


| Basic Information | |
|---|---|
| Family ID | F069289 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MILLAIAGSTIGAWWRRAILALTHPAPRSKSDVPPEFYRFPIF |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.61 % |
| % of genes near scaffold ends (potentially truncated) | 29.03 % |
| % of genes from short scaffolds (< 2000 bps) | 92.74 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.452 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.677 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.323 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF06568 | DUF1127 | 56.45 |
| PF00126 | HTH_1 | 7.26 |
| PF03466 | LysR_substrate | 5.65 |
| PF00465 | Fe-ADH | 1.61 |
| PF06779 | MFS_4 | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF14681 | UPRTase | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 56.45 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 1.61 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 1.61 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 1.61 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 1.61 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.45 % |
| Unclassified | root | N/A | 18.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10120608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 518 | Open in IMG/M |
| 3300002914|JGI25617J43924_10082997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300003368|JGI26340J50214_10046618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1216 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10288870 | Not Available | 667 | Open in IMG/M |
| 3300004080|Ga0062385_10206379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1065 | Open in IMG/M |
| 3300004082|Ga0062384_100163922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
| 3300004631|Ga0058899_10027880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1484 | Open in IMG/M |
| 3300005174|Ga0066680_10583154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300005175|Ga0066673_10028674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2652 | Open in IMG/M |
| 3300005177|Ga0066690_10699667 | Not Available | 671 | Open in IMG/M |
| 3300005184|Ga0066671_10031384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2499 | Open in IMG/M |
| 3300005434|Ga0070709_10287509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 3300005435|Ga0070714_101927057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 577 | Open in IMG/M |
| 3300005436|Ga0070713_100281630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1525 | Open in IMG/M |
| 3300005561|Ga0066699_10637148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 765 | Open in IMG/M |
| 3300005568|Ga0066703_10697803 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005576|Ga0066708_10636147 | Not Available | 681 | Open in IMG/M |
| 3300005602|Ga0070762_10406019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300005602|Ga0070762_10595540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300005610|Ga0070763_10027308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2579 | Open in IMG/M |
| 3300005610|Ga0070763_10177012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1127 | Open in IMG/M |
| 3300005921|Ga0070766_10353182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300005921|Ga0070766_11234307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 517 | Open in IMG/M |
| 3300006172|Ga0075018_10473597 | Not Available | 649 | Open in IMG/M |
| 3300006175|Ga0070712_100522376 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300006176|Ga0070765_100005862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8186 | Open in IMG/M |
| 3300006176|Ga0070765_100165620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1984 | Open in IMG/M |
| 3300006800|Ga0066660_11125866 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006893|Ga0073928_10252115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300006954|Ga0079219_10307100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 987 | Open in IMG/M |
| 3300007788|Ga0099795_10237004 | Not Available | 782 | Open in IMG/M |
| 3300009092|Ga0105250_10461903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces phyllanthi | 571 | Open in IMG/M |
| 3300009137|Ga0066709_101140553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
| 3300009147|Ga0114129_12710042 | Not Available | 590 | Open in IMG/M |
| 3300009156|Ga0111538_10487569 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300010083|Ga0127478_1020553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300010159|Ga0099796_10330294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300010859|Ga0126352_1073292 | Not Available | 510 | Open in IMG/M |
| 3300010861|Ga0126349_1030187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1314 | Open in IMG/M |
| 3300011120|Ga0150983_10133146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300011120|Ga0150983_13019415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300012198|Ga0137364_10620979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300012202|Ga0137363_10929444 | Not Available | 738 | Open in IMG/M |
| 3300012212|Ga0150985_101901963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300012212|Ga0150985_110824539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012391|Ga0134035_1094447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 509 | Open in IMG/M |
| 3300012469|Ga0150984_101521517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1743 | Open in IMG/M |
| 3300012582|Ga0137358_10389884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 942 | Open in IMG/M |
| 3300012915|Ga0157302_10463598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 538 | Open in IMG/M |
| 3300016319|Ga0182033_11193531 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300016357|Ga0182032_11119194 | Not Available | 676 | Open in IMG/M |
| 3300016445|Ga0182038_11919514 | Not Available | 535 | Open in IMG/M |
| 3300018433|Ga0066667_11419591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300020080|Ga0206350_11498775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1394 | Open in IMG/M |
| 3300020579|Ga0210407_10099746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2205 | Open in IMG/M |
| 3300020579|Ga0210407_10634253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
| 3300020579|Ga0210407_11198346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300020580|Ga0210403_10163892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1820 | Open in IMG/M |
| 3300020581|Ga0210399_11085220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300020582|Ga0210395_11020375 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300020583|Ga0210401_10269422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1562 | Open in IMG/M |
| 3300021151|Ga0179584_1041560 | Not Available | 623 | Open in IMG/M |
| 3300021151|Ga0179584_1490563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 904 | Open in IMG/M |
| 3300021170|Ga0210400_10549693 | Not Available | 952 | Open in IMG/M |
| 3300021170|Ga0210400_10673092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300021374|Ga0213881_10003660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6475 | Open in IMG/M |
| 3300021377|Ga0213874_10185906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300021401|Ga0210393_10373584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300021405|Ga0210387_10306584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1397 | Open in IMG/M |
| 3300021407|Ga0210383_10729030 | Not Available | 851 | Open in IMG/M |
| 3300021407|Ga0210383_11265520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300021420|Ga0210394_10022975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5722 | Open in IMG/M |
| 3300021432|Ga0210384_10521174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1069 | Open in IMG/M |
| 3300021433|Ga0210391_11391188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300021439|Ga0213879_10093287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300021478|Ga0210402_10608623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1012 | Open in IMG/M |
| 3300021479|Ga0210410_11304134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300021559|Ga0210409_11007369 | Not Available | 707 | Open in IMG/M |
| 3300021559|Ga0210409_11705567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300021560|Ga0126371_11871267 | Not Available | 720 | Open in IMG/M |
| 3300021858|Ga0213852_1477557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300021860|Ga0213851_1516348 | Not Available | 1442 | Open in IMG/M |
| 3300022504|Ga0242642_1011948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
| 3300022513|Ga0242667_1030488 | Not Available | 613 | Open in IMG/M |
| 3300022525|Ga0242656_1028928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300022527|Ga0242664_1007091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1467 | Open in IMG/M |
| 3300022528|Ga0242669_1134795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 506 | Open in IMG/M |
| 3300022709|Ga0222756_1038512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300022716|Ga0242673_1094195 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300022724|Ga0242665_10094222 | Not Available | 878 | Open in IMG/M |
| 3300026312|Ga0209153_1234770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300026330|Ga0209473_1230366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 663 | Open in IMG/M |
| 3300026538|Ga0209056_10331881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
| 3300026551|Ga0209648_10264272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300026552|Ga0209577_10756343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300026557|Ga0179587_10917669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300027065|Ga0208489_1005821 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300027583|Ga0209527_1038938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300027698|Ga0209446_1157306 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027737|Ga0209038_10012884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2452 | Open in IMG/M |
| 3300027783|Ga0209448_10082017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1081 | Open in IMG/M |
| 3300027812|Ga0209656_10001405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 15733 | Open in IMG/M |
| 3300027829|Ga0209773_10217106 | Not Available | 799 | Open in IMG/M |
| 3300027884|Ga0209275_10066858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1771 | Open in IMG/M |
| 3300027889|Ga0209380_10161949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1309 | Open in IMG/M |
| 3300027903|Ga0209488_10351974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1095 | Open in IMG/M |
| 3300030730|Ga0307482_1109417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 766 | Open in IMG/M |
| 3300030730|Ga0307482_1178778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300030902|Ga0308202_1029595 | Not Available | 915 | Open in IMG/M |
| 3300030975|Ga0099845_1568587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300031022|Ga0138301_1003641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300031057|Ga0170834_106281717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300031057|Ga0170834_109936563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300031091|Ga0308201_10434170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300031092|Ga0308204_10052496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300031231|Ga0170824_109290347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300031231|Ga0170824_128584184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1486 | Open in IMG/M |
| 3300031561|Ga0318528_10576651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 604 | Open in IMG/M |
| 3300031590|Ga0307483_1006118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300031679|Ga0318561_10354180 | Not Available | 805 | Open in IMG/M |
| 3300031821|Ga0318567_10274402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 949 | Open in IMG/M |
| 3300031866|Ga0316049_115177 | Not Available | 591 | Open in IMG/M |
| 3300032042|Ga0318545_10346557 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032515|Ga0348332_10706457 | Not Available | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.06% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.42% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010083 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027065 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_101206081 | 3300001545 | Forest Soil | VLEGVMILLAIAGSTVGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF* |
| JGI25617J43924_100829972 | 3300002914 | Grasslands Soil | MTLLAIAGSTIGAWWRLAILALTQPAPPSKSDVPPEYYKFPIF* |
| JGI26340J50214_100466182 | 3300003368 | Bog Forest Soil | MIVLALAGRAIGELWRRAILAFEQLAPRSNRDVPPEFYRFPIF* |
| JGIcombinedJ51221_102888702 | 3300003505 | Forest Soil | MILLAIAGSTIXAWWRRAILAMTHPEPRSKSEVPLEXYKFPIF* |
| Ga0062385_102063792 | 3300004080 | Bog Forest Soil | MILLAIAGSTIGAWWRRAILALAHPAPSSKRDIPPEFYRFPIF* |
| Ga0062384_1001639223 | 3300004082 | Bog Forest Soil | MILLAIAGSTIGAWWRRAILALTQPAPRSKGEVPLEFYRFPIF* |
| Ga0058899_100278802 | 3300004631 | Forest Soil | MTLLTIAGGTIGAWWRRAMLALTQPAPRSKSDVPPEYYRFPIF* |
| Ga0066680_105831543 | 3300005174 | Soil | MIMLAIVGSTIGEWWRRAILAFAKPAPRSSRDVPPEFYNFPLF* |
| Ga0066673_100286743 | 3300005175 | Soil | MILLAIAGSTIGAWWRRAILALAHPAPSPRRDVPAEFYKFPLF* |
| Ga0066690_106996671 | 3300005177 | Soil | AVLEGVMILLAIAGSTIGTWWRRAILALTRPAPRSKNEVPLEFYKFPMF* |
| Ga0066671_100313844 | 3300005184 | Soil | MILLAIAGSTIGAWWCRAILALAHPAPSPRRDVPAEFYKFPLF* |
| Ga0070709_102875092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MILLAMAGSTIGAWWRRAILALAHPAPRSKSDVPPEFYRFPIF* |
| Ga0070714_1019270571 | 3300005435 | Agricultural Soil | MILLAIAGSTIRAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF* |
| Ga0070713_1002816302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MILLAIAGSTIGAWWRRAILALTHPAPRSKSDVPPEFYRFPIF* |
| Ga0066699_106371482 | 3300005561 | Soil | MTLLAIAGSTIGAWWRRAILALTQPAPRSKSEVPPEYYKFPIF* |
| Ga0066703_106978032 | 3300005568 | Soil | MTLVAIAGSTIGAWWRRAILALTRPAPRSKNEVPLEYYRFPMF* |
| Ga0066708_106361472 | 3300005576 | Soil | LLAIVGGTIGTWWRRAILALTRPAPRSKNEVPLEFYRFPMF* |
| Ga0070762_104060192 | 3300005602 | Soil | QQAVLEGVMTLLTIAGGTIGAWWRRAILALTQPAPRSKSDVPPEYYRFPIF* |
| Ga0070762_105955403 | 3300005602 | Soil | MILLAIAGSTIRAWWRRAMLAMTHPEPRSKSEVPLEYYKFPIF* |
| Ga0070763_100273083 | 3300005610 | Soil | MILLAIAGSTIGAWWRRAILALAHPAPRSKSDVPPEFYKFPIF* |
| Ga0070763_101770121 | 3300005610 | Soil | PQQQAVLEGVMILLAIAGSTIRAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF* |
| Ga0070766_103531822 | 3300005921 | Soil | MILLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF* |
| Ga0070766_112343071 | 3300005921 | Soil | PQQQAVLEGVMTLLTIAGGTIGAWWRRAILALTQPAPRSKSDVPPEYYRFPIF* |
| Ga0075018_104735971 | 3300006172 | Watersheds | VMILLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF* |
| Ga0070712_1005223763 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MILLAIAGSTIGAWWRRAILALAHPAPRSKSDVPPEFYRFPIF* |
| Ga0070765_1000058625 | 3300006176 | Soil | MTLLTIAGGTIGAWWRRAILALTQPAPRSKSDVPPEYYRFPIF* |
| Ga0070765_1001656204 | 3300006176 | Soil | MTLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF* |
| Ga0066660_111258662 | 3300006800 | Soil | MTLLAIAGSTIGAWWRLAILALTQPAPRSKSDVPPEYYKFPIF* |
| Ga0073928_102521152 | 3300006893 | Iron-Sulfur Acid Spring | MILLAIAGSTIGAWWRRAILALTHQAPTSKRDVPAEYYKFPIF* |
| Ga0079219_103071001 | 3300006954 | Agricultural Soil | MTLLAIAGSTIGAWWRRGILALTQPAPRSKSDVPPEYYRFPIF |
| Ga0099795_102370041 | 3300007788 | Vadose Zone Soil | QAVLEGVMILLAIAGSTIGAWWRRAILTLAQPTPRSKSDVPPEFYRFPIF* |
| Ga0105250_104619031 | 3300009092 | Switchgrass Rhizosphere | MMLLLAIAGGTIGEWVRRAILALAQRAARSSRDVPPEFYKFPLF* |
| Ga0066709_1011405532 | 3300009137 | Grasslands Soil | MIMLAIVGSTIGEWWRRAILTFAKPAPRSSRDVPPEFYNFPLF* |
| Ga0114129_127100421 | 3300009147 | Populus Rhizosphere | QQAVLEGVMILLAIAGSTIGAWWRRAILALTHPAPRSKSDVPPEFYRFPPF* |
| Ga0111538_104875693 | 3300009156 | Populus Rhizosphere | MLLLAIAGGTIGGWVRRAILALAQRAARSSRDVPPEFYKFPLF* |
| Ga0127478_10205532 | 3300010083 | Grasslands Soil | MILLAIAGSTIGAWWRRAILALTRPGPRSNNKVPIEFYRFPMF* |
| Ga0099796_103302942 | 3300010159 | Vadose Zone Soil | MILLAIAGSTIGAWWRRAILALAHQAPRSKSDVPPEFYRFPIF* |
| Ga0126352_10732922 | 3300010859 | Boreal Forest Soil | LLAIAGSTIGAWWRRVILALAQPAPRSKSDVPPEFYRFPIF* |
| Ga0126349_10301872 | 3300010861 | Boreal Forest Soil | MILLAIAGSTIGAWWRRAILALAHPAPHSKGDVPPEFYKFPIF* |
| Ga0150983_101331461 | 3300011120 | Forest Soil | QAVLEGVMTLLAIAGSTIGAWWRRAILVLAHPAPRLKSDVPPEFYKFPIF* |
| Ga0150983_130194152 | 3300011120 | Forest Soil | MTLLAIAGSTIGAWWRRAILALTQPAPHSKSEVPLEYYKFPIF* |
| Ga0137364_106209792 | 3300012198 | Vadose Zone Soil | LEGVMILLAFAGGTIGEWVRRAIVALARLAPHSNRDIPPEFYKFPLF* |
| Ga0137363_109294442 | 3300012202 | Vadose Zone Soil | RVPEQQALLEGVMIMLAIVGSTIGEWWRRAILAFAKPAPRSSRDVPPEFYNFPLF* |
| Ga0150985_1019019632 | 3300012212 | Avena Fatua Rhizosphere | MMLLLAIAGGTIGEWARRAILALAQRAARSSRDVPPEFYKFPLF* |
| Ga0150985_1108245392 | 3300012212 | Avena Fatua Rhizosphere | MILLAIAGSAIGAWWRRAILALAHPAPRSKSDVPPEFYRFPIF* |
| Ga0134035_10944471 | 3300012391 | Grasslands Soil | ATSLLEGVMILLAIAGSTIGAWWRRAILALAHPAPSPRRDVPAEFYKFPLF* |
| Ga0150984_1015215173 | 3300012469 | Avena Fatua Rhizosphere | MSLLAIVGGTIGTWWRRAILALTRPAPRSKNEVPLEFYRFPMF* |
| Ga0137358_103898842 | 3300012582 | Vadose Zone Soil | MILLAIAGSTIGAWWRRAILAMTHPKPRAKSEVPLEYYKFPIF* |
| Ga0157302_104635982 | 3300012915 | Soil | MILVAIAGSTIGAWWRRAILALTQPAPHSKNEVPLEFYRFPIF* |
| Ga0182033_111935312 | 3300016319 | Soil | MTLLAIAGSTIGAWWRRAILALAQPATRSKGEVPLEFYRFPIF |
| Ga0182032_111191942 | 3300016357 | Soil | PEQQAVLEGVMTLLAIAGSTIGAWWRRAILALAQPAPRSKGEVPLEFYRFPIF |
| Ga0182038_119195142 | 3300016445 | Soil | MTLLAIAGSTIGAWWRRAILALAQPATRSKVEVPQEFYRCPIF |
| Ga0066667_114195912 | 3300018433 | Grasslands Soil | MTLLAIAGSTIGAWWHRAILALTQPAPRSKSDVPPEYYKFPIF |
| Ga0206350_114987752 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLLAIAGGTIGEWVRRAILALAQRAARSSRDVPPEFYKFPLF |
| Ga0210407_100997462 | 3300020579 | Soil | MILLAIAGSTIRAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0210407_106342532 | 3300020579 | Soil | MTLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0210407_111983462 | 3300020579 | Soil | MILLAIAGSTIGAWWRRAILVLAHPAPRLKSDVPPEFYKFPIF |
| Ga0210403_101638922 | 3300020580 | Soil | MTSLTIAGSTIGAWWRRAILALAQPAPRSKSDVPPEYYRFPIF |
| Ga0210399_110852202 | 3300020581 | Soil | MILLAMAGSTIGAWWRRAILALAHPAPRSKSDVPPEFYRFPIF |
| Ga0210395_110203752 | 3300020582 | Soil | MTLLTIAGSTIGAWWRRAILVLTQPAPRSKSEVPPEYYRFPIF |
| Ga0210401_102694223 | 3300020583 | Soil | MTLLTIAGSTIGAWWRRAILALTQPAPRSKSDVPPEYYRFPIF |
| Ga0179584_10415602 | 3300021151 | Vadose Zone Soil | MILLAIVGSTIGEWWHRAILAFAKPAPRSNRDVPPEFYKFPLF |
| Ga0179584_14905632 | 3300021151 | Vadose Zone Soil | MILLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0210400_105496932 | 3300021170 | Soil | MTLLAIAGSTIGAWWRRAILAMTHPEQPRSKSEVPLEYYKFPIF |
| Ga0210400_106730921 | 3300021170 | Soil | MILLAIAGSTIRAWWRRAILGMTHPEPRSKSEVPLE |
| Ga0213881_100036603 | 3300021374 | Exposed Rock | MILLTIVGGTIGQWWRRAILALSRPAPGSNRDDPPEFYRFPPF |
| Ga0213874_101859062 | 3300021377 | Plant Roots | MTLLAIAGSTIGTWWRRAILALTGPAPRSKNQVPLEFYRFPMF |
| Ga0210393_103735842 | 3300021401 | Soil | MILLAIAGSTIRAWWRLAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0210387_103065841 | 3300021405 | Soil | MILLAIAGSTIRAWWRRAILAMTHPEPRSKSEVPLEYS |
| Ga0210383_107290301 | 3300021407 | Soil | EGVMILLAIAGSTIGAWWRRAILVLAHPAPRLKSDVPPEFYKFPIF |
| Ga0210383_112655202 | 3300021407 | Soil | MILLAIAGSTIGAWWRRAILAMTHPEQPRSKSEVPLEYYKFPIF |
| Ga0210394_100229753 | 3300021420 | Soil | MTLLAIAGSTIGAWWRRAILALTQPAPRSKSDVPPEYYRFPIF |
| Ga0210384_105211741 | 3300021432 | Soil | AVLEGVMILLAIAGSTIRAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0210391_113911881 | 3300021433 | Soil | MTLLAIAGSTIGAWWRRAILVLAHPAPRLKSDVPPEFYKFPIF |
| Ga0213879_100932871 | 3300021439 | Bulk Soil | GKTIGAWWRRAILALTRPAPRSKNEVPLEYYRFPIF |
| Ga0210402_106086231 | 3300021478 | Soil | MILLAIAGSTIRAWWRRAILAMTHPEPRSKSEVPLEYYKF |
| Ga0210410_113041341 | 3300021479 | Soil | MTLLAIAGSTIGAWWRRAILALTQPAPHSKSEVPLEYYKFPIF |
| Ga0210409_110073691 | 3300021559 | Soil | QQQAVLEGVMTLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0210409_117055672 | 3300021559 | Soil | MTLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYY |
| Ga0126371_118712671 | 3300021560 | Tropical Forest Soil | ATSPSGENKMILLTIVGGTIGQWWRRAILALSRPALGSKHDAPPEFYRFPPF |
| Ga0213852_14775572 | 3300021858 | Watersheds | MILLAIAGSTIGAWWRRAILALTHPALLSKSDVPPEFYKFPIF |
| Ga0213851_15163483 | 3300021860 | Watersheds | MTLLAIAGSTIGAWWRRAILALTHPALLSKSDVPPEFYKFPIF |
| Ga0242642_10119482 | 3300022504 | Soil | MTLLAIAGSTIRAWWRRAILAMTHPGPRSKSEVPLEYYKFPIF |
| Ga0242667_10304881 | 3300022513 | Soil | IAGSTIGAWWRRAILALTQPAPRSKSDVPPEYYKFPIF |
| Ga0242656_10289282 | 3300022525 | Soil | MTLLAIAGSTIGAWWRRAILAMTHPGPRSKSEVPLEYYKFPIF |
| Ga0242664_10070913 | 3300022527 | Soil | TLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0242669_11347951 | 3300022528 | Soil | QQQAVLEGVMTLLTIAGSTIGGWWRRAILALTQPAPRSKSEVPPEYYRFPIF |
| Ga0222756_10385122 | 3300022709 | Soil | MILLAIAGSTIGAWWRRAILVLAHPAPRSKSDVPPEFYKFPIF |
| Ga0242673_10941952 | 3300022716 | Soil | GCRIPQQQAVLEGVMTLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0242665_100942223 | 3300022724 | Soil | MTLLAIAGSTIGAWWRRAILAMTNPEPRSKSEVPVEYYKFPIF |
| Ga0209153_12347701 | 3300026312 | Soil | MILLAIAGSTIGAWWCRAILALAHPAPSPRRDVPAEVYK |
| Ga0209473_12303661 | 3300026330 | Soil | MILLAIAGSTIGAWWRRAILALAHPAPSPRRDVPAEFYKFPLF |
| Ga0209056_103318812 | 3300026538 | Soil | MIMLAIVGSTIGEWWRRAILAFAKPAPRSSRDVPPEFYNFPLF |
| Ga0209648_102642722 | 3300026551 | Grasslands Soil | MTLLAIAGSTIGAWWRLAILALTQPAPPSKSDVPPEYYKFPIF |
| Ga0209577_107563432 | 3300026552 | Soil | MTLLAIAGSTIGAWWRRAILALTQPAPRSKSDVPPEYYKFPIF |
| Ga0179587_109176691 | 3300026557 | Vadose Zone Soil | MILLAIAGSTISAWWRRAILALTQPAPHPKGEVPLEFYRFPIF |
| Ga0208489_10058212 | 3300027065 | Forest Soil | MTLLAIAGTTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0209527_10389382 | 3300027583 | Forest Soil | MTLLAIVGGTIGAWWRRAILGMTHPEPRSKSEVPLEYYKFPIF |
| Ga0209446_11573062 | 3300027698 | Bog Forest Soil | MILLAIAGSTIGAWWRRAILALTQPVLHSKGEVPLEFYRFPIF |
| Ga0209038_100128842 | 3300027737 | Bog Forest Soil | MILLAIAGSTIGAWWRRAILVLTHPATRSKSDVPPEFYRFPIF |
| Ga0209448_100820171 | 3300027783 | Bog Forest Soil | MILLAIAGSTIGAWWRRAILALTQPALHPKGEVPLEFYRFPI |
| Ga0209656_1000140511 | 3300027812 | Bog Forest Soil | MIVLALAGRAIGELWRRAILAFEQLAPRSNRDVPPEFYRFPIF |
| Ga0209773_102171062 | 3300027829 | Bog Forest Soil | MILLAIAGSTIGAWWRRAILALTQPAPRSKGEVPLEFYRFPIF |
| Ga0209275_100668583 | 3300027884 | Soil | MTLLTIAGGTIGAWWRRAILALTQPAPRSKSDVPPEYYRFPIF |
| Ga0209380_101619491 | 3300027889 | Soil | RIPQQQAVLEGVMTLLAIAGSTIGAWWRRAILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0209488_103519743 | 3300027903 | Vadose Zone Soil | MILLAIAGSTIGAWWRRAILTLAQPTPRSKSDVPPEFYRFPIF |
| Ga0307482_11094172 | 3300030730 | Hardwood Forest Soil | MILLAIAGSAIGAWWRRAILALTQPSPRSKGEVPLEFYRFPMF |
| Ga0307482_11787782 | 3300030730 | Hardwood Forest Soil | MILLAIAGSTIGAWWRRAILALTQPAPHPKGEVPLEFYRFPIF |
| Ga0308202_10295952 | 3300030902 | Soil | MTLLAIAGSTIGAWWRRAILALTQPAPHPKGDEVPLEFYRFPIF |
| Ga0099845_15685872 | 3300030975 | Boreal Forest Soil | MILLAIAGSTIGAWWRRAILALTHQAPTSKRDVPPEYYKFPIF |
| Ga0138301_10036412 | 3300031022 | Soil | MTLLAMAGSTIGAWWRRAILALAHPVPRSKSDVPPEFYKFPIF |
| Ga0170834_1062817172 | 3300031057 | Forest Soil | MILLALVGRTIGDWWRRAILALVQPAPRSNRDVPPEFYRFPLF |
| Ga0170834_1099365632 | 3300031057 | Forest Soil | MILLAIARSTIGAWWRRAILALAHPAPRSESDVPPEFYRFPIF |
| Ga0308201_104341702 | 3300031091 | Soil | MILLAIAGSAIGAWWRRAILALAHPAPRSKSDVPPEFYRFPIF |
| Ga0308204_100524961 | 3300031092 | Soil | LLLAIAGGTIGGWARRAILALAERAARSSRDVPPEFYKFPLF |
| Ga0170824_1092903472 | 3300031231 | Forest Soil | MILLAIAGSTIRAWWRRSILAMTHPEPRSKSEVPLEYYKFPIF |
| Ga0170824_1285841842 | 3300031231 | Forest Soil | MILLAIVGSTIGASWRRAILALTRPAPRSNNDVPTEFYRFPVF |
| Ga0318528_105766512 | 3300031561 | Soil | MTLLAIAGSTIGAWWRRAILALAQPAPRSKGEVPLEFYRFPIF |
| Ga0307483_10061182 | 3300031590 | Hardwood Forest Soil | MILLALAGRTIGDRWRRVILALAQPPRSNRDVPPEFYRFPLF |
| Ga0318561_103541802 | 3300031679 | Soil | VPEQQAVLEGVMTLLAIAGSTIGAWWRRAILALAQPAPRSKGEVPLEFYRFPIF |
| Ga0318567_102744021 | 3300031821 | Soil | MILLALAGRTIGEWWRRAILAFAEPAPRSNRDVPPEFYKFPLF |
| Ga0316049_1151772 | 3300031866 | Soil | GVMTLLAIAGSTIGAWWRRAILALTHPASHSKSDVPPEFYKFPLF |
| Ga0318545_103465572 | 3300032042 | Soil | VLEGVMTLLAIAGSTIGAWWRRAILALAQPAPRSKGEVPLEFYRFPIF |
| Ga0348332_107064572 | 3300032515 | Plant Litter | MILLAIAGSTIGAWWRRAILALTRPAPHPKSDVPPEFYKFPLF |
| ⦗Top⦘ |