


| Basic Information | |
|---|---|
| Family ID | F069111 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSVQGVQRSNHHVPRYDALEILMIAAGVVFIVAVALVF |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.90 % |
| % of genes near scaffold ends (potentially truncated) | 16.94 % |
| % of genes from short scaffolds (< 2000 bps) | 79.84 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.613 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.645 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.581 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (83.065 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00132 | Hexapep | 8.06 |
| PF00072 | Response_reg | 5.65 |
| PF16576 | HlyD_D23 | 4.84 |
| PF06035 | Peptidase_C93 | 3.23 |
| PF02668 | TauD | 2.42 |
| PF13505 | OMP_b-brl | 2.42 |
| PF00873 | ACR_tran | 1.61 |
| PF13561 | adh_short_C2 | 1.61 |
| PF02627 | CMD | 0.81 |
| PF04851 | ResIII | 0.81 |
| PF10276 | zf-CHCC | 0.81 |
| PF14417 | MEDS | 0.81 |
| PF13439 | Glyco_transf_4 | 0.81 |
| PF03480 | DctP | 0.81 |
| PF11324 | DUF3126 | 0.81 |
| PF00211 | Guanylate_cyc | 0.81 |
| PF03852 | Vsr | 0.81 |
| PF01823 | MACPF | 0.81 |
| PF00291 | PALP | 0.81 |
| PF00171 | Aldedh | 0.81 |
| PF04717 | Phage_base_V | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 3.23 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.81 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.81 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3727 | G:T-mismatch repair DNA endonuclease Vsr, very short patch repair protein | Replication, recombination and repair [L] | 0.81 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
| COG4540 | Phage P2 baseplate assembly protein gpV | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.61 % |
| All Organisms | root | All Organisms | 48.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459007|GJ61VE201A6S14 | Not Available | 511 | Open in IMG/M |
| 3300000567|JGI12270J11330_10030954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3129 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101111201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300004103|Ga0058903_1523518 | Not Available | 797 | Open in IMG/M |
| 3300005538|Ga0070731_10043020 | All Organisms → cellular organisms → Bacteria | 3022 | Open in IMG/M |
| 3300005538|Ga0070731_10203928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1313 | Open in IMG/M |
| 3300005602|Ga0070762_10047751 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300005602|Ga0070762_10389414 | Not Available | 896 | Open in IMG/M |
| 3300005602|Ga0070762_10736243 | Not Available | 664 | Open in IMG/M |
| 3300005610|Ga0070763_10196627 | Not Available | 1073 | Open in IMG/M |
| 3300005921|Ga0070766_10082293 | Not Available | 1876 | Open in IMG/M |
| 3300005921|Ga0070766_10237157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300005921|Ga0070766_10352208 | Not Available | 956 | Open in IMG/M |
| 3300005921|Ga0070766_10518540 | Not Available | 794 | Open in IMG/M |
| 3300005921|Ga0070766_10687438 | Not Available | 692 | Open in IMG/M |
| 3300005921|Ga0070766_10794034 | Not Available | 645 | Open in IMG/M |
| 3300006176|Ga0070765_100064537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3046 | Open in IMG/M |
| 3300006176|Ga0070765_100064822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3040 | Open in IMG/M |
| 3300006176|Ga0070765_100133964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2190 | Open in IMG/M |
| 3300006176|Ga0070765_100437145 | Not Available | 1225 | Open in IMG/M |
| 3300006176|Ga0070765_101136983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter agilis | 738 | Open in IMG/M |
| 3300006176|Ga0070765_101145745 | Not Available | 735 | Open in IMG/M |
| 3300006176|Ga0070765_101241089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300006176|Ga0070765_102037748 | Not Available | 536 | Open in IMG/M |
| 3300006893|Ga0073928_10075361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2910 | Open in IMG/M |
| 3300006893|Ga0073928_10311108 | Not Available | 1180 | Open in IMG/M |
| 3300006893|Ga0073928_10564746 | Not Available | 808 | Open in IMG/M |
| 3300009524|Ga0116225_1092963 | Not Available | 1404 | Open in IMG/M |
| 3300009683|Ga0116224_10545479 | Not Available | 553 | Open in IMG/M |
| 3300010379|Ga0136449_100771809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1595 | Open in IMG/M |
| 3300010379|Ga0136449_103239218 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010379|Ga0136449_103239364 | Not Available | 628 | Open in IMG/M |
| 3300010379|Ga0136449_104547903 | Not Available | 509 | Open in IMG/M |
| 3300010876|Ga0126361_10708646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300010880|Ga0126350_11569388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300011120|Ga0150983_13248184 | Not Available | 550 | Open in IMG/M |
| 3300011120|Ga0150983_13261228 | Not Available | 882 | Open in IMG/M |
| 3300011120|Ga0150983_13910397 | Not Available | 760 | Open in IMG/M |
| 3300011120|Ga0150983_14881586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300011270|Ga0137391_10604255 | Not Available | 919 | Open in IMG/M |
| 3300014200|Ga0181526_10445999 | Not Available | 820 | Open in IMG/M |
| 3300014489|Ga0182018_10028715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3561 | Open in IMG/M |
| 3300014489|Ga0182018_10198118 | Not Available | 1124 | Open in IMG/M |
| 3300014501|Ga0182024_10156831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3187 | Open in IMG/M |
| 3300014657|Ga0181522_10201175 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300014657|Ga0181522_10301560 | Not Available | 951 | Open in IMG/M |
| 3300015089|Ga0167643_1049752 | Not Available | 637 | Open in IMG/M |
| 3300019258|Ga0181504_1274987 | Not Available | 1115 | Open in IMG/M |
| 3300020021|Ga0193726_1000065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 189915 | Open in IMG/M |
| 3300020579|Ga0210407_10973787 | Not Available | 648 | Open in IMG/M |
| 3300020580|Ga0210403_10562014 | Not Available | 924 | Open in IMG/M |
| 3300020581|Ga0210399_10280839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1390 | Open in IMG/M |
| 3300020581|Ga0210399_10687261 | Not Available | 842 | Open in IMG/M |
| 3300020583|Ga0210401_10425325 | Not Available | 1191 | Open in IMG/M |
| 3300020583|Ga0210401_10518930 | Not Available | 1054 | Open in IMG/M |
| 3300021088|Ga0210404_10221046 | Not Available | 1022 | Open in IMG/M |
| 3300021170|Ga0210400_10443565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300021170|Ga0210400_11162995 | Not Available | 623 | Open in IMG/M |
| 3300021171|Ga0210405_10005345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11772 | Open in IMG/M |
| 3300021171|Ga0210405_10124476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2036 | Open in IMG/M |
| 3300021171|Ga0210405_10437581 | Not Available | 1028 | Open in IMG/M |
| 3300021178|Ga0210408_10018369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5616 | Open in IMG/M |
| 3300021181|Ga0210388_10203377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1733 | Open in IMG/M |
| 3300021181|Ga0210388_10902412 | Not Available | 762 | Open in IMG/M |
| 3300021403|Ga0210397_10170425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1536 | Open in IMG/M |
| 3300021403|Ga0210397_10571777 | Not Available | 862 | Open in IMG/M |
| 3300021406|Ga0210386_10619276 | Not Available | 935 | Open in IMG/M |
| 3300021420|Ga0210394_10210504 | Not Available | 1696 | Open in IMG/M |
| 3300021420|Ga0210394_10972739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300021420|Ga0210394_11092506 | Not Available | 688 | Open in IMG/M |
| 3300021420|Ga0210394_11441171 | Not Available | 584 | Open in IMG/M |
| 3300021420|Ga0210394_11576305 | Not Available | 553 | Open in IMG/M |
| 3300021474|Ga0210390_10286555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1395 | Open in IMG/M |
| 3300021474|Ga0210390_10384895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 8X | 1186 | Open in IMG/M |
| 3300021474|Ga0210390_11009187 | Not Available | 680 | Open in IMG/M |
| 3300021477|Ga0210398_10620724 | Not Available | 877 | Open in IMG/M |
| 3300021478|Ga0210402_10598796 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300021478|Ga0210402_10701507 | Not Available | 935 | Open in IMG/M |
| 3300021479|Ga0210410_10044770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3853 | Open in IMG/M |
| 3300021479|Ga0210410_11160701 | Not Available | 663 | Open in IMG/M |
| 3300021559|Ga0210409_11447573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300022522|Ga0242659_1013388 | Not Available | 1179 | Open in IMG/M |
| 3300022530|Ga0242658_1187892 | Not Available | 555 | Open in IMG/M |
| 3300022532|Ga0242655_10044113 | Not Available | 1075 | Open in IMG/M |
| 3300022532|Ga0242655_10167221 | Not Available | 654 | Open in IMG/M |
| 3300022557|Ga0212123_10333361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300022711|Ga0242674_1048052 | Not Available | 581 | Open in IMG/M |
| 3300022722|Ga0242657_1028397 | Not Available | 1113 | Open in IMG/M |
| 3300024225|Ga0224572_1007548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1995 | Open in IMG/M |
| 3300025494|Ga0207928_1037763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300027090|Ga0208604_1000563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 4409 | Open in IMG/M |
| 3300027370|Ga0209010_1000734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9448 | Open in IMG/M |
| 3300027567|Ga0209115_1000196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 7606 | Open in IMG/M |
| 3300027568|Ga0208042_1001950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6471 | Open in IMG/M |
| 3300027583|Ga0209527_1105886 | Not Available | 630 | Open in IMG/M |
| 3300027629|Ga0209422_1067746 | Not Available | 843 | Open in IMG/M |
| 3300027678|Ga0209011_1005107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4524 | Open in IMG/M |
| 3300027684|Ga0209626_1020430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1577 | Open in IMG/M |
| 3300027854|Ga0209517_10493811 | Not Available | 668 | Open in IMG/M |
| 3300027855|Ga0209693_10057017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1921 | Open in IMG/M |
| 3300027879|Ga0209169_10039418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2479 | Open in IMG/M |
| 3300027889|Ga0209380_10020908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 3701 | Open in IMG/M |
| 3300027889|Ga0209380_10213499 | Not Available | 1133 | Open in IMG/M |
| 3300027889|Ga0209380_10413798 | Not Available | 790 | Open in IMG/M |
| 3300027908|Ga0209006_11422555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300028906|Ga0308309_10120039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2069 | Open in IMG/M |
| 3300028906|Ga0308309_10149653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1877 | Open in IMG/M |
| 3300028906|Ga0308309_10186410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1699 | Open in IMG/M |
| 3300028906|Ga0308309_10231092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300028906|Ga0308309_11764398 | Not Available | 524 | Open in IMG/M |
| 3300030888|Ga0265769_102640 | Not Available | 953 | Open in IMG/M |
| 3300031018|Ga0265773_1048343 | Not Available | 504 | Open in IMG/M |
| 3300031057|Ga0170834_111510201 | Not Available | 507 | Open in IMG/M |
| 3300031090|Ga0265760_10008758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2893 | Open in IMG/M |
| 3300031231|Ga0170824_103537415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300031238|Ga0265332_10222867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300031446|Ga0170820_13521983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
| 3300031474|Ga0170818_111662646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300031708|Ga0310686_103213877 | Not Available | 587 | Open in IMG/M |
| 3300031708|Ga0310686_119836578 | Not Available | 1350 | Open in IMG/M |
| 3300031715|Ga0307476_10000431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 33469 | Open in IMG/M |
| 3300032160|Ga0311301_10139228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4456 | Open in IMG/M |
| 3300032160|Ga0311301_10522126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300032174|Ga0307470_10194806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 22.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.23% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.61% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_05645630 | 2170459007 | Grass Soil | MSVQGVQRSNQHVPRYDALEILMIAAGVVFIVAVALVF |
| JGI12270J11330_100309544 | 3300000567 | Peatlands Soil | MSVQGVQGSNSHVPHYDALEILMIAAGVVFIVAVALVF* |
| JGIcombinedJ26739_1011112011 | 3300002245 | Forest Soil | VQGVQRSNHHAPRYDALEILMIAAGVVLIVAVALVF* |
| Ga0058903_15235182 | 3300004103 | Forest Soil | MSVQGVQRSNHHAPRYDVLEILMIAAGVVFIVAVALDFDGSSNGV |
| Ga0070731_100430204 | 3300005538 | Surface Soil | MSVQGVQRTNDHIPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070731_102039282 | 3300005538 | Surface Soil | MSVQGVQRSNSHVPRYDALEILMIASGVVFIVAVALVF* |
| Ga0070762_100477512 | 3300005602 | Soil | MSVQGVQRSNRPAPRYDALEILMIAAGVVLIVAVALVI* |
| Ga0070762_103894141 | 3300005602 | Soil | MSVQGVQRSDQHIPRYDVLEILMIAGGVVFIVAVALVF* |
| Ga0070762_107362432 | 3300005602 | Soil | MSVQGVQRTDNHVPRYDVLEILMIAAGVVFIVAIALVF* |
| Ga0070763_101966272 | 3300005610 | Soil | MSVQGVQRSNDHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070766_100822932 | 3300005921 | Soil | MSVQGVQRTNNHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070766_102371572 | 3300005921 | Soil | MSVQGVQRSNSHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070766_103522082 | 3300005921 | Soil | MSVQGVQRSSNHVPRYDVLEILMIAAGVVFIVAVALVF* |
| Ga0070766_105185402 | 3300005921 | Soil | MSVQGVQHSSNHIPRYDAIEILMIAAGVVFIVAVALVF* |
| Ga0070766_106874382 | 3300005921 | Soil | MSVQGVQRSDQHIPRYDVLEILMIAAGVVFIVAVALVF* |
| Ga0070766_107940341 | 3300005921 | Soil | MSVQGVQRTDNHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070765_1000645372 | 3300006176 | Soil | MSAQGVQRTNNHVPRYDALEILMIAAGVVFIVAVAFIM* |
| Ga0070765_1000648223 | 3300006176 | Soil | MSVQGVRRSNGYVPRYDALEILMIASGVVFIVAVALVF* |
| Ga0070765_1001339644 | 3300006176 | Soil | MSVQGVHRSSHHAPRYDVLEILMIAAGVVFIVAVALVF* |
| Ga0070765_1004371451 | 3300006176 | Soil | MSVQGVQRSNSHVPRYDILEILMIAAGVVFIVAVALVF* |
| Ga0070765_1011369831 | 3300006176 | Soil | GSTAMSVQGVQRSNQHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070765_1011457452 | 3300006176 | Soil | MSVQGVQRSDSHVPRYDVLEILMIAAGVVFIVAVALVF* |
| Ga0070765_1012410892 | 3300006176 | Soil | NRRLLTGSTAMSVQGVQRTDNHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0070765_1020377481 | 3300006176 | Soil | RRLLTGSTAMSVQGVQRTDNRVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0073928_100753615 | 3300006893 | Iron-Sulfur Acid Spring | MSVQGVQRSNHHAPRYDVLEILMIAAGVVFIVAVALVF* |
| Ga0073928_103111083 | 3300006893 | Iron-Sulfur Acid Spring | MSVQGVQRSNHHAPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0073928_105647461 | 3300006893 | Iron-Sulfur Acid Spring | MSVQGVQRSNHHAPRYDVLEILMIAAGVVLIVAVALVF* |
| Ga0116225_10929633 | 3300009524 | Peatlands Soil | MSVQGVQRSNSHAPRFDALEILMIAVGVVFIVAVALVF* |
| Ga0116224_105454792 | 3300009683 | Peatlands Soil | MSVQGVQRSNSHVPHYDALEILMIAAGVVFIVAVALVF* |
| Ga0136449_1007718093 | 3300010379 | Peatlands Soil | MSVQGVQRSNSHIPRYDALEILMIAVGVVFIVAVALVF* |
| Ga0136449_1032392181 | 3300010379 | Peatlands Soil | MSVQGVQPSSHPVPRYDGLVILMIAAGVVFIVAVALVF* |
| Ga0136449_1032393641 | 3300010379 | Peatlands Soil | MSVQGVQRSNQHVPRYDAIEILMIAAGVVFIVAVALVF* |
| Ga0136449_1045479031 | 3300010379 | Peatlands Soil | MSVQGVQRSSHPVPRYDGLEILMIAAGVVFIVAVALVF* |
| Ga0126361_107086462 | 3300010876 | Boreal Forest Soil | STVMSVQDVQRSNHHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0126350_115693882 | 3300010880 | Boreal Forest Soil | SVQGVQRSNHHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0150983_132481841 | 3300011120 | Forest Soil | MSVQGVQRTNNHVPRYDALEILMIAAGVVLIVAVALVF* |
| Ga0150983_132612283 | 3300011120 | Forest Soil | MSAQGVQHSNHHAPRYDVLEILMIAAGVVLIVAVALVF* |
| Ga0150983_139103972 | 3300011120 | Forest Soil | MSVQGVQRSNNHVPRYDALEILMIDAGVVFIVAVALVF* |
| Ga0150983_148815861 | 3300011120 | Forest Soil | MSVQGVQRTDNHVPRYDALEILMIAAGVVFIVAVALVL* |
| Ga0137391_106042551 | 3300011270 | Vadose Zone Soil | MTAQSIQRSNTHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0181526_104459992 | 3300014200 | Bog | MSVQGVQHSSNHVPRYDALEILMIAAGVVLIVAVALVF* |
| Ga0182018_100287154 | 3300014489 | Palsa | MSVQGVERSNNHAPRYDVLEILMIAAGVVLIVAVALVF* |
| Ga0182018_101981182 | 3300014489 | Palsa | MPAQSVQRSNNHFPRYDTLEILMITAGVVFIVAVALVF* |
| Ga0182024_101568312 | 3300014501 | Permafrost | MSVQDVQRSNHHVPRYDALEILMIAAGVVFIVAVALVF* |
| Ga0181522_102011751 | 3300014657 | Bog | MSVQGVQHSNNHVPRHDVLEILMIAAGVVLAVAVALVF* |
| Ga0181522_103015601 | 3300014657 | Bog | MSVQGAQRTNNHVPRHDVLEVLMIAAGVVLAVAVALVF* |
| Ga0167643_10497522 | 3300015089 | Glacier Forefield Soil | MSVQGVQRSNQHVPRYDVLEILMIAAGVVLIVAVALVF* |
| Ga0181504_12749872 | 3300019258 | Peatland | MSVQGVQRTDNHIPRYDGLEILMIAAGVVLIVAVALVF |
| Ga0193726_1000065175 | 3300020021 | Soil | MSVQGVQRTNNHIPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210407_109737871 | 3300020579 | Soil | MSVQGVQRSNSHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210403_105620142 | 3300020580 | Soil | MSVQGVQRSNGHVPRYDTLEILMIAAGVVFIVAVALVF |
| Ga0210399_102808392 | 3300020581 | Soil | MSVQGVQRSNHHAPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0210399_106872612 | 3300020581 | Soil | MSVQGVRRSNGYVPRYDALEILMIASGVVFIVAVALVF |
| Ga0210401_104253252 | 3300020583 | Soil | MSVQGVQRSNSHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0210401_105189302 | 3300020583 | Soil | MSVQGVQRSNRPAPRYDALEILMIAAGVVLIVAVALVI |
| Ga0210404_102210461 | 3300021088 | Soil | MSVQGVQRSNHHAPRYDALEILMIGAGDVFIVAVALVF |
| Ga0210400_104435652 | 3300021170 | Soil | MSVQGVQRSNHHFPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210400_111629952 | 3300021170 | Soil | MSVQGVQRSNQHVPRYDALEILMIAAGVVFIVAVALV |
| Ga0210405_100053459 | 3300021171 | Soil | MSVQGVQRSNHHAPRYDVLEILMIAAGVVLIVAVALVF |
| Ga0210405_101244761 | 3300021171 | Soil | MSVQGVQRSNSHVPRCDILEILMIAAGVVFIVAVALVF |
| Ga0210405_104375812 | 3300021171 | Soil | MSVQGVQRTNDHIPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210408_100183692 | 3300021178 | Soil | MSVQGVQRSNQHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0210388_102033773 | 3300021181 | Soil | MSVQGVQRSDNHVPRYDALEILMVAAGVVLIVAVALVF |
| Ga0210388_109024121 | 3300021181 | Soil | MSVQGVQRSNHHIPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210397_101704251 | 3300021403 | Soil | MSVQGVQRSNGHVPRYDALEILMIASGVVFIVTVALVF |
| Ga0210397_105717771 | 3300021403 | Soil | MSVQGVQGSNHHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210386_106192763 | 3300021406 | Soil | MSVQGVQRSNRPVPRYDALEILMIAAGVVLIVAVALVI |
| Ga0210394_102105042 | 3300021420 | Soil | MSVQGVQRTNNRVPRYDAIEILMIAAGVVLIVAVALLF |
| Ga0210394_109727392 | 3300021420 | Soil | GSTAMSVQGVQRSNGHVPRYDTLEILMIAAGVVFIVAVALVF |
| Ga0210394_110925062 | 3300021420 | Soil | MSVQGVQRSNHHFPSYDALEILMIAAGVVFIVAVALVF |
| Ga0210394_114411712 | 3300021420 | Soil | MSVQGVQRSDSHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0210394_115763052 | 3300021420 | Soil | MSVQGVQRSNSHVQRYDVLEILMIAAGVVFIVAVALVF |
| Ga0210390_102865552 | 3300021474 | Soil | MSVQGVQRSNGHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0210390_103848952 | 3300021474 | Soil | TGSTVMSVQGVQRSNHPAPRYDVLEILMIAAGVVLIVAVALVF |
| Ga0210390_110091872 | 3300021474 | Soil | MSVQGVQRSNHHALRYNALEILMIAAGVVFIIAVALVF |
| Ga0210398_106207241 | 3300021477 | Soil | MSVQGVQRSRRYVPRYDVLEILMIAAGVVLIVAVALVF |
| Ga0210402_105987962 | 3300021478 | Soil | MSVQGVPRSNRPVPRYDALEVLMIAAGVVLIVAVALVI |
| Ga0210402_107015071 | 3300021478 | Soil | MSVQGVQRSNIHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0210410_100447703 | 3300021479 | Soil | MSVQGVQRSNHHAPRYDVLEILMVAAGVVFIVAVALVF |
| Ga0210410_111607011 | 3300021479 | Soil | TAMSVQGVQRSNHHALRYDALEILMIAAGVVFIVAVALVF |
| Ga0210409_114475731 | 3300021559 | Soil | RVQGVQHSNHHAPRYDVLEILMIAAGVVLIVAVALVF |
| Ga0242659_10133881 | 3300022522 | Soil | MSVQGVQRSNQHVPRYDVLEVLMIAAGVVFIVAVALVF |
| Ga0242658_11878922 | 3300022530 | Soil | MSVQGVQRSNHHLPRHDALEILMIAAGVVFIVAVALVF |
| Ga0242655_100441131 | 3300022532 | Soil | MSVQGVRRSNGHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0242655_101672212 | 3300022532 | Soil | MSVQGVQRSNHHALRYDALEILMIAAGVVFIVAVALVF |
| Ga0212123_103333612 | 3300022557 | Iron-Sulfur Acid Spring | MSVQGVQRSNHHAPRYDALEILMIAAGVVFIVAVALVF |
| Ga0242674_10480522 | 3300022711 | Soil | MSVQGVQRTDNHVARYDALEILMIAAGVVFIVAVALVF |
| Ga0242657_10283972 | 3300022722 | Soil | MSVQGVQRSNGHVPRYDALEILMIASGVVFIVAVALVF |
| Ga0224572_10075483 | 3300024225 | Rhizosphere | MSVQGVQRSNNHVPRYDALEILMIAAGVVFIVAVALVI |
| Ga0207928_10377632 | 3300025494 | Arctic Peat Soil | MSVQGLQRSNSHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0208604_10005634 | 3300027090 | Forest Soil | MSVQGVQRSNHHAPRYDILEILMIAAGVVFIVAVALVF |
| Ga0209010_10007344 | 3300027370 | Forest Soil | MSVQGVQHSSNHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0209115_10001967 | 3300027567 | Forest Soil | MSVQGVQRTDNHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0208042_10019507 | 3300027568 | Peatlands Soil | MSVQGVQGSNSHVPHYDALEILMIAAGVVFIVAVALVF |
| Ga0209527_11058862 | 3300027583 | Forest Soil | MSVQGVQRSNHHAPRYDVLEVLMIAAGAVFIVAVALVF |
| Ga0209422_10677461 | 3300027629 | Forest Soil | MSVQGVQRSNSHFPRYDALEILMIAAGVVFIVAVALVF |
| Ga0209011_10051078 | 3300027678 | Forest Soil | MSVQGVQRSNHHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0209626_10204303 | 3300027684 | Forest Soil | MSVQGVQRSNHHAPRYDVLEILMISAGVVFIVAVALVF |
| Ga0209517_104938112 | 3300027854 | Peatlands Soil | MSVQGVQRSNSHAPRFDALEILMIAVGVVFIVAVALVF |
| Ga0209693_100570173 | 3300027855 | Soil | MSVQGVQRSRSYVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0209169_100394184 | 3300027879 | Soil | MSVQGVQRSNDHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0209380_100209083 | 3300027889 | Soil | MSVQGVQRTNNHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0209380_102134991 | 3300027889 | Soil | MSVQGVQRSSNHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0209380_104137982 | 3300027889 | Soil | MSVQGVQHSSNHIPRYDAIEILMIAAGVVFIVAVALVF |
| Ga0209006_114225552 | 3300027908 | Forest Soil | QGVQRSNHHAPRFDALEILMIAAGVVFIVAVALVF |
| Ga0308309_101200393 | 3300028906 | Soil | MSVQGVHRSSHHAPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0308309_101496531 | 3300028906 | Soil | MSVQGVQHSNHHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0308309_101864101 | 3300028906 | Soil | MSVQGVQRSNSHVPRYDILEILMIAAGVVFIVAVALVF |
| Ga0308309_102310922 | 3300028906 | Soil | MSAQGVQRTNNHVPRYDALEILMIAAGVVFIVAVAFIM |
| Ga0308309_117643981 | 3300028906 | Soil | KSQRINRRLLTGSTVMSVQGVQRSNQHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0265769_1026401 | 3300030888 | Soil | MSVQGVQRTDNHVPRYDVLEILMIAAGVVFIVAIALVF |
| Ga0265773_10483431 | 3300031018 | Soil | ITNRRLLTGSTAMSVQGVQRSNNHVPRYDALEILMIAAGVVFIVAVALVI |
| Ga0170834_1115102012 | 3300031057 | Forest Soil | MSVQGVQRSDHHVPRYDVLEILMIAAGVVFIVAVALVF |
| Ga0265760_100087584 | 3300031090 | Soil | MSVQGVQRSNSHIPRYDALEILMIGAGVVFIVAVALVF |
| Ga0170824_1035374152 | 3300031231 | Forest Soil | VQGVQRSNHHAPRYDILEILMIAAGVVLIVAVALVF |
| Ga0265332_102228672 | 3300031238 | Rhizosphere | MSVQGVQRSNSHVPRYDILEILMIAAGVVLIVAVALVF |
| Ga0170820_135219831 | 3300031446 | Forest Soil | MSVQGVQRSNNHVPRYDALEILMIAAGVVFIVAVALVF |
| Ga0170818_1116626461 | 3300031474 | Forest Soil | VQGVQRSNQHVPRYDVLEILMIAAGVVLIVAVALVF |
| Ga0310686_1032138771 | 3300031708 | Soil | LLTGSTAMSVQGVQRTNDHIPRYDALEILMIAAGVVFIVAVALVF |
| Ga0310686_1198365782 | 3300031708 | Soil | MSVQGVQRSNHPAPRYDVLEILMIAAGVVLIVAVALVF |
| Ga0307476_1000043133 | 3300031715 | Hardwood Forest Soil | MSVQGVQRSNQHVPRYDALEVLMIAAGVAFIVAVALVF |
| Ga0311301_101392287 | 3300032160 | Peatlands Soil | MSVQGVQRSNSHVPHYDALEILMIAAGVVFIVAVALVF |
| Ga0311301_105221263 | 3300032160 | Peatlands Soil | MSVQGVQRSNSHIPRYDALEILMIAVGVVFIVAVALVF |
| Ga0307470_101948062 | 3300032174 | Hardwood Forest Soil | MSVQGVQHSNHHVPRYDVLEILMIAAGVVLIVAVALVF |
| ⦗Top⦘ |