


| Basic Information | |
|---|---|
| Family ID | F069242 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 91.94 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.710 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.839 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 21.77 |
| PF00106 | adh_short | 5.65 |
| PF13561 | adh_short_C2 | 4.03 |
| PF05977 | MFS_3 | 2.42 |
| PF13602 | ADH_zinc_N_2 | 2.42 |
| PF12680 | SnoaL_2 | 1.61 |
| PF01494 | FAD_binding_3 | 1.61 |
| PF02954 | HTH_8 | 1.61 |
| PF13271 | DUF4062 | 1.61 |
| PF12697 | Abhydrolase_6 | 1.61 |
| PF13577 | SnoaL_4 | 1.61 |
| PF03466 | LysR_substrate | 1.61 |
| PF02624 | YcaO | 0.81 |
| PF16912 | Glu_dehyd_C | 0.81 |
| PF01152 | Bac_globin | 0.81 |
| PF13458 | Peripla_BP_6 | 0.81 |
| PF02909 | TetR_C_1 | 0.81 |
| PF06736 | TMEM175 | 0.81 |
| PF00107 | ADH_zinc_N | 0.81 |
| PF09509 | Hypoth_Ymh | 0.81 |
| PF01522 | Polysacc_deac_1 | 0.81 |
| PF11171 | DUF2958 | 0.81 |
| PF00027 | cNMP_binding | 0.81 |
| PF02371 | Transposase_20 | 0.81 |
| PF00111 | Fer2 | 0.81 |
| PF13784 | Fic_N | 0.81 |
| PF01590 | GAF | 0.81 |
| PF00672 | HAMP | 0.81 |
| PF12439 | GDE_N | 0.81 |
| PF13460 | NAD_binding_10 | 0.81 |
| PF01479 | S4 | 0.81 |
| PF07589 | PEP-CTERM | 0.81 |
| PF01610 | DDE_Tnp_ISL3 | 0.81 |
| PF01914 | MarC | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF02518 | HATPase_c | 0.81 |
| PF07166 | DUF1398 | 0.81 |
| PF00724 | Oxidored_FMN | 0.81 |
| PF13538 | UvrD_C_2 | 0.81 |
| PF00723 | Glyco_hydro_15 | 0.81 |
| PF04397 | LytTR | 0.81 |
| PF12833 | HTH_18 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.23 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 2.42 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.61 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.61 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.61 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.81 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.81 |
| COG1944 | Ribosomal protein S12 methylthiotransferase accessory factor YcaO | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.81 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| COG5562 | Prophage-encoded protein YbcV, DUF1398 family | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.71 % |
| Unclassified | root | N/A | 11.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_101782121 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005445|Ga0070708_102198626 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005467|Ga0070706_100023822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5636 | Open in IMG/M |
| 3300005538|Ga0070731_10986803 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005541|Ga0070733_10293042 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005541|Ga0070733_10706637 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005552|Ga0066701_10112395 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300005558|Ga0066698_10282216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300005712|Ga0070764_10379170 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005843|Ga0068860_100944978 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005921|Ga0070766_10003145 | All Organisms → cellular organisms → Bacteria | 8315 | Open in IMG/M |
| 3300005921|Ga0070766_10889552 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006041|Ga0075023_100285506 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006173|Ga0070716_100812578 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006175|Ga0070712_100176470 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300006237|Ga0097621_101336897 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006796|Ga0066665_10120368 | Not Available | 1955 | Open in IMG/M |
| 3300006806|Ga0079220_10275766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1023 | Open in IMG/M |
| 3300006844|Ga0075428_102308890 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006846|Ga0075430_100384761 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300006893|Ga0073928_10540018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300009012|Ga0066710_100080050 | All Organisms → cellular organisms → Bacteria | 4253 | Open in IMG/M |
| 3300009088|Ga0099830_10824499 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300009098|Ga0105245_10996117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300009100|Ga0075418_10418750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1433 | Open in IMG/M |
| 3300009137|Ga0066709_100149250 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
| 3300010048|Ga0126373_13297770 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010326|Ga0134065_10275084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300010339|Ga0074046_10421619 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010360|Ga0126372_12458846 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010397|Ga0134124_11419520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 720 | Open in IMG/M |
| 3300010403|Ga0134123_12011900 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300011119|Ga0105246_10705393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 885 | Open in IMG/M |
| 3300011271|Ga0137393_11770319 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012096|Ga0137389_10856389 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012207|Ga0137381_10746948 | Not Available | 849 | Open in IMG/M |
| 3300012357|Ga0137384_11562046 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012362|Ga0137361_10174688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1934 | Open in IMG/M |
| 3300012582|Ga0137358_10213394 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300012683|Ga0137398_10889122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 621 | Open in IMG/M |
| 3300012685|Ga0137397_10320882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
| 3300012925|Ga0137419_11679430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 541 | Open in IMG/M |
| 3300012929|Ga0137404_10874112 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300012951|Ga0164300_10509948 | Not Available | 690 | Open in IMG/M |
| 3300012975|Ga0134110_10628568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300013308|Ga0157375_11287812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 859 | Open in IMG/M |
| 3300014657|Ga0181522_10799688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300014968|Ga0157379_12601627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300016270|Ga0182036_11452162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300016294|Ga0182041_11383064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300016341|Ga0182035_11585795 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300017970|Ga0187783_10939184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300017974|Ga0187777_11277861 | Not Available | 539 | Open in IMG/M |
| 3300018029|Ga0187787_10448950 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018062|Ga0187784_11504744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 533 | Open in IMG/M |
| 3300018481|Ga0190271_13188574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300020579|Ga0210407_10074792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2546 | Open in IMG/M |
| 3300020579|Ga0210407_10088821 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300020580|Ga0210403_10421861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300020580|Ga0210403_11297927 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300020581|Ga0210399_11503149 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300020583|Ga0210401_10721141 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300021088|Ga0210404_10467831 | Not Available | 710 | Open in IMG/M |
| 3300021168|Ga0210406_10132924 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300021171|Ga0210405_10376157 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300021178|Ga0210408_10318669 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300021178|Ga0210408_10687307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 807 | Open in IMG/M |
| 3300021178|Ga0210408_11493932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300021403|Ga0210397_10261211 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300021404|Ga0210389_10903311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300021405|Ga0210387_10038420 | All Organisms → cellular organisms → Bacteria | 3808 | Open in IMG/M |
| 3300021405|Ga0210387_10273398 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300021405|Ga0210387_10645571 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300021420|Ga0210394_10395392 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300021420|Ga0210394_10828353 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300021432|Ga0210384_10965432 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300021432|Ga0210384_11638084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 549 | Open in IMG/M |
| 3300021474|Ga0210390_10924464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300021475|Ga0210392_10662493 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300021479|Ga0210410_10269520 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300022508|Ga0222728_1027999 | Not Available | 856 | Open in IMG/M |
| 3300022521|Ga0224541_1015158 | Not Available | 830 | Open in IMG/M |
| 3300022712|Ga0242653_1031287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300025916|Ga0207663_11585921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300026942|Ga0207783_1008038 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300027370|Ga0209010_1053714 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300027371|Ga0209418_1064100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300027591|Ga0209733_1109266 | Not Available | 692 | Open in IMG/M |
| 3300027652|Ga0209007_1017691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1846 | Open in IMG/M |
| 3300027652|Ga0209007_1149050 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027660|Ga0209736_1021670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium ADurb.Bin051 | 1966 | Open in IMG/M |
| 3300027684|Ga0209626_1133803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300027824|Ga0209040_10295494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 791 | Open in IMG/M |
| 3300027842|Ga0209580_10222750 | Not Available | 937 | Open in IMG/M |
| 3300027842|Ga0209580_10522861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 590 | Open in IMG/M |
| 3300027889|Ga0209380_10010784 | All Organisms → cellular organisms → Bacteria | 5305 | Open in IMG/M |
| 3300027889|Ga0209380_10686657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300028906|Ga0308309_11599911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300029951|Ga0311371_11663047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
| 3300030002|Ga0311350_10709090 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300030520|Ga0311372_12301364 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031128|Ga0170823_10533023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1238 | Open in IMG/M |
| 3300031231|Ga0170824_119896716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031234|Ga0302325_13236741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031545|Ga0318541_10395052 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300031572|Ga0318515_10498741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300031708|Ga0310686_110678773 | Not Available | 724 | Open in IMG/M |
| 3300031720|Ga0307469_10949506 | Not Available | 800 | Open in IMG/M |
| 3300031740|Ga0307468_100194727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1363 | Open in IMG/M |
| 3300031753|Ga0307477_10947152 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031754|Ga0307475_11154093 | Not Available | 605 | Open in IMG/M |
| 3300031823|Ga0307478_10518996 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300031910|Ga0306923_10118223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3004 | Open in IMG/M |
| 3300031944|Ga0310884_10308329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300031946|Ga0310910_11044797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300031947|Ga0310909_10733530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300031947|Ga0310909_10872691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300031954|Ga0306926_11366980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300031954|Ga0306926_11460382 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300032180|Ga0307471_100564326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1294 | Open in IMG/M |
| 3300032205|Ga0307472_102300664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 545 | Open in IMG/M |
| 3300032205|Ga0307472_102427454 | Not Available | 532 | Open in IMG/M |
| 3300034124|Ga0370483_0112501 | Not Available | 901 | Open in IMG/M |
| 3300034163|Ga0370515_0462249 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.84% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1017821212 | 3300004091 | Bog Forest Soil | GEVSDKNDPEALARFFVATIQGMRAMAKVNSNRNALEQVAKLALSSLS* |
| Ga0070708_1021986261 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GETDTGALAKFFVASIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0070706_1000238225 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGKDAGALARFFLATIQGMRSTACANSNRAALEQVARVALSTLD* |
| Ga0070731_109868031 | 3300005538 | Surface Soil | VTIQGMRAIARLKSDRKALERVARVALAVFKSSNSASLSK* |
| Ga0070733_102930421 | 3300005541 | Surface Soil | DAGALARFFVATIQGMRAMARLKSDRRALRQVARIALAVFDRS* |
| Ga0070733_107066371 | 3300005541 | Surface Soil | ALAKFFVATIQGMRAMARLKSNRRALRQVAKIALAALHG* |
| Ga0066701_101123951 | 3300005552 | Soil | ALAHFFVVTIQGMRATARLKSDRQALEQVARVALAVFN* |
| Ga0066698_102822162 | 3300005558 | Soil | KALAHFFVVTIQGMRATARLKSDRQALEQVARVALAVFK* |
| Ga0070764_103791702 | 3300005712 | Soil | RFFVATIQGMRAMARLKSDRKALEQIARVALSVFNLSTGA* |
| Ga0068860_1009449781 | 3300005843 | Switchgrass Rhizosphere | ALARFFLVTIQGMRSTARVHSNRTALEQVARVALAALG* |
| Ga0070766_100031451 | 3300005921 | Soil | ALAKFFVATIQGMRAMARLKSDRGALRQVAKIALAVFDRS* |
| Ga0070766_108895521 | 3300005921 | Soil | DASALAKFFVVTIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0075023_1002855062 | 3300006041 | Watersheds | ALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDDIRRL* |
| Ga0070716_1008125781 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ALARFFVATIQGMRAMAKLNSNRNSLEQVAKLALSTIS* |
| Ga0070712_1001764701 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ALARFFVATIQGMRAMAKLNSNRKALEQVAKLALSTIG* |
| Ga0097621_1013368971 | 3300006237 | Miscanthus Rhizosphere | LAKFFVVTIQGMRAMARLNSDRRALRQVAKIALAQFE* |
| Ga0066665_101203683 | 3300006796 | Soil | FFVVTIQGMRAMARLKSDKRALEQVARVALGVFNSSRHEKN* |
| Ga0079220_102757661 | 3300006806 | Agricultural Soil | RRTWGETDTGALAKFFVASIRVMRAMARLKSDRRAVRQVARIALAVFDR* |
| Ga0075428_1023088902 | 3300006844 | Populus Rhizosphere | LARFFMVTIQGMRATARARSDRAALEQVAKLALTMLD* |
| Ga0075430_1003847613 | 3300006846 | Populus Rhizosphere | AALARFYVVTIQGMRSTARARSDRAALEQVANLALSMLD* |
| Ga0073928_105400181 | 3300006893 | Iron-Sulfur Acid Spring | HELRPGTDAGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAAFDR* |
| Ga0066710_1000800504 | 3300009012 | Grasslands Soil | PAALAHFFVVTIQGMRAMARLKSDKRALEQVARVALGVFNSPHPRHEKN |
| Ga0099830_108244991 | 3300009088 | Vadose Zone Soil | RTHDPKALAHFFVVTIQGMRATARVKSDRQALEQVARVALAVFN* |
| Ga0105245_109961172 | 3300009098 | Miscanthus Rhizosphere | VVTIQGMRAMARLKSERKALEQVARVALAVFKASNTS* |
| Ga0075418_104187503 | 3300009100 | Populus Rhizosphere | VARFFAVTIQGMRAMARLKSDRRALRQVARVALAALDAR* |
| Ga0066709_1001492501 | 3300009137 | Grasslands Soil | DDPAALAHFFVVTIQGMRAMARLKSDKRALEQVARVALGVFNSPHPRHEKN* |
| Ga0126373_132977701 | 3300010048 | Tropical Forest Soil | KDDPAALARFFVVTIQGMRAMARLKSDRKALEQVARIALARFKSPDEE* |
| Ga0134065_102750841 | 3300010326 | Grasslands Soil | AALAHFFVVTIQGMRTTARLTSDRQALEQVARIALAVFS* |
| Ga0074046_104216191 | 3300010339 | Bog Forest Soil | FFVATIQGMRAMAKLNSNRKALEQVARLALSALN* |
| Ga0126372_124588461 | 3300010360 | Tropical Forest Soil | SAKENVAALGRFFVVTIQGMRAMARLKSDRKALKQVAKVALAVFR* |
| Ga0134124_114195202 | 3300010397 | Terrestrial Soil | AGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0134123_120119002 | 3300010403 | Terrestrial Soil | AASEDPAALARFFVVTIQGMRAIARLRSDRKALEQVTRVALGVFA* |
| Ga0105246_107053932 | 3300011119 | Miscanthus Rhizosphere | AKFFVASIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0137393_117703191 | 3300011271 | Vadose Zone Soil | KALARFFTATIQGMRAMARLRSDRKSLEQVARLALAALDQ* |
| Ga0137389_108563892 | 3300012096 | Vadose Zone Soil | SRTHKPAALAHFFVVTIQGMRTTARLTSDRKALEQVARIALAVFS* |
| Ga0137381_107469481 | 3300012207 | Vadose Zone Soil | LARFFVVTIQGMRALARLKSDRRALLEEVTRVALAVLVEKAPHS |
| Ga0137384_115620462 | 3300012357 | Vadose Zone Soil | PSEQDARAVAKFFVVTVQGMRAMARLKSDRRALKQVAKLALAVFDRQGYR* |
| Ga0137361_101746881 | 3300012362 | Vadose Zone Soil | RFFVATIQGMRAMAKLHSNRKALEQVAKLALSTLD* |
| Ga0137358_102133943 | 3300012582 | Vadose Zone Soil | VAGVLEHGALAKFFVASIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0137398_108891221 | 3300012683 | Vadose Zone Soil | HNGADAGALAKFFVATIQGMRAMARLKSDRRALRQVAKIALAVFDRS* |
| Ga0137397_103208823 | 3300012685 | Vadose Zone Soil | GELGGETDTGALAKFFAASIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0137419_116794301 | 3300012925 | Vadose Zone Soil | HFFVVTIQGMRTTARLTSDRQALEQVARIALAVFS* |
| Ga0137404_108741121 | 3300012929 | Vadose Zone Soil | AALAHFFVVTIQGMRTTARLTSDRKALEQVARIALAVFS* |
| Ga0164300_105099481 | 3300012951 | Soil | DPAALARFFVATIQGMRAMAKLNSNRKALEQVAKLALRTIS* |
| Ga0134110_106285682 | 3300012975 | Grasslands Soil | SGEFAPDKDAGALARCCGATMQGMRSTARASSNRAALEQVARVALSTLD* |
| Ga0157375_112878122 | 3300013308 | Miscanthus Rhizosphere | GEFGEETDAGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR* |
| Ga0181522_107996881 | 3300014657 | Bog | QDPVALGRFFVVTIQGMRAMARLKSDRKALEQVARVALAVFEES* |
| Ga0157379_126016271 | 3300014968 | Switchgrass Rhizosphere | EALAKFLVVTIQGMRAMARLKSDRRALRQVAKIALAMLDR* |
| Ga0182036_114521622 | 3300016270 | Soil | LARFFVATIQGMRAMAKLNSDRKSLEQVAKLAWSTIS |
| Ga0182041_113830641 | 3300016294 | Soil | ALARFFVATIQGMRAMAKLNSNRKSLEQVAKLALSTIS |
| Ga0182035_115857952 | 3300016341 | Soil | VVTIQGMRAMARLKSDRKALEEVARVALGVFNPSNAVE |
| Ga0187783_109391842 | 3300017970 | Tropical Peatland | SNSQDPVALARFFIVTIQGMRSMARLKSDRRALRQVAKVALAVFDNGKKAVTGAKVTLSSRS |
| Ga0187777_112778612 | 3300017974 | Tropical Peatland | APNADLPALARFFVATIQGLRSMARLKSDRKALEQVAHVALAVFNA |
| Ga0187787_104489501 | 3300018029 | Tropical Peatland | DKDTTALARFFVVTIQGMRAIAKLRSDRKALEQVARVALGVFG |
| Ga0187784_115047442 | 3300018062 | Tropical Peatland | VATIQGMRAMARLKSDRKALEQVARVALAVFHSFAATKSE |
| Ga0190271_131885742 | 3300018481 | Soil | ARFFMVTIQGMRATARARSDRAALQQVANLALSMLD |
| Ga0210407_100747925 | 3300020579 | Soil | AGALAKFFVATIQGMRAMARLKSNRRALRQVARIALAAFDR |
| Ga0210407_100888211 | 3300020579 | Soil | ELRPATDAGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0210403_104218612 | 3300020580 | Soil | ARFFVATIQGMRAMARLKSDRKALEQIARIALAVFNSPNTA |
| Ga0210403_112979271 | 3300020580 | Soil | GELSGKADAKALAQFFTVTIQGMRAMARVRSDRKSLEQVARVALAALDQ |
| Ga0210399_115031492 | 3300020581 | Soil | RAEAGALAKFFVVTIQGMRAMARLKSDRRALRQVARIALTMFDP |
| Ga0210401_107211411 | 3300020583 | Soil | SGEVSSKHDPAALARFFVATIQGLRAMAKLNSNRKALEQVAHLALSRLD |
| Ga0210404_104678311 | 3300021088 | Soil | SDRQDPVALARFFVATIQGMRAMAKLHSNRKALEQVAKLALSTLD |
| Ga0210406_101329244 | 3300021168 | Soil | SAEALARFFVVTIQGMRAMARLKSDRQARRQVAKIALALFDRQ |
| Ga0210405_103761572 | 3300021171 | Soil | AALARFFVATIQGMRAMAKLNSNRKALEQVAKLALRTIS |
| Ga0210408_103186691 | 3300021178 | Soil | FFTVTIQGMRAMARLSSDRKSLEQVARVALATLDQ |
| Ga0210408_106873072 | 3300021178 | Soil | KFFVASIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0210408_114939322 | 3300021178 | Soil | VALARFFVATIQGMRAMAKLHSNRKALEQVAKLALSTLD |
| Ga0210397_102612111 | 3300021403 | Soil | PAALARFFVATIQGMRAMAKVNSNRKALEEVAKLALSTIS |
| Ga0210389_109033111 | 3300021404 | Soil | IVALARFFVATIQGMRAIARLSHDRKTLENIATVALNSLES |
| Ga0210387_100384206 | 3300021405 | Soil | KQDPAAMARFFVVTIQGMRSMARLKSDRKALKQVAQIALAAFNSSNTASTG |
| Ga0210387_102733981 | 3300021405 | Soil | QRAGELPNTAEAGALAKFFVVTIQGMRAMARLKSDRRALRQVARIALTMFDP |
| Ga0210387_106455712 | 3300021405 | Soil | AERDPAALARFFVATIQGMRAMAKLNSNRKALEQVAKLALSTIG |
| Ga0210394_103953921 | 3300021420 | Soil | PAALARFFVVTIQGMRAMARLKSDRRALKEVARVALAVFD |
| Ga0210394_108283531 | 3300021420 | Soil | EDPTALARFFVVTIQGMRAMARLKSDRKALEQVAKVALSVFK |
| Ga0210384_109654321 | 3300021432 | Soil | ADAGALAKFFVVTIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0210384_116380842 | 3300021432 | Soil | PGTHAGALAKFFVATIQGMRAMARLKSDRRALRQVARISLAVFDR |
| Ga0210390_109244642 | 3300021474 | Soil | PAALARFFVVTIQGMRAMARLNSDRKALEQVARVALSVFKSSNARL |
| Ga0210392_106624932 | 3300021475 | Soil | DKHDPEALARFFVATIQGMRAMAKVNSNRKALEQVAKLALTSLS |
| Ga0210410_102695201 | 3300021479 | Soil | RFFVAAIQGLRAMAKLNSNRKALEQVAHLALSRLD |
| Ga0222728_10279991 | 3300022508 | Soil | GTDAGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0224541_10151581 | 3300022521 | Soil | ALARFFVVTIQGMRALARLKSDRRALEEVAKVALAVLD |
| Ga0242653_10312872 | 3300022712 | Soil | RTLWPSQRRGAGKFFVVTIQGMRAMARLKSDRQALRQVAKIALALFDRQ |
| Ga0207663_115859211 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QRGCELGEKTDASGLARFFVATIQGMRAMARLKPDRRALRQVAKIALAVFDR |
| Ga0207783_10080381 | 3300026942 | Tropical Forest Soil | SDKHDPVALARFFVATIQGMRAMAKVNSNRKALEQVAKLALSSLS |
| Ga0209010_10537143 | 3300027370 | Forest Soil | DPAALARFFVVTIQGMRAMARLKSDRKELEQVARVALAVFNSSNTA |
| Ga0209418_10641002 | 3300027371 | Forest Soil | GEVSVKQDPAALARFFVATIQGMRAMAKLNSNRNSLEQVAKLALSTIS |
| Ga0209733_11092661 | 3300027591 | Forest Soil | LAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0209007_10176913 | 3300027652 | Forest Soil | FFVVTIQGMRAMARLKSDRKELEQVARVALAVFNSSNTA |
| Ga0209007_11490502 | 3300027652 | Forest Soil | FFVVTIQGMRAMARLKSDRKELEQVARVALAVFHSSNTP |
| Ga0209736_10216702 | 3300027660 | Forest Soil | VRGGELGGETDAGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAA |
| Ga0209626_11338031 | 3300027684 | Forest Soil | ALARFFVATIQGMRAMAKLNSNRKALEQVAKLALSTIG |
| Ga0209040_102954941 | 3300027824 | Bog Forest Soil | LARFFVATIQGMRAMAKVNSNRKALEQVAKLALSSLS |
| Ga0209580_102227502 | 3300027842 | Surface Soil | AGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0209580_105228611 | 3300027842 | Surface Soil | ADAGALAKFFVATIQGMRAMARLKSDRRALRQVAKIALAVFDRS |
| Ga0209380_100107841 | 3300027889 | Soil | GELRNGADAGALAKFFVATIQGMRAMARLKSDRGALRQVAKIALAVFDRS |
| Ga0209380_106866572 | 3300027889 | Soil | GIDASALAKFFVVTIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0308309_115999112 | 3300028906 | Soil | FFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0311371_116630471 | 3300029951 | Palsa | AALARFFVATIQGMRAMARLKSDRKALEQIARVALAVFNSANTT |
| Ga0311350_107090902 | 3300030002 | Fen | KDAKALARFFVATIQGMRSTARATSDRASLEQVARIALSTLV |
| Ga0311372_123013642 | 3300030520 | Palsa | DAAALARFFVATIQGMRAMAGLKSDRKALEQIAGVALAVFNSSNTG |
| Ga0170823_105330232 | 3300031128 | Forest Soil | GADAGALAKFFVATIQGMRAMARLKSDRRALRQVAKIALAVFDQ |
| Ga0170824_1198967161 | 3300031231 | Forest Soil | VEASALAKFFVVTIQGMRAMARLKSDRRALRQVAKIALAMLDR |
| Ga0302325_132367411 | 3300031234 | Palsa | ARFFVVTIQGMRALARLRSDRRALEGVAKVALAVLD |
| Ga0318541_103950522 | 3300031545 | Soil | ARFFVATIQGMRAMAKLNSNRKSLEQVAKLALSTIS |
| Ga0318515_104987411 | 3300031572 | Soil | LARFFVATIQGMRAMAKVNSNRKALEEVAKLALSTMN |
| Ga0310686_1106787731 | 3300031708 | Soil | PGTDAGALAKFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0307469_109495062 | 3300031720 | Hardwood Forest Soil | LSGHHSGEALAKFFVVTSQGMRAMARLKFDRQALRQVAKIALALFDRQ |
| Ga0307468_1001947271 | 3300031740 | Hardwood Forest Soil | EDPAALARFFVVTIQGMRAIARLHSDRKGLEQVARVVLGVFGRPD |
| Ga0307477_109471521 | 3300031753 | Hardwood Forest Soil | PAALARFFAVTIQGMRAMARLKSDRKALEQVARVALAVFKPSNTS |
| Ga0307475_111540931 | 3300031754 | Hardwood Forest Soil | NQGPASLARFFVATIQGMRAMARIKSDRKALESVARVALAALE |
| Ga0307478_105189961 | 3300031823 | Hardwood Forest Soil | PAALARFFVATIQGMRAMAKLSSNRKALEQVAKLALSTIG |
| Ga0306923_101182231 | 3300031910 | Soil | VSDKQDPAALARFFVATIQGMRAMAKVNSNRKALEEVAKLALSTMN |
| Ga0310884_103083292 | 3300031944 | Soil | LATFFAVTIQGMRAMARLKSDRRALRQVAKLALAALDAK |
| Ga0310910_110447971 | 3300031946 | Soil | AALARFFVATIQGMRAMAKVNSNRKALEEVAKLALSTMN |
| Ga0310909_107335302 | 3300031947 | Soil | RFFVATIQGMRAMAKLNSNRQSLEQIARLALSTIS |
| Ga0310909_108726912 | 3300031947 | Soil | ALARFFVATIQGMRAMAKVNSNRKALEEVAKLALSTMD |
| Ga0306926_113669801 | 3300031954 | Soil | ALARFFVATIQGMRAMAKVNSNRKALEEVAKLALSTIS |
| Ga0306926_114603821 | 3300031954 | Soil | AMARFFVVTIQGMRAMARLKSDRKALEEVARVALGVFNPSNAVE |
| Ga0307471_1005643262 | 3300032180 | Hardwood Forest Soil | GQRGSELGVETDAGALANFFVATIQGMRAMARLKSDRRALRQVARIALAVFDR |
| Ga0307472_1023006641 | 3300032205 | Hardwood Forest Soil | ELSRKRDPAALARFFVVTIQGMRALARLKSDRRALEEVARVALAVLD |
| Ga0307472_1024274541 | 3300032205 | Hardwood Forest Soil | VSAKRDPAALARLFVATFQGMRAMAKLNSDRKSLQQVAKLALSTIS |
| Ga0370483_0112501_359_472 | 3300034124 | Untreated Peat Soil | LARFFVVTIQGMWALARLKSDRRALEEAAKVALAVLD |
| Ga0370515_0462249_215_328 | 3300034163 | Untreated Peat Soil | LARFFVVTIQGMRALARLKSDRRALEEVAKVALAVLD |
| ⦗Top⦘ |