


| Basic Information | |
|---|---|
| Family ID | F069296 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AEDVFSYDVSGDGQRFLIITKVDEANAAPLSILLNWASEMEK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.63 % |
| % of genes near scaffold ends (potentially truncated) | 92.74 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.710 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.452 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.903 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.323 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.86% Coil/Unstructured: 77.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 4.03 |
| PF00291 | PALP | 4.03 |
| PF07676 | PD40 | 3.23 |
| PF00383 | dCMP_cyt_deam_1 | 2.42 |
| PF08207 | EFP_N | 2.42 |
| PF12697 | Abhydrolase_6 | 2.42 |
| PF01364 | Peptidase_C25 | 1.61 |
| PF02618 | YceG | 1.61 |
| PF08922 | DUF1905 | 1.61 |
| PF05697 | Trigger_N | 1.61 |
| PF04389 | Peptidase_M28 | 1.61 |
| PF13442 | Cytochrome_CBB3 | 1.61 |
| PF14437 | MafB19-deam | 0.81 |
| PF03703 | bPH_2 | 0.81 |
| PF00708 | Acylphosphatase | 0.81 |
| PF16870 | OxoGdeHyase_C | 0.81 |
| PF13578 | Methyltransf_24 | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF01546 | Peptidase_M20 | 0.81 |
| PF04542 | Sigma70_r2 | 0.81 |
| PF00839 | Cys_rich_FGFR | 0.81 |
| PF00118 | Cpn60_TCP1 | 0.81 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.81 |
| PF16363 | GDP_Man_Dehyd | 0.81 |
| PF06831 | H2TH | 0.81 |
| PF00117 | GATase | 0.81 |
| PF13594 | Obsolete Pfam Family | 0.81 |
| PF04986 | Y2_Tnp | 0.81 |
| PF13429 | TPR_15 | 0.81 |
| PF02371 | Transposase_20 | 0.81 |
| PF00271 | Helicase_C | 0.81 |
| PF00266 | Aminotran_5 | 0.81 |
| PF01850 | PIN | 0.81 |
| PF13414 | TPR_11 | 0.81 |
| PF02803 | Thiolase_C | 0.81 |
| PF13463 | HTH_27 | 0.81 |
| PF14534 | DUF4440 | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF13520 | AA_permease_2 | 0.81 |
| PF05036 | SPOR | 0.81 |
| PF00753 | Lactamase_B | 0.81 |
| PF13240 | zinc_ribbon_2 | 0.81 |
| PF01266 | DAO | 0.81 |
| PF08447 | PAS_3 | 0.81 |
| PF01527 | HTH_Tnp_1 | 0.81 |
| PF09285 | Elong-fact-P_C | 0.81 |
| PF12867 | DinB_2 | 0.81 |
| PF13328 | HD_4 | 0.81 |
| PF13495 | Phage_int_SAM_4 | 0.81 |
| PF02604 | PhdYeFM_antitox | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF00196 | GerE | 0.81 |
| PF00731 | AIRC | 0.81 |
| PF13432 | TPR_16 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 16.13 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 2.42 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.81 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.81 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.81 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.81 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.81 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.81 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.81 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.71 % |
| Unclassified | root | N/A | 11.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02TNX3M | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300001593|JGI12635J15846_10211904 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300001593|JGI12635J15846_10274959 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100649980 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100755251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 852 | Open in IMG/M |
| 3300002914|JGI25617J43924_10242860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 607 | Open in IMG/M |
| 3300002917|JGI25616J43925_10293644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 606 | Open in IMG/M |
| 3300004092|Ga0062389_102094192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 741 | Open in IMG/M |
| 3300005167|Ga0066672_10451272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300005184|Ga0066671_10315437 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300005332|Ga0066388_100360937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2099 | Open in IMG/M |
| 3300005332|Ga0066388_107942076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 531 | Open in IMG/M |
| 3300005435|Ga0070714_101592005 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005437|Ga0070710_10617719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 756 | Open in IMG/M |
| 3300005471|Ga0070698_101691708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 585 | Open in IMG/M |
| 3300005555|Ga0066692_10147598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1441 | Open in IMG/M |
| 3300005575|Ga0066702_10119580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1528 | Open in IMG/M |
| 3300005829|Ga0074479_10040373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300005921|Ga0070766_10882861 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005938|Ga0066795_10254958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 519 | Open in IMG/M |
| 3300006050|Ga0075028_100038650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2235 | Open in IMG/M |
| 3300006059|Ga0075017_100377650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300006162|Ga0075030_100169792 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300006172|Ga0075018_10120281 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300006172|Ga0075018_10580033 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006175|Ga0070712_100773222 | Not Available | 823 | Open in IMG/M |
| 3300006854|Ga0075425_101254600 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006893|Ga0073928_10900845 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009038|Ga0099829_10229704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1509 | Open in IMG/M |
| 3300009088|Ga0099830_11367965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300009090|Ga0099827_11948824 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009143|Ga0099792_10060942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1871 | Open in IMG/M |
| 3300009143|Ga0099792_11219100 | Not Available | 511 | Open in IMG/M |
| 3300010159|Ga0099796_10579840 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010376|Ga0126381_101220760 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300010376|Ga0126381_102968779 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010379|Ga0136449_101549325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300010398|Ga0126383_10049916 | Not Available | 3477 | Open in IMG/M |
| 3300010398|Ga0126383_12769393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300011120|Ga0150983_13839335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300011269|Ga0137392_10229430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| 3300011270|Ga0137391_10399274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300011270|Ga0137391_11157150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012198|Ga0137364_11240140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300012199|Ga0137383_10052283 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
| 3300012202|Ga0137363_10119378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2032 | Open in IMG/M |
| 3300012202|Ga0137363_10184887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1662 | Open in IMG/M |
| 3300012203|Ga0137399_10686505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300012203|Ga0137399_10795554 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 796 | Open in IMG/M |
| 3300012203|Ga0137399_11584234 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012205|Ga0137362_10314796 | Not Available | 1355 | Open in IMG/M |
| 3300012205|Ga0137362_10396298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300012205|Ga0137362_10606494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300012206|Ga0137380_10652402 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012206|Ga0137380_11689564 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012207|Ga0137381_10616729 | Not Available | 945 | Open in IMG/M |
| 3300012207|Ga0137381_11130721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300012209|Ga0137379_10293219 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300012209|Ga0137379_10458123 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300012209|Ga0137379_10641388 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300012349|Ga0137387_10047654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2847 | Open in IMG/M |
| 3300012349|Ga0137387_10368669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300012349|Ga0137387_10435028 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300012349|Ga0137387_10557466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300012359|Ga0137385_10849142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300012361|Ga0137360_10020689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4391 | Open in IMG/M |
| 3300012362|Ga0137361_10375548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300012917|Ga0137395_10846004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300012918|Ga0137396_10797845 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012923|Ga0137359_11372255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300012925|Ga0137419_10006638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5937 | Open in IMG/M |
| 3300012925|Ga0137419_10047971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2738 | Open in IMG/M |
| 3300012977|Ga0134087_10194875 | Not Available | 904 | Open in IMG/M |
| 3300015242|Ga0137412_10986357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300017933|Ga0187801_10407018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300017970|Ga0187783_10093397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2217 | Open in IMG/M |
| 3300017972|Ga0187781_11404494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300018016|Ga0187880_1078051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1683 | Open in IMG/M |
| 3300019890|Ga0193728_1184300 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300019890|Ga0193728_1203485 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300020583|Ga0210401_10909192 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300020583|Ga0210401_11522836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300021046|Ga0215015_10227729 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300021046|Ga0215015_11089351 | Not Available | 689 | Open in IMG/M |
| 3300021168|Ga0210406_10322124 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300021432|Ga0210384_10294611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1460 | Open in IMG/M |
| 3300021433|Ga0210391_11398599 | Not Available | 538 | Open in IMG/M |
| 3300021474|Ga0210390_10240598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
| 3300025159|Ga0209619_10071905 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300025322|Ga0209641_10407892 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025898|Ga0207692_10628325 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025915|Ga0207693_10938087 | Not Available | 663 | Open in IMG/M |
| 3300025945|Ga0207679_10779892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300026285|Ga0209438_1105937 | Not Available | 836 | Open in IMG/M |
| 3300026318|Ga0209471_1104326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300026320|Ga0209131_1187246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PCS3-D2 | 987 | Open in IMG/M |
| 3300026376|Ga0257167_1036603 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026497|Ga0257164_1089853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026514|Ga0257168_1093849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300026551|Ga0209648_10288314 | Not Available | 1185 | Open in IMG/M |
| 3300026552|Ga0209577_10656664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300027660|Ga0209736_1007413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3576 | Open in IMG/M |
| 3300027663|Ga0208990_1077367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
| 3300027678|Ga0209011_1031289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1689 | Open in IMG/M |
| 3300027825|Ga0209039_10322065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027842|Ga0209580_10101976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1389 | Open in IMG/M |
| 3300027854|Ga0209517_10158595 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300027894|Ga0209068_10046739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2186 | Open in IMG/M |
| 3300027905|Ga0209415_10012054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14461 | Open in IMG/M |
| 3300027911|Ga0209698_11195869 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027915|Ga0209069_10713292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300028857|Ga0302289_1110729 | Not Available | 632 | Open in IMG/M |
| 3300028906|Ga0308309_11373081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300031754|Ga0307475_11351675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300031962|Ga0307479_11586357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300032059|Ga0318533_11439401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300032094|Ga0318540_10470042 | Not Available | 607 | Open in IMG/M |
| 3300032173|Ga0315268_10708825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300032174|Ga0307470_11929920 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032180|Ga0307471_100026058 | All Organisms → cellular organisms → Bacteria | 4404 | Open in IMG/M |
| 3300032180|Ga0307471_103456932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300032205|Ga0307472_101521038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300033004|Ga0335084_11752343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028857 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_06486480 | 2070309004 | Green-Waste Compost | MDFFTYDVTADGQKFLVNSKVDTSVAAPLSVVLNWPSETEK |
| JGI12635J15846_102119041 | 3300001593 | Forest Soil | LPSVLFQTHRRQPVSAQDFFSYDVSGDGKRFLIATRVDEANAAPLSVLLNWASEMEK* |
| JGI12635J15846_102749591 | 3300001593 | Forest Soil | DVSGDGQRFLIATKVDEANAAPLSILLNWASDMEK* |
| JGIcombinedJ26739_1006499804 | 3300002245 | Forest Soil | HPRQPVSASDVFSYDVSGDGQRFLILSKVDEANPAPLSVLLNWASEMEK* |
| JGIcombinedJ26739_1007552512 | 3300002245 | Forest Soil | SQDHFSYDVSGDGQRFLIITKVDEANAAPLTILLNWASQMDK* |
| JGI25617J43924_102428601 | 3300002914 | Grasslands Soil | TRRRQPVSAQDVFSYDVSGDGQRFLIATKADEGNAAPLSVLLNWASAMEK* |
| JGI25616J43925_102936441 | 3300002917 | Grasslands Soil | MAVALKTGTSFKAESPVALFQTQRRQPISSFAVFSYDVSGDGRRFLVITKVDEGNAAPLSVHLNWASEMEK* |
| Ga0062389_1020941921 | 3300004092 | Bog Forest Soil | VFSYDVSGDGRRFLVITKTDEANAAPLTVLLNWASEMEK* |
| Ga0066672_104512722 | 3300005167 | Soil | ALFQTRRRQPISAQDVFSYDVSGDGKKFMVATKVDEPNGAPLSVLLNWASEIEK* |
| Ga0066671_103154371 | 3300005184 | Soil | SAQDVFSYDVSGDGKKFLIATRVDEGNAAPLSILLNWASQMDN* |
| Ga0066388_1003609371 | 3300005332 | Tropical Forest Soil | MDVVSYDVSADGQKFLVNTKMVDPNPAPMSIILNWRAQMEK* |
| Ga0066388_1079420762 | 3300005332 | Tropical Forest Soil | QDVFSYDVSGDGQRFLIATKVDEASTAPLTILLNWALEMEK* |
| Ga0070714_1015920051 | 3300005435 | Agricultural Soil | RQPMSVLDFFSYDVSPDGQKFLLATKVDEDTTAPLGILMNWESEMTK* |
| Ga0070710_106177192 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QPVALFETHRRQPMSVLDFFSYDVSPDGQKFLLATKVDEDTTAPLGILMNWESEMTK* |
| Ga0070698_1016917081 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DAFSYDVNADGQKFLINTRVNEPSVPPLAIILNWASEMEK* |
| Ga0066692_101475983 | 3300005555 | Soil | LSAMDFFTYDVTGDGQKFLVNSKVDISNTAPLSVVLNWASETEK* |
| Ga0066702_101195802 | 3300005575 | Soil | SSGDVVSYDVSADGQKFLINTRVDEPNAARLSVTLNWSSELEK* |
| Ga0074479_100403731 | 3300005829 | Sediment (Intertidal) | TIALFQTNRRQAVSSQDVFSYDVTGDGQRFLIVTHVDEGSFVPPSVILDWASESEK* |
| Ga0070766_108828612 | 3300005921 | Soil | ISAQDAFSYDVTSDGQKFLIITRTDEASAAPPSVLLNWASEMEK* |
| Ga0066795_102549581 | 3300005938 | Soil | VFSYDVSGDGQRFLIATKVDEVNAAPLSILLNWASQMEK* |
| Ga0075028_1000386504 | 3300006050 | Watersheds | FSYDVSGNGQRFLIATKMDEANAAPLAITLNWASELEK* |
| Ga0075017_1003776501 | 3300006059 | Watersheds | DFFSYDVTSDGQKFLIDTKIDEPNAAPLSVFLNWAGETGK* |
| Ga0075030_1001697923 | 3300006162 | Watersheds | RQPNSSQDHFSYDVSPDGQKFLVITKMDEANPAPLSVLLNWSSEMDK* |
| Ga0075018_101202813 | 3300006172 | Watersheds | RQPISAMDFFSYDVTGDGQKFLVNTKVDTTNAAPLSIILNWSSDLEK* |
| Ga0075018_105800332 | 3300006172 | Watersheds | FSYDVSGDGQRFLVITKVDEANAAPLSILLNWASQMDK* |
| Ga0070712_1007732221 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DFFTYDVTGDGQKFLVNSKVDISNTAPLSVVLNWASETEK* |
| Ga0075425_1012546001 | 3300006854 | Populus Rhizosphere | PVALFQAHCRQPISSQDLFCYAISDDGQRFLIATKVDEANTAPLSVFLNWASEIEK* |
| Ga0073928_109008451 | 3300006893 | Iron-Sulfur Acid Spring | PVALFQTHRRQPISTLDVFSYDVSGDGQRFLVITKQDEAHAAPLSIHLNWASEMEK* |
| Ga0099829_102297041 | 3300009038 | Vadose Zone Soil | AEDVFSYDVSGDGQRFLIITKVDEANAAPLSILLNWASEMEK* |
| Ga0099830_113679651 | 3300009088 | Vadose Zone Soil | RQPVSSQDVFSYDVSGDGQRLLIATKMDEPNAAPLSVILNWASEMDR* |
| Ga0099827_119488241 | 3300009090 | Vadose Zone Soil | AQDVFSYDVSGDGKRFLILTKLDETNAAPLSVLLNWASETEK* |
| Ga0099792_100609423 | 3300009143 | Vadose Zone Soil | QTHLRQAISAQDVFSYAVTGDGQKFLINTKVDEPNAAPLSIILNWASEMEK* |
| Ga0099792_112191002 | 3300009143 | Vadose Zone Soil | PVSAQDFFSYDVSSDGQKFLIATRVDEANSAPLTVLLNWTSEMEK* |
| Ga0099796_105798401 | 3300010159 | Vadose Zone Soil | MLFQTHLRQAISAQDVFSCDVTGDGQKFLINTKVDEPNAVPLSIILNWASEMEK* |
| Ga0126381_1012207602 | 3300010376 | Tropical Forest Soil | SSQDLFSYDVSADGQKFLVATKLDEARAAPLSVLLNWATGMEK* |
| Ga0126381_1029687792 | 3300010376 | Tropical Forest Soil | FTTHRRQHISSQDVFSYDVSHDGQKFLIVTSVDQAQVTPLSILLNWTSQPQK* |
| Ga0136449_1015493251 | 3300010379 | Peatlands Soil | DVSGDGQRFLIATKVDEANAAPLSVLLNWASQMEK* |
| Ga0126383_100499161 | 3300010398 | Tropical Forest Soil | APVALFTTHRRQHISSQDVFSYDVSHDGQKFLIVTSVDQAQVTSLSILLNWTSEPQK* |
| Ga0126383_127693932 | 3300010398 | Tropical Forest Soil | FSYDVSSDGQRFLIITKVDEANAAPLSVLLNWASQMEK* |
| Ga0150983_138393351 | 3300011120 | Forest Soil | VKFLTHRRQPVSSQDQFSYDVRADGQKFLVITKVDEANAAPLSVLLNWASEMEK* |
| Ga0137392_102294303 | 3300011269 | Vadose Zone Soil | RQPVSSQDVFSYDVSGDGQRFLILTKMDEANPAPLSVLLNWTSEMER* |
| Ga0137391_103992743 | 3300011270 | Vadose Zone Soil | VSSQDVFSYDVSGDGQRFLILTKMDEANAAPLSITLNWASEMER* |
| Ga0137391_111571501 | 3300011270 | Vadose Zone Soil | QRRQPVSSFAVFSYDVSGDGRRFLVIGKAGEATAAPLTVLLNWASEMEK* |
| Ga0137364_112401401 | 3300012198 | Vadose Zone Soil | PISAQDRFSYDVSGDGQRFLINTKLDEANVAPLFLYLNWDSEMEK* |
| Ga0137383_100522833 | 3300012199 | Vadose Zone Soil | MDAAGAFQQDRFSYDVSGDGQRFLINTKIEEANVAPLSIHLNWASEMEK* |
| Ga0137363_101193782 | 3300012202 | Vadose Zone Soil | RQPISSMDLFSYDVTADGQKFLVNTRFDEPNAAPLSIILNWASEMER* |
| Ga0137363_101848871 | 3300012202 | Vadose Zone Soil | RQPISSMDLFSYDVTADGQKFLVNTRFDEPNAAPLSIILNWSSEMER* |
| Ga0137399_106865052 | 3300012203 | Vadose Zone Soil | RFSYDVSGDGQKFLINTKIEEANVAPLSIHLNWASEMEK* |
| Ga0137399_107955542 | 3300012203 | Vadose Zone Soil | RRRQPISAQDVFSYDVSGDGKKFLIATKVDEANAAPVSVLLNWASHMDK* |
| Ga0137399_115842342 | 3300012203 | Vadose Zone Soil | RQAISAQDVFSYDVSGDGKRFLILTKLDETNAAPLFVLLNWASETEK* |
| Ga0137362_103147962 | 3300012205 | Vadose Zone Soil | SAQDVFSYDVSGDGKRFLILTKLDEANAAPLFVLLNWASETEK* |
| Ga0137362_103962981 | 3300012205 | Vadose Zone Soil | HARQPVSSQDHSSYDVSGDGQRFLIITKMDEANAAPLSVLLNWASEMEK* |
| Ga0137362_106064941 | 3300012205 | Vadose Zone Soil | SPVALFQTQRRQPVSSFAVFSYDVSGDGRRFLVITKVGEAYAAPLSVHLNWASEMEK* |
| Ga0137380_106524021 | 3300012206 | Vadose Zone Soil | PVALFQTQRRQPISSFAVFSYDVSGDGRRFLVITKVGEANDAPLSVHLNWASEMEK* |
| Ga0137380_116895642 | 3300012206 | Vadose Zone Soil | THTRQQISFMDVFSYDVTGDGQKFLINTKVDEADASPLSIILNWESEMER* |
| Ga0137381_106167292 | 3300012207 | Vadose Zone Soil | LRQPISAMDFFSYDLTGDGQKFLVNAKLDTSNAAPLSIILNWPSEMGK* |
| Ga0137381_111307212 | 3300012207 | Vadose Zone Soil | SYDVSADGQKFLINTRVNEPSAPPLAIILNWASEMEK* |
| Ga0137379_102932194 | 3300012209 | Vadose Zone Soil | AEAPVALFQTQRRQPISSFAVFSYDVSGDGRRFLVITKMGEANAAPLSVHLNWASEMEK* |
| Ga0137379_104581231 | 3300012209 | Vadose Zone Soil | PIQGPDVVSYDVTGDGQRFLINTKVDDPNAAPLAVIVNWRSQVEK* |
| Ga0137379_106413881 | 3300012209 | Vadose Zone Soil | QQISFMDVFSYDVTGDGQKFLINTKVDEADASPLSIILNWESEMER* |
| Ga0137387_100476541 | 3300012349 | Vadose Zone Soil | DVSGDGRRFLVITKAGEANAAPLSVHLNWASEMEK* |
| Ga0137387_103686692 | 3300012349 | Vadose Zone Soil | LAQPIQGPDVVSYDVTGDGQRFLINTKVDDPNAAPLAVIVNWRSQVEK* |
| Ga0137387_104350282 | 3300012349 | Vadose Zone Soil | ASFKAEAPVALFQTQRRQPISSFAVFSYDVSGDGRRFLVITKMGEANAAPLSVHLNWASEMEK* |
| Ga0137387_105574661 | 3300012349 | Vadose Zone Soil | PVSAGTSFESGSPVALFQTHRRQPISSQDILSYDVSADGHKFLIATKVDEGDAAPLSVLLNWSSALEK* |
| Ga0137385_108491421 | 3300012359 | Vadose Zone Soil | RQPVSFMDAFSYDVTSDGQKFMINTRMDEASAAPLSVVLNWASEVEK* |
| Ga0137360_100206894 | 3300012361 | Vadose Zone Soil | MDLFSYDVTADGQKFLVNTRFDEPNAAPLSIILNWASEMER* |
| Ga0137361_103755482 | 3300012362 | Vadose Zone Soil | VSGDGQRFLVITKMDEANAAPLSILLNWASEMEK* |
| Ga0137395_108460042 | 3300012917 | Vadose Zone Soil | YDVTSDGQKFLINTKVDEPNAAPLAIVLNWASEIEK* |
| Ga0137396_107978452 | 3300012918 | Vadose Zone Soil | PVSSQDVFSYDVSGDGQRFLIATKVDEANAAPLSILLNWASEMGK* |
| Ga0137359_113722551 | 3300012923 | Vadose Zone Soil | HRRQPISSQDILSYDVSADGQKFLVATRVDESAVAPLSVLLNWTSSIEK* |
| Ga0137419_100066386 | 3300012925 | Vadose Zone Soil | FSYDVTRDGQKFLVNTKVDEPNAAPLSIILNWASEMEK* |
| Ga0137419_100479712 | 3300012925 | Vadose Zone Soil | MDLFSYDLTVDGQKFLINARVDEPSSAPLSIILNWASEIEK* |
| Ga0134087_101948751 | 3300012977 | Grasslands Soil | ISAMDLFWYHLTVDGQKSLINARVDEPSSAPLSIILNWASEIEK* |
| Ga0137412_109863571 | 3300015242 | Vadose Zone Soil | ISAQDRFSYDVSGDGQRFLINTKIEEANVAPLSIHLNWASEMEK* |
| Ga0187801_104070181 | 3300017933 | Freshwater Sediment | QTHRRLPVSSLDDFSYDVSGDGQRFLIATKVDQANSPPLSILLNWASQMEK |
| Ga0187783_100933972 | 3300017970 | Tropical Peatland | RQAVSAQDVFSYDVSGDGEKFLILTKMDEGNPAPLSVILNWASEMEK |
| Ga0187781_114044941 | 3300017972 | Tropical Peatland | TLFQTHRRQPISAQDAFSYDVSSDGQKFLIIARTEEAGAAPPSVLLNWASEIEK |
| Ga0187880_10780512 | 3300018016 | Peatland | QVSSLDDFSYDVSGDGQRFLIATKVDEANAAPLSVLLNWVSQMEK |
| Ga0193728_11843001 | 3300019890 | Soil | QDLFSYDVSSDGQRFLIANKLDEPNAAPLSVLLNWASEIER |
| Ga0193728_12034852 | 3300019890 | Soil | MAVPVRLGANFEAGPPVVLFQTHLRQPISAQDVFSYDVSGDGQNFLVNTKVDEPNAAPLSIILNWASEMEK |
| Ga0210401_109091921 | 3300020583 | Soil | VTLFQTHRRQPISAQDAFSYDVSSDGQKFLIITRMDEVSAAPPSVLLNWASEMEK |
| Ga0210401_115228362 | 3300020583 | Soil | FSYDVSGDGQRFLIITKVDEANAPLSVLLNWASEMEK |
| Ga0215015_102277294 | 3300021046 | Soil | YDVTGDGQKFLVNTKVDEPNAAPLSIILNWASEMEK |
| Ga0215015_110893511 | 3300021046 | Soil | FSYDVSGDGQRFLIATKVDETTAAPLSITLNWASEMEK |
| Ga0210406_103221244 | 3300021168 | Soil | DLVSYDATGDGQKFLINTKVDEPNAAPLSITLNWASEMEK |
| Ga0210384_102946111 | 3300021432 | Soil | DAFTYDVSRDGQKFLINTRMDESNAAPLSIILNWSSELEK |
| Ga0210391_113985991 | 3300021433 | Soil | PISSYDLVSYDVTGDGQKFLINTKVDEPNAAPLSITMNWASEMEK |
| Ga0210390_102405981 | 3300021474 | Soil | PISSFAVFSYDVSGDGQRFLIITKMDEASAAPLSVFLNWASEMEK |
| Ga0209619_100719053 | 3300025159 | Soil | PIALFQAHRRQPVSSFDLFSYAVSGDGNRFLIATKLDDARAAPLSVFLNWTSEMEK |
| Ga0209641_104078921 | 3300025322 | Soil | LFQAHRRQPVSSFDLFSYAVSGDGNRFLIATKLDEASAAPLSVFLNWTSEMET |
| Ga0207692_106283252 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GQPVALFETHRRQPMSVLDFFSYDVSPDGQKFLLATKVDEDTTAPLGILMNWESEMTK |
| Ga0207693_109380871 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFFTYDVTGDGQKFLVNSKVDISNTAPLSVVLNWASETEK |
| Ga0207679_107798921 | 3300025945 | Corn Rhizosphere | ISAQDVFSYDVSADGQRFLIITKVDEANAAPLSVFLNWTSQIEK |
| Ga0209438_11059371 | 3300026285 | Grasslands Soil | LFQTHRRQPVSAQDFFSYDVSGDGQKFLIATRVDEPNSAPLTVLLNWTSEMEK |
| Ga0209471_11043262 | 3300026318 | Soil | HLRQPISSMDLFSYDVTADGQKFLVNTRFDEPNAAPLSIILNWASEMER |
| Ga0209131_11872461 | 3300026320 | Grasslands Soil | DVSGDGKRFLILTKLDEANAAPLFVLLNWASETEK |
| Ga0257167_10366032 | 3300026376 | Soil | LFQTHRRQPVSSQDVFSYDVSGDGQRFLIATKVDEANAAPLSILLNWASEMEK |
| Ga0257164_10898531 | 3300026497 | Soil | MDLFSYDVPTDGQKFIINTRLGEPNVARLSIILNWVSEMEK |
| Ga0257168_10938491 | 3300026514 | Soil | VFPYDVSGDGQQRFLANTKGDESNGAPLPIILNWASEMEK |
| Ga0209648_102883142 | 3300026551 | Grasslands Soil | SYDVSGDGKRFLILTKLDEANAAPLFVLLNWASETEK |
| Ga0209577_106566642 | 3300026552 | Soil | KTTTAGFEGGTPIALFQTRRRQPISAQDVFSYDVSGDGKKFMVATKVDEPNGAPLSVLLNWASEIEK |
| Ga0209736_10074136 | 3300027660 | Forest Soil | LFQTHRRQPVSSQDVFSYDVSGDGQRFLIATKMDEGNAAPLSITLNWASDMEK |
| Ga0208990_10773672 | 3300027663 | Forest Soil | AMDFFSYDVTSDGQKFLVNTRVDTSNSAPLSIILNWSSEMEK |
| Ga0209011_10312894 | 3300027678 | Forest Soil | MFSYDVTSDGQKFLINTKVDEPNAAPLSIVLNWASEMEK |
| Ga0209039_103220651 | 3300027825 | Bog Forest Soil | SSFAVFSYDVSGDGRRFLVITKVDEPSAAPLSILLNWASGMGK |
| Ga0209580_101019761 | 3300027842 | Surface Soil | YDVTADGQKFLVNSKVDMSNSAPLSVVLNWASETEK |
| Ga0209517_101585952 | 3300027854 | Peatlands Soil | VLNDLRISTHRRLPVSSQDDFSYDVSGDGQRFLIATKVDEANAAPLSVLLNWASQMEK |
| Ga0209068_100467394 | 3300027894 | Watersheds | HRRQPVSSLDVFSYDVSGDGQRFLIATRVDEANAPPLSVLLNWASELEK |
| Ga0209415_100120547 | 3300027905 | Peatlands Soil | DVSGDGQRFLIATKVDEANAAPLSVLLNWASQMEK |
| Ga0209698_111958692 | 3300027911 | Watersheds | QDHFSYDVSPDGQKFLVITKMDDANPAPLSILLNWSAKVDK |
| Ga0209069_107132922 | 3300027915 | Watersheds | MSSQDLFSYDVSADGQRFLIASKVDEVNAAPLSIFLNWSSQLEK |
| Ga0302289_11107291 | 3300028857 | Fen | YDVSADGQRFLIATQVDESSVAPLSVFLNWTSAMDK |
| Ga0308309_113730811 | 3300028906 | Soil | QTHRRQPVSAQDAFSYDVSSDGQKFLIITRMDEVSAAPPSVLLNWASEMEK |
| Ga0307475_113516751 | 3300031754 | Hardwood Forest Soil | RQPISAQDVFSYDVTGDGQKFLINTKVDEPNAAPLSIILNWASEMEK |
| Ga0307479_115863572 | 3300031962 | Hardwood Forest Soil | VLFQTHLRQPISAQDVFSYDVTGDGQKFLINTKVDEPNAAPLSIILNWASEMEK |
| Ga0318533_114394012 | 3300032059 | Soil | HRRQPVSSQDHFSYDVSADGKKFLIITKVEEANAAPLAVLLNWSSEMEK |
| Ga0318540_104700421 | 3300032094 | Soil | FQTYARQSTGVMDAFSYDVDADGHKFLINTRVNEPSAPPLPIILNWASEMAE |
| Ga0315268_107088251 | 3300032173 | Sediment | KALFQTHRRQPVSAQDVFSYDLSGDGQRFLVITKVDEGKTAPLAVMLNWAAEMEK |
| Ga0307470_119299201 | 3300032174 | Hardwood Forest Soil | TALFLTHLRQPISAMDFFSYDVTDDGQKFLVNAKLDTSNAAPLAVILNWRSEMEK |
| Ga0307471_1000260581 | 3300032180 | Hardwood Forest Soil | SQDLFSFDVCADGQRFLVCTKLDEANAAPLAITLNWASDLEK |
| Ga0307471_1034569322 | 3300032180 | Hardwood Forest Soil | QTHRRQRVSTQDVFSYDVSGDGQRFLIITKVDEPNAAPLSVLLNWASEMEK |
| Ga0307472_1015210381 | 3300032205 | Hardwood Forest Soil | QTHRRQPVSFLDVFSYDVSGDGKRFLIATKIDEANTAPLSVLLNWASEMEK |
| Ga0335084_117523431 | 3300033004 | Soil | PISSLDVFSYDVNADGSRFLINTKVDSASAPPPSIILNWASEMEK |
| Ga0335077_104580751 | 3300033158 | Soil | DLFSYAVSADGQRFLVATQVTETNAAPLAVRLNWTSGLGK |
| ⦗Top⦘ |