


| Basic Information | |
|---|---|
| Family ID | F069231 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 39 residues |
| Representative Sequence | AYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 93.55 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.548 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.742 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 8.06 |
| PF00072 | Response_reg | 7.26 |
| PF07978 | NIPSNAP | 5.65 |
| PF00296 | Bac_luciferase | 5.65 |
| PF07690 | MFS_1 | 4.03 |
| PF04120 | Iron_permease | 3.23 |
| PF04072 | LCM | 2.42 |
| PF01266 | DAO | 2.42 |
| PF05685 | Uma2 | 2.42 |
| PF02771 | Acyl-CoA_dh_N | 1.61 |
| PF02720 | DUF222 | 1.61 |
| PF13302 | Acetyltransf_3 | 1.61 |
| PF14384 | BrnA_antitoxin | 1.61 |
| PF08448 | PAS_4 | 1.61 |
| PF13416 | SBP_bac_8 | 1.61 |
| PF01208 | URO-D | 1.61 |
| PF08241 | Methyltransf_11 | 1.61 |
| PF01207 | Dus | 1.61 |
| PF00561 | Abhydrolase_1 | 0.81 |
| PF12847 | Methyltransf_18 | 0.81 |
| PF04365 | BrnT_toxin | 0.81 |
| PF01557 | FAA_hydrolase | 0.81 |
| PF02627 | CMD | 0.81 |
| PF00496 | SBP_bac_5 | 0.81 |
| PF04392 | ABC_sub_bind | 0.81 |
| PF06841 | Phage_T4_gp19 | 0.81 |
| PF00149 | Metallophos | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF01979 | Amidohydro_1 | 0.81 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF13620 | CarboxypepD_reg | 0.81 |
| PF03069 | FmdA_AmdA | 0.81 |
| PF00528 | BPD_transp_1 | 0.81 |
| PF01408 | GFO_IDH_MocA | 0.81 |
| PF00664 | ABC_membrane | 0.81 |
| PF10137 | TIR-like | 0.81 |
| PF09365 | DUF2461 | 0.81 |
| PF09619 | YscW | 0.81 |
| PF02452 | PemK_toxin | 0.81 |
| PF01799 | Fer2_2 | 0.81 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF09851 | SHOCT | 0.81 |
| PF00881 | Nitroreductase | 0.81 |
| PF10518 | TAT_signal | 0.81 |
| PF00126 | HTH_1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 5.65 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 2.42 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 1.61 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.61 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.81 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.81 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.81 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.81 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.55 % |
| Unclassified | root | N/A | 6.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11355779 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300000955|JGI1027J12803_109101740 | Not Available | 776 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100912684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 761 | Open in IMG/M |
| 3300004025|Ga0055433_10127610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300005290|Ga0065712_10623291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 580 | Open in IMG/M |
| 3300005295|Ga0065707_10843572 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005332|Ga0066388_108212267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300005344|Ga0070661_101920592 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005444|Ga0070694_100262091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300005447|Ga0066689_10116674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1552 | Open in IMG/M |
| 3300005447|Ga0066689_10669332 | Not Available | 651 | Open in IMG/M |
| 3300005536|Ga0070697_102142512 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300005540|Ga0066697_10480648 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005546|Ga0070696_101127458 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005552|Ga0066701_10460608 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005555|Ga0066692_10387099 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300005558|Ga0066698_10225408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. | 1288 | Open in IMG/M |
| 3300005586|Ga0066691_10033020 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300005617|Ga0068859_100782118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1043 | Open in IMG/M |
| 3300005764|Ga0066903_100341324 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300005764|Ga0066903_101081563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1476 | Open in IMG/M |
| 3300005764|Ga0066903_107264071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
| 3300005829|Ga0074479_10062653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 656 | Open in IMG/M |
| 3300005842|Ga0068858_100860205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 886 | Open in IMG/M |
| 3300006046|Ga0066652_100159160 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300006173|Ga0070716_101228065 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006844|Ga0075428_101219382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300006854|Ga0075425_101107025 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006871|Ga0075434_101822140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
| 3300006881|Ga0068865_101235105 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006904|Ga0075424_100853002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300006954|Ga0079219_12310605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300006969|Ga0075419_11152296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
| 3300009012|Ga0066710_103643795 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009038|Ga0099829_11282621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 606 | Open in IMG/M |
| 3300009089|Ga0099828_10837904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
| 3300009100|Ga0075418_10750598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1053 | Open in IMG/M |
| 3300009137|Ga0066709_100463495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1775 | Open in IMG/M |
| 3300009137|Ga0066709_102370011 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300009147|Ga0114129_10060254 | All Organisms → cellular organisms → Bacteria | 5307 | Open in IMG/M |
| 3300009162|Ga0075423_10258818 | Not Available | 1823 | Open in IMG/M |
| 3300009176|Ga0105242_12827221 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009792|Ga0126374_11887235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300009803|Ga0105065_1052902 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009805|Ga0105079_1045730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300009820|Ga0105085_1082650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 612 | Open in IMG/M |
| 3300009821|Ga0105064_1094961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300010046|Ga0126384_10780251 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300010046|Ga0126384_12068473 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300010047|Ga0126382_10738567 | Not Available | 831 | Open in IMG/M |
| 3300010048|Ga0126373_13166710 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010320|Ga0134109_10060955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300010359|Ga0126376_10225026 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300010360|Ga0126372_10762702 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010398|Ga0126383_11100957 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300010400|Ga0134122_12746282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 545 | Open in IMG/M |
| 3300010401|Ga0134121_10451998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1173 | Open in IMG/M |
| 3300010403|Ga0134123_13129412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300011271|Ga0137393_10567191 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300012189|Ga0137388_11392143 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012198|Ga0137364_10806866 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012203|Ga0137399_11791823 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012204|Ga0137374_10114169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2504 | Open in IMG/M |
| 3300012205|Ga0137362_10364801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1251 | Open in IMG/M |
| 3300012358|Ga0137368_10500909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 783 | Open in IMG/M |
| 3300012360|Ga0137375_10384568 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300012362|Ga0137361_10600887 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012399|Ga0134061_1308857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300012917|Ga0137395_10176290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1477 | Open in IMG/M |
| 3300012917|Ga0137395_10523498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300012918|Ga0137396_10998129 | Not Available | 606 | Open in IMG/M |
| 3300012930|Ga0137407_11527335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300012944|Ga0137410_11348683 | Not Available | 618 | Open in IMG/M |
| 3300012948|Ga0126375_10524998 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300012971|Ga0126369_10711943 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300012971|Ga0126369_12386855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
| 3300012972|Ga0134077_10115054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1052 | Open in IMG/M |
| 3300014269|Ga0075302_1146836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300014324|Ga0075352_1174484 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
| 3300015241|Ga0137418_10261927 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300015356|Ga0134073_10257206 | Not Available | 605 | Open in IMG/M |
| 3300015372|Ga0132256_101566964 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300015373|Ga0132257_104275035 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300016270|Ga0182036_10790370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
| 3300016371|Ga0182034_10707042 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300017656|Ga0134112_10148547 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300017659|Ga0134083_10429996 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300018000|Ga0184604_10000784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3941 | Open in IMG/M |
| 3300018028|Ga0184608_10294332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 714 | Open in IMG/M |
| 3300018079|Ga0184627_10120101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1391 | Open in IMG/M |
| 3300018084|Ga0184629_10089411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1489 | Open in IMG/M |
| 3300018431|Ga0066655_11312038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300018433|Ga0066667_10354512 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300018433|Ga0066667_10784885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
| 3300023067|Ga0247743_1027975 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300025910|Ga0207684_10255483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1512 | Open in IMG/M |
| 3300025911|Ga0207654_11192961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300025922|Ga0207646_10481799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1118 | Open in IMG/M |
| 3300025930|Ga0207701_10961070 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300025941|Ga0207711_10331705 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300025965|Ga0210090_1038729 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300026298|Ga0209236_1130862 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300026328|Ga0209802_1002581 | All Organisms → cellular organisms → Bacteria | 12494 | Open in IMG/M |
| 3300026332|Ga0209803_1100736 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300026333|Ga0209158_1010311 | All Organisms → cellular organisms → Bacteria | 4639 | Open in IMG/M |
| 3300026469|Ga0257169_1077061 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026536|Ga0209058_1319186 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027527|Ga0209684_1065035 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
| 3300027775|Ga0209177_10104536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300027876|Ga0209974_10146235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 851 | Open in IMG/M |
| 3300027909|Ga0209382_10516682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1313 | Open in IMG/M |
| 3300027909|Ga0209382_11250791 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027954|Ga0209859_1032262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300028381|Ga0268264_10472205 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300031720|Ga0307469_11343930 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300031764|Ga0318535_10518192 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031858|Ga0310892_11304680 | Not Available | 520 | Open in IMG/M |
| 3300031903|Ga0307407_10434673 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300031946|Ga0310910_10968173 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032013|Ga0310906_10784368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 672 | Open in IMG/M |
| 3300032122|Ga0310895_10153899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 995 | Open in IMG/M |
| 3300032174|Ga0307470_10042605 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300032174|Ga0307470_11871909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300032180|Ga0307471_104288456 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.03% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.61% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_113557791 | 3300000891 | Soil | DAYQQTFVDEPRLYSKVQEIGEKLLARTGVTLPRSRWPIV* |
| JGI1027J12803_1091017402 | 3300000955 | Soil | VDGYRQTFVDEGRLFQKIQEIGERLQARTGITFPRSR |
| JGIcombinedJ26739_1009126842 | 3300002245 | Forest Soil | QTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMS* |
| Ga0055433_101276102 | 3300004025 | Natural And Restored Wetlands | VVDAYRQTFADERRLFSKVQEIGERLQARTGITFPRSKWPMS* |
| Ga0065712_106232911 | 3300005290 | Miscanthus Rhizosphere | VIDAYQQTFVDEPRLYSKVQEMGEKLLARTGVKPGLPRWPIV* |
| Ga0065707_108435722 | 3300005295 | Switchgrass Rhizosphere | IDGRVVVDAYRQSFVDEPKLYAKVQEMGEKLMARTDTTFPRSRWQIV* |
| Ga0066388_1082122671 | 3300005332 | Tropical Forest Soil | VVDAYRQSFVDEDRLFEKVQEIGERLQVRTGITFPRSRWPIV* |
| Ga0070661_1019205921 | 3300005344 | Corn Rhizosphere | VDAYRQSFVDEPRLFARVQEIGERLLARTGVELPRSRWPII* |
| Ga0070694_1002620911 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAYRQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMS* |
| Ga0066689_101166741 | 3300005447 | Soil | AYRQTFVDEPRLFAQVQEIGEKLQRRTGTTFPRSRWPIL* |
| Ga0066689_106693321 | 3300005447 | Soil | VDAYRQSFVDEGRLFAKVQEIGEQLQARTGITFPRSRWPIV* |
| Ga0070697_1021425121 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDAYRQTFVDEPRLYAQVQEIGERLQARTGISFPRSRWPMS* |
| Ga0066697_104806483 | 3300005540 | Soil | FVDEGRLFATVQEIGERLQSRTGITFPRSRWPVV* |
| Ga0070696_1011274581 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVDAYRQTFADEPRLFAKVQDIGERLQARTGITFPRSKWPMG* |
| Ga0066701_104606084 | 3300005552 | Soil | YRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV* |
| Ga0066692_103870994 | 3300005555 | Soil | QSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV* |
| Ga0066698_102254083 | 3300005558 | Soil | RQSFVDEARLFAKVQEIGERLQARTGITFPRSRWPIV* |
| Ga0066691_100330201 | 3300005586 | Soil | TFVDEPKLYAKVQVVGEQLMARTGTSFPRSRWNII* |
| Ga0068859_1007821181 | 3300005617 | Switchgrass Rhizosphere | RVVVDAYRQSFVDEPKLFARVQEIGEQLQARTGITFPRSRWPIV* |
| Ga0066903_1003413244 | 3300005764 | Tropical Forest Soil | QTFVDEGRLFQKVQEIGEQLQARTGITFPRSRWPIV* |
| Ga0066903_1010815631 | 3300005764 | Tropical Forest Soil | VVIDAYRQTFVDEPRLFAKVQEIGEKLQRRTGTSFPRSRWQIL* |
| Ga0066903_1072640711 | 3300005764 | Tropical Forest Soil | VIDAYRQSFVDEGRLFATVQEIGERLQKRTGITFPRSRWPIV* |
| Ga0074479_100626531 | 3300005829 | Sediment (Intertidal) | RQTFADEPRLFAKVQEIGERLQARTGITFPRSKWPMS* |
| Ga0068858_1008602051 | 3300005842 | Switchgrass Rhizosphere | YRQSFVDEPKLFAKVQEIGEQLQARTGITFPRSRWPIV* |
| Ga0066652_1001591603 | 3300006046 | Soil | RQTFVDESRLFATVQEIGERLQARTGITFPRSRWPIL* |
| Ga0070716_1012280651 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAYRQTFVDEPRLFAKVQEIGEKLQTRTGTTFPRARWQIV* |
| Ga0075428_1012193821 | 3300006844 | Populus Rhizosphere | QSFADEGKLFAQAQEIGERLLARTGVSFPRSRWPVI* |
| Ga0075425_1011070251 | 3300006854 | Populus Rhizosphere | FVDEPRLFAKVQEIGEKLQRRTGTTFPRSRWQIV* |
| Ga0075434_1018221402 | 3300006871 | Populus Rhizosphere | RVVVDAYRQTFVDETRLFGKVQEIGEKLQARTGITFPLSRWPMG* |
| Ga0068865_1012351052 | 3300006881 | Miscanthus Rhizosphere | QTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMI* |
| Ga0075424_1008530021 | 3300006904 | Populus Rhizosphere | IDGRVVVDAYRQSFVDEPRLYAKVQEMGEKLLARTDTTFPRSRWQIV* |
| Ga0079219_123106053 | 3300006954 | Agricultural Soil | VDAYQQSFVDEPRLYSKVQEIGESLLARTGVSHPRSRWPMV* |
| Ga0075419_111522961 | 3300006969 | Populus Rhizosphere | GKQRFVDADRLYGQIQEIGESLQARTGITFPRSRWPIV* |
| Ga0066710_1036437952 | 3300009012 | Grasslands Soil | DAYRQTFVDEPRLFAQVQEIGEKLQRRTGTTFPRSRWPIL |
| Ga0099829_112826211 | 3300009038 | Vadose Zone Soil | FVDETRLFGKVQEIGEKLQARTGITFPLSKWPMS* |
| Ga0099828_108379042 | 3300009089 | Vadose Zone Soil | DAYRQSFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0075418_107505981 | 3300009100 | Populus Rhizosphere | GRVVVDAYRQTFVDEPSLYAQVQEIGEKLQRRTGTTFPRSRWPIL* |
| Ga0066709_1004634953 | 3300009137 | Grasslands Soil | VVDAYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV* |
| Ga0066709_1023700111 | 3300009137 | Grasslands Soil | FVDEGRLFATVQEIGERLQSRTGITFPRSRWPVL* |
| Ga0114129_100602546 | 3300009147 | Populus Rhizosphere | YRQTFVDEARLYSTVQEIGERLQARTGISFPRSRWPIS* |
| Ga0075423_102588184 | 3300009162 | Populus Rhizosphere | GYRQTFVDAARLFSTVQEIGERLQARTGISFPRSRWPIV* |
| Ga0105242_128272213 | 3300009176 | Miscanthus Rhizosphere | YKQSFVDEPRLFSKVQEIGESLLARTGVSQPRSRWPMV* |
| Ga0126374_118872351 | 3300009792 | Tropical Forest Soil | VDNYRQTFADEPRLFAKVQEIGEQLQARTGISFARSKWPMS* |
| Ga0105065_10529022 | 3300009803 | Groundwater Sand | VDAYRQTFVDEPRLFAKVQEIGERLQARTGISFPRSRWPMS* |
| Ga0105079_10457302 | 3300009805 | Groundwater Sand | FVEEARLFGRVQEIGERLLARTGVTLPRSRWPIV* |
| Ga0105085_10826502 | 3300009820 | Groundwater Sand | SFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0105064_10949611 | 3300009821 | Groundwater Sand | QSFVDEPQLFAKVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0126384_107802512 | 3300010046 | Tropical Forest Soil | VDAYRQSFVDEDRLFGEVQEIGERLQARTGITFPRSRWPIV* |
| Ga0126384_120684731 | 3300010046 | Tropical Forest Soil | QSFVDEERLFARVQEIGEQLLARTGVALPRSRWPIV* |
| Ga0126382_107385671 | 3300010047 | Tropical Forest Soil | TFVDEPRLFAKVQEIGEKLQRRTGTSFPRSRWQIV* |
| Ga0126373_131667103 | 3300010048 | Tropical Forest Soil | DGYRQTFVDERRLFATVQEIGERLQARTGIHFPLTRWPVV* |
| Ga0134109_100609551 | 3300010320 | Grasslands Soil | AYKQTFVDEPKLYARVQAVGEQLMARTGTSFPRSRWNIL* |
| Ga0126376_102250261 | 3300010359 | Tropical Forest Soil | GHRQTFVDAARLFSTVQEIGERLQARTGITFPRSRWPVV* |
| Ga0126372_107627023 | 3300010360 | Tropical Forest Soil | DAYRQSFVDEPKLYAMVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0126383_111009573 | 3300010398 | Tropical Forest Soil | VVVDAYRQTFVDERRLYGTVQEIGERLQARTGVTFPTSRWPIV* |
| Ga0134122_127462821 | 3300010400 | Terrestrial Soil | YRQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMI* |
| Ga0134121_104519981 | 3300010401 | Terrestrial Soil | DGKVVVDTYRQTFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQIV* |
| Ga0134123_131294122 | 3300010403 | Terrestrial Soil | FVDEPRLFARVQEIGERLLARTGVELPRSRWPIV* |
| Ga0137393_105671911 | 3300011271 | Vadose Zone Soil | DDYRQAFVDEARLFATVQEIGERLQARTGITFPRSRWPVV* |
| Ga0137388_113921432 | 3300012189 | Vadose Zone Soil | DAYRQAFVDEARLFAKVQEIGDRLQARNGVTFPRPGWPIV* |
| Ga0137364_108068663 | 3300012198 | Vadose Zone Soil | IVVDNYRQTFVDEARLFSTVQEIGERLQARTGITFPRSRWPVL* |
| Ga0137399_117918231 | 3300012203 | Vadose Zone Soil | DAYKQSFVDEPRLYSKVQEIGESLLARTGVSHPRSRWPMV* |
| Ga0137374_101141691 | 3300012204 | Vadose Zone Soil | RQSFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0137362_103648012 | 3300012205 | Vadose Zone Soil | SFVEESRLFAKVQEIGERLQARTGITYPRSRWPII* |
| Ga0137368_105009092 | 3300012358 | Vadose Zone Soil | FVDEPQLFAKVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0137375_103845683 | 3300012360 | Vadose Zone Soil | DAYRQSFVDEPRLFARVQEIGERLQARTGVSFPRSRWPMS* |
| Ga0137361_106008871 | 3300012362 | Vadose Zone Soil | YRQTFVDAPRLYAQVQEIGEKLQRRTGTTFPRSRWPIL* |
| Ga0134061_13088572 | 3300012399 | Grasslands Soil | QSFVDEARLFAKVQEIGEQLQARTGITFPRSRWPIV* |
| Ga0137395_101762901 | 3300012917 | Vadose Zone Soil | YRQTFVDEPRLFAKVQEIGEKLQTRTGTTFPRSRWPIV* |
| Ga0137395_105234981 | 3300012917 | Vadose Zone Soil | RVVVDAYRQTFVDEARLFGKVQEIGERLQARTGITFPLSRWPMG* |
| Ga0137396_109981291 | 3300012918 | Vadose Zone Soil | TFVDEARLFATVQEIGERLQARTGITFPRSRWPVV* |
| Ga0137407_115273351 | 3300012930 | Vadose Zone Soil | AYRQSFVDEPRLFAQVQEIGEKLQARTGTTFPRSRWQIV* |
| Ga0137410_113486831 | 3300012944 | Vadose Zone Soil | AFVDEARLFATVQEIGERLQARTGITFPRSRWPVV* |
| Ga0126375_105249982 | 3300012948 | Tropical Forest Soil | RQTFVDEPRLFAKVQEIGEKLQTRTGTSFPRSRWPVV* |
| Ga0126369_107119433 | 3300012971 | Tropical Forest Soil | FVDEPTLFSRVQEMGEKLLARTGVSFPRSRWPVV* |
| Ga0126369_123868552 | 3300012971 | Tropical Forest Soil | RVVVDAYRQSFVDEDRLFEKVQEIGERLQVRTGITFPRSRWPIV* |
| Ga0134077_101150541 | 3300012972 | Grasslands Soil | QSFVDEARLFAKVQEIGEQLQARTGVTFPRSRWPIV* |
| Ga0075302_11468361 | 3300014269 | Natural And Restored Wetlands | TFADEPRLFGKVQEIGERLQARTGITFPRSKWPMS* |
| Ga0075352_11744843 | 3300014324 | Natural And Restored Wetlands | QSFADEGKLYATVQEIGERLQARTGITFPRSRWPFA* |
| Ga0137418_102619272 | 3300015241 | Vadose Zone Soil | MGNLPGPGRVVVDAYRQTFVDETRLFGKVQEIGEKLQARTGITFPLSKWPMS* |
| Ga0134073_102572061 | 3300015356 | Grasslands Soil | RQSFVDEGRLFATVQEIGERLQSRTGITFPRSRWPIL* |
| Ga0132256_1015669643 | 3300015372 | Arabidopsis Rhizosphere | VVDAYRQTFVNEARLFGKVQEIGERLQARTGITFPLSRWPMG* |
| Ga0132257_1042750351 | 3300015373 | Arabidopsis Rhizosphere | KVVVDAYRQTFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQIV* |
| Ga0182036_107903701 | 3300016270 | Soil | DGKVVIDAYRQTFVDEPRLFAKVQEIGEKLQTRTGTTFPRSRWQMV |
| Ga0182034_107070421 | 3300016371 | Soil | RVVVDNYRQTFADEPRLFAKVQEIGEQLQARTGITFPRSKWPMS |
| Ga0134112_101485471 | 3300017656 | Grasslands Soil | RQTFVDESRLFATVQEIGERLQARTGITFPRSRWPIL |
| Ga0134083_104299961 | 3300017659 | Grasslands Soil | SFVDEPQLFARVQEIGEKLQARTGTTFPRSRWQIL |
| Ga0184604_100007846 | 3300018000 | Groundwater Sediment | YRQSFVDEPRLFARVQEIGERLQARTGVSFPRSRWPMS |
| Ga0184608_102943321 | 3300018028 | Groundwater Sediment | TFVDEPRLYAKVQEIGEKLLARTGVSLPPSRWPIV |
| Ga0184627_101201013 | 3300018079 | Groundwater Sediment | QTFVDEPRLYATVQEIGERLLARTGVSFPRSRWPIV |
| Ga0184629_100894112 | 3300018084 | Groundwater Sediment | VVVDGYRQTFVDERRLYATVQEIGERLQARTGIKAPPSRWPVV |
| Ga0066655_113120382 | 3300018431 | Grasslands Soil | AYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV |
| Ga0066667_103545121 | 3300018433 | Grasslands Soil | SFVDEGRLFGKVQEIGERLQARTGITFPRSRWPIV |
| Ga0066667_107848852 | 3300018433 | Grasslands Soil | VVDAYRQSFVDEPRLYAKVQEVGEKLLARTGVTPAPPRWPVV |
| Ga0247743_10279751 | 3300023067 | Soil | VDAYRQRFVDEPRLFAKVQEIGERLQARTGIRFPRSRWPLS |
| Ga0207684_102554831 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QTFVDEPCLYARVQEIGERLQARTGISFPRSRWPLS |
| Ga0207654_111929613 | 3300025911 | Corn Rhizosphere | DAYRQSFVDEPKLFAKVQEIGERLQARTGITFPRSRWPIV |
| Ga0207646_104817993 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VVFNAYRQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPLS |
| Ga0207701_109610702 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | YRQRFVDEPRLFAKVQEIGEKLQTRTGTTFPRARWQIV |
| Ga0207711_103317051 | 3300025941 | Switchgrass Rhizosphere | VVDAYRQSFVDEPKLFAKVQEIGEQLQARTGITFPRSRWPIV |
| Ga0210090_10387292 | 3300025965 | Natural And Restored Wetlands | YRQSFVDEPRLYARVQEIGEQLQARTGVSFPRSRWPMS |
| Ga0209236_11308621 | 3300026298 | Grasslands Soil | DAYRQSFVDEPRLYAKVQEIGESLLARTGVSHPRSRWPMV |
| Ga0209802_100258111 | 3300026328 | Soil | DAYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV |
| Ga0209803_11007361 | 3300026332 | Soil | RVDAYRQTFVDEPRLFAQVQEIGEKLQRRTGTTFPRSRWPIL |
| Ga0209158_10103111 | 3300026333 | Soil | TFVDEPKLYAKVQVVGEQLMARTGTSFPRSRWNII |
| Ga0257169_10770611 | 3300026469 | Soil | HRQSFVDEGRLFGKVQEIGERLQARTGITFPRSRWPIV |
| Ga0209058_13191862 | 3300026536 | Soil | AYRQSFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV |
| Ga0209684_10650352 | 3300027527 | Tropical Forest Soil | NYRQTFADEPRLFAKVQEIGEQLQARTGITFPRSKWPMS |
| Ga0209177_101045363 | 3300027775 | Agricultural Soil | RQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMI |
| Ga0209974_101462352 | 3300027876 | Arabidopsis Thaliana Rhizosphere | DAYRQAFVDEARLFAQVQEIGERLQARTGVRFPPSRWPIV |
| Ga0209382_105166821 | 3300027909 | Populus Rhizosphere | IVVDNYRQTFVDEARLFSTVQEIGERLQARTGITFPRSRWPVS |
| Ga0209382_112507912 | 3300027909 | Populus Rhizosphere | IDAYRQTFVDEPRLYSKVQEIGEKLLARTGVTLPRSRWPIV |
| Ga0209859_10322621 | 3300027954 | Groundwater Sand | QTFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV |
| Ga0268264_104722053 | 3300028381 | Switchgrass Rhizosphere | QSFVDEPKLFAKVQEIGERLQARTGITFPRSRWPIV |
| Ga0307469_113439301 | 3300031720 | Hardwood Forest Soil | AYRQTFVDEPRLFAKVQEIGEKLQRRTGTTIPRSRWQIV |
| Ga0318535_105181922 | 3300031764 | Soil | GRVVVDAYRQSFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQII |
| Ga0310892_113046801 | 3300031858 | Soil | YKQSFVDEARLFAKVQEIGESLQARTGITFPRSRWPIV |
| Ga0307407_104346732 | 3300031903 | Rhizosphere | AYRQTFVDERRLYARVQEIGENLLARTGVAPGRPRWPIV |
| Ga0310910_109681731 | 3300031946 | Soil | YRQSFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQII |
| Ga0310906_107843681 | 3300032013 | Soil | KQRFVDADALYGKVQAIGESLQTRTGITFPRSRWPIV |
| Ga0310895_101538992 | 3300032122 | Soil | DGRVRVDAYRQTFVDEPRLFAQVQEIGEKLQRRTGTSFPRSRWPIL |
| Ga0307470_100426053 | 3300032174 | Hardwood Forest Soil | VVDAYRQTFADEPRLFAKVQDIGERLQARTGITFPRSKWPMG |
| Ga0307470_118719092 | 3300032174 | Hardwood Forest Soil | DAYRQAFVDEPRLFAKVQEIGEKLQTRTGTTFPRSRWQIV |
| Ga0307471_1042884561 | 3300032180 | Hardwood Forest Soil | AYRQSFVDEGRLYAKVQEIGERLLARTAVTFPRSRWPVV |
| ⦗Top⦘ |