


| Basic Information | |
|---|---|
| Family ID | F069100 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TQMRLSSTGNAFLLQGSLRAFEGANEVCRRDWDRSIPRDFS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.03 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 91.13 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.161 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 44.93% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 27.42 |
| PF00903 | Glyoxalase | 6.45 |
| PF00753 | Lactamase_B | 3.23 |
| PF01862 | PvlArgDC | 2.42 |
| PF14224 | DUF4331 | 2.42 |
| PF07992 | Pyr_redox_2 | 1.61 |
| PF00027 | cNMP_binding | 1.61 |
| PF03475 | 3-alpha | 1.61 |
| PF00561 | Abhydrolase_1 | 1.61 |
| PF02627 | CMD | 1.61 |
| PF02077 | SURF4 | 1.61 |
| PF00106 | adh_short | 0.81 |
| PF06441 | EHN | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF00534 | Glycos_transf_1 | 0.81 |
| PF05222 | AlaDh_PNT_N | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF02633 | Creatininase | 0.81 |
| PF13826 | DUF4188 | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF03315 | SDH_beta | 0.81 |
| PF02148 | zf-UBP | 0.81 |
| PF08530 | PepX_C | 0.81 |
| PF02739 | 5_3_exonuc_N | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 29.03 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 27.42 |
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 2.42 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.61 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.61 |
| COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 1.61 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.81 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.81 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.81 |
| COG1760 | L-serine deaminase | Amino acid transport and metabolism [E] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.81 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.16 % |
| Unclassified | root | N/A | 4.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10044887 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101609430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101632397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300005171|Ga0066677_10848836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300005332|Ga0066388_103371909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300005332|Ga0066388_108800604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300005365|Ga0070688_100957163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300005471|Ga0070698_101610053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005591|Ga0070761_11092178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005610|Ga0070763_10837554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300005713|Ga0066905_101317562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300005713|Ga0066905_101464435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300005842|Ga0068858_101975336 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005843|Ga0068860_101794478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300006028|Ga0070717_11614724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300006059|Ga0075017_100422353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
| 3300006086|Ga0075019_10371922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300006176|Ga0070765_100242153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1651 | Open in IMG/M |
| 3300006176|Ga0070765_101938276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300006176|Ga0070765_102040459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300006194|Ga0075427_10074933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300006791|Ga0066653_10260464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| 3300006939|Ga0081244_1194577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 538 | Open in IMG/M |
| 3300009520|Ga0116214_1371910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300009524|Ga0116225_1338942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300009665|Ga0116135_1185450 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009826|Ga0123355_11200461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
| 3300010046|Ga0126384_11090992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300010048|Ga0126373_11424710 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300010362|Ga0126377_12140745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300010362|Ga0126377_13421465 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010400|Ga0134122_11556186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300010869|Ga0126359_1145280 | Not Available | 1005 | Open in IMG/M |
| 3300012205|Ga0137362_10580975 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012207|Ga0137381_10404978 | Not Available | 1190 | Open in IMG/M |
| 3300012582|Ga0137358_10671062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300012923|Ga0137359_10346555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300014155|Ga0181524_10331600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300014156|Ga0181518_10537780 | Not Available | 550 | Open in IMG/M |
| 3300014325|Ga0163163_11657400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300014495|Ga0182015_10540390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300014745|Ga0157377_11163121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 595 | Open in IMG/M |
| 3300014969|Ga0157376_12358263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300015264|Ga0137403_11330411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300016319|Ga0182033_10526475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300016357|Ga0182032_10317311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1236 | Open in IMG/M |
| 3300016371|Ga0182034_10766428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300016387|Ga0182040_10045122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2702 | Open in IMG/M |
| 3300016387|Ga0182040_10737991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300016404|Ga0182037_10023432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3824 | Open in IMG/M |
| 3300017926|Ga0187807_1226902 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300017961|Ga0187778_10162049 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300017970|Ga0187783_10223407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1380 | Open in IMG/M |
| 3300017975|Ga0187782_10636337 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300018058|Ga0187766_10757763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300018062|Ga0187784_10886507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300018086|Ga0187769_10317655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1165 | Open in IMG/M |
| 3300020006|Ga0193735_1150740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → unclassified Acidisoma → Acidisoma sp. L85 | 603 | Open in IMG/M |
| 3300020034|Ga0193753_10172263 | Not Available | 1014 | Open in IMG/M |
| 3300020580|Ga0210403_11235059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300020581|Ga0210399_10688623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300021082|Ga0210380_10499501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300021168|Ga0210406_10436646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300021171|Ga0210405_10110303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2172 | Open in IMG/M |
| 3300021402|Ga0210385_11215805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300021403|Ga0210397_11044509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300021404|Ga0210389_10602172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 863 | Open in IMG/M |
| 3300021406|Ga0210386_10247979 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300021407|Ga0210383_10854673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300021433|Ga0210391_10091763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2396 | Open in IMG/M |
| 3300021433|Ga0210391_10396124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1084 | Open in IMG/M |
| 3300021433|Ga0210391_11521917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300021477|Ga0210398_11565577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300021478|Ga0210402_10683015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae | 949 | Open in IMG/M |
| 3300021479|Ga0210410_10450822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1151 | Open in IMG/M |
| 3300022557|Ga0212123_10420793 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025914|Ga0207671_10040342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3456 | Open in IMG/M |
| 3300025928|Ga0207700_10037634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3505 | Open in IMG/M |
| 3300026507|Ga0257165_1058002 | Not Available | 700 | Open in IMG/M |
| 3300027047|Ga0208730_1004785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1335 | Open in IMG/M |
| 3300027535|Ga0209734_1046125 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300027567|Ga0209115_1048131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300027619|Ga0209330_1006450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2643 | Open in IMG/M |
| 3300027645|Ga0209117_1063902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| 3300027680|Ga0207826_1065136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300027684|Ga0209626_1075669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300027829|Ga0209773_10187145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae | 865 | Open in IMG/M |
| 3300027867|Ga0209167_10503304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300027908|Ga0209006_10559014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 949 | Open in IMG/M |
| 3300028047|Ga0209526_10340584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1007 | Open in IMG/M |
| 3300028379|Ga0268266_12164823 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028747|Ga0302219_10013679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3033 | Open in IMG/M |
| 3300028800|Ga0265338_10970633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 576 | Open in IMG/M |
| 3300028876|Ga0307286_10116004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
| 3300030520|Ga0311372_12457599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300030763|Ga0265763_1000759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2109 | Open in IMG/M |
| 3300031572|Ga0318515_10040751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2306 | Open in IMG/M |
| 3300031708|Ga0310686_107712657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300031715|Ga0307476_10635079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 792 | Open in IMG/M |
| 3300031716|Ga0310813_10361611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1239 | Open in IMG/M |
| 3300031740|Ga0307468_100316493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
| 3300031744|Ga0306918_11172132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300031748|Ga0318492_10046774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2007 | Open in IMG/M |
| 3300031764|Ga0318535_10439643 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300031771|Ga0318546_10862184 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031771|Ga0318546_10950381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300031792|Ga0318529_10100736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
| 3300031793|Ga0318548_10078054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1561 | Open in IMG/M |
| 3300031797|Ga0318550_10510096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031837|Ga0302315_10291921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300031845|Ga0318511_10458968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300031912|Ga0306921_11192077 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300031962|Ga0307479_11234855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031981|Ga0318531_10259800 | Not Available | 784 | Open in IMG/M |
| 3300031981|Ga0318531_10341401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300032039|Ga0318559_10617883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300032052|Ga0318506_10571679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300032094|Ga0318540_10393886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300032205|Ga0307472_102093890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300032805|Ga0335078_10654303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1313 | Open in IMG/M |
| 3300032805|Ga0335078_12748030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300033134|Ga0335073_10768419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1040 | Open in IMG/M |
| 3300033289|Ga0310914_10355548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300033289|Ga0310914_11398348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 603 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100448871 | 3300000793 | Forest Soil | TQLRLSCNRDVFRLQGSLRAWEGANEVCRRDWDRSIARDFL* |
| JGIcombinedJ26739_1016094301 | 3300002245 | Forest Soil | VRVETRLRLSSTGSAFLLQGSLRAWEGANELCHREWDRTIARDFL* |
| JGIcombinedJ26739_1016323971 | 3300002245 | Forest Soil | IRVETQLRLSATGNTFLLQGSMRAFEGANEMCRRDWDRSIPRDFL* |
| Ga0066677_108488362 | 3300005171 | Soil | QVRIETQMRLSCTREVFLLQASLRAWEGADEVCRRDWDRAIARDFL* |
| Ga0066388_1033719092 | 3300005332 | Tropical Forest Soil | RIETQMRLTSTRDAFLLRASLRAFEGATEVCHREWDRAIPRDFM* |
| Ga0066388_1088006042 | 3300005332 | Tropical Forest Soil | QIRIETQMRLASTRNAFLLQASLIATENANEVCRRDWDRTIPRDFV* |
| Ga0070688_1009571632 | 3300005365 | Switchgrass Rhizosphere | AWQIRVETQMRLSSTADVFLLQGGLRAWEGGKEVYHRTCDRSISRDFM* |
| Ga0070698_1016100532 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QMRLSCTREVFLLQASLRAWEGADEVCRRDWDRAIARDFL* |
| Ga0070761_110921781 | 3300005591 | Soil | RLRLSSTGSAFLLQGSLRAWEGANEVCHREWDRAIPRDFL* |
| Ga0070763_108375541 | 3300005610 | Soil | NEWQVRVETRLRLSSTGSAFLLQGSLRAWEGANELCHREWDRTIARDFL* |
| Ga0066905_1013175622 | 3300005713 | Tropical Forest Soil | KIGIETQMRLSCTRNAFVLWGSLRAWEGANEVCQREWSRSIARDFL* |
| Ga0066905_1014644351 | 3300005713 | Tropical Forest Soil | KIGIETQMRLSCTRNAFVLWGSLRAWEGANEVCQREWSRSVARDFL* |
| Ga0068858_1019753361 | 3300005842 | Switchgrass Rhizosphere | QLRMSSTSNAFLLKVSLCAFDGDNEVCRRNWDRSIPRDFL* |
| Ga0068860_1017944781 | 3300005843 | Switchgrass Rhizosphere | QIRIETEMRLSSTRDSFRLQGRLRAAEGETEVCRRDWDRSIPRDCL* |
| Ga0070717_116147242 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TQMRLSCTREVFLLQASLRAWEGANEVCRRDWDRAIARDFL* |
| Ga0075017_1004223531 | 3300006059 | Watersheds | TQLRLSSTGGAFLLQGSLRAFEGTNEVHRREWDRSIPRDSS* |
| Ga0075019_103719223 | 3300006086 | Watersheds | RMSSTGNAFLLQGRLRAFEGDNEVCRRDWDRSIPRDFL* |
| Ga0070765_1002421531 | 3300006176 | Soil | RLSATANAFLLQGSMRAFEGANEVCRRDWDRSIPRDFL* |
| Ga0070765_1019382762 | 3300006176 | Soil | ETQLRMSSTANAFLLQGSMRAFEGANEVCRRDWDRTITRDFS* |
| Ga0070765_1020404592 | 3300006176 | Soil | NEWQIRIDTQLRLSATSNAFVLQASLRAWEGTNEICHREWDRAIPRDFL* |
| Ga0075427_100749331 | 3300006194 | Populus Rhizosphere | TQMRLSCTRDVFLLQASLRAWEGPNEVCHRDWDRSIPRDFL* |
| Ga0066653_102604641 | 3300006791 | Soil | IETQMRLSCTRTAFLLQGSLRAWEGAIEVCHRDWDRTIPRDFL* |
| Ga0081244_11945771 | 3300006939 | Tropical Rainforest Soil | ATANDFLLQGGLRAWEGTKEVCRREWYRPIPRDFL* |
| Ga0116214_13719101 | 3300009520 | Peatlands Soil | MRLSSTRDTFLLQGSLRAFEGANEVCRRDCDCSIPRDFL |
| Ga0116225_13389422 | 3300009524 | Peatlands Soil | SSTGNAFLLQGSMRAFEGANEVCRRDWDRSIPRDFS* |
| Ga0116135_11854501 | 3300009665 | Peatland | ETQLRMSSTADAFLLQGSLRAFEGANEVCHRDWDRSVPRDFS* |
| Ga0123355_112004611 | 3300009826 | Termite Gut | RLSSTRDTLLLQGSLRAFEGATEVCRRDWDRSVPRDLL* |
| Ga0126384_110909921 | 3300010046 | Tropical Forest Soil | MRLSCTRNAFVLWGSLRAWEGANEVCQREWSRSIARDFL* |
| Ga0126373_114247101 | 3300010048 | Tropical Forest Soil | LSCTRDVFLLQASLRAWEGANEVCRRDWDRSIACDFL* |
| Ga0126377_121407451 | 3300010362 | Tropical Forest Soil | RDAWHVRVETEMRLSSTRDSFQLQGHLRAAEGAMEVCRRDWDLLIPRDCL* |
| Ga0126377_134214651 | 3300010362 | Tropical Forest Soil | TQMRLSCNRDAFLLHGRLRASEGTNEVCHREWDRSIPRDFM* |
| Ga0134122_115561862 | 3300010400 | Terrestrial Soil | ETQMRLSCNRDVFLLQGDLRAWEGADEVCHREWDLAIPRDFV* |
| Ga0126359_11452802 | 3300010869 | Boreal Forest Soil | MRLSCTHDAFLLQASLRAWEGTSEVCHREWDHSIPRDLV* |
| Ga0137362_105809753 | 3300012205 | Vadose Zone Soil | RLSCTRDVFRLQATLRAREGANEVSHREWDLSIPRDFM* |
| Ga0137381_104049783 | 3300012207 | Vadose Zone Soil | SSTANAFLLQGGLRAWEGTNEVCHREWDRSIPRDFM* |
| Ga0137358_106710621 | 3300012582 | Vadose Zone Soil | ETQLRLSSTGNAFLLQGSLRAWEGANEVCRRDWDRSIPRDFS* |
| Ga0137359_103465551 | 3300012923 | Vadose Zone Soil | VRIETQMRLSCTREVFLLQASLRAWEGADEVCRRDWDRAIARDFL* |
| Ga0181524_103316001 | 3300014155 | Bog | TQLRMSSTGNAFLLQGSMRAFEGANEVCRRDWDRSIPRDFS* |
| Ga0181518_105377802 | 3300014156 | Bog | VETQLRLSSTGNAFLLQGSLGAWVGANEVFRRDWDRSIPRDFL* |
| Ga0163163_116574002 | 3300014325 | Switchgrass Rhizosphere | WQIRVETLLRMSSTSNAFLLKGSLCAFDGDNEVCRRNWDRSIPRDFL* |
| Ga0182015_105403902 | 3300014495 | Palsa | NEWQIRVETQLRLSCTASAFVLHGSLRAWEGANEMYGREWDRTIARDFL* |
| Ga0157377_111631211 | 3300014745 | Miscanthus Rhizosphere | IRVETQMRLSCTRNDFLLQGSLRAWDGANEVCHREWDRSVPRDFL* |
| Ga0157376_123582632 | 3300014969 | Miscanthus Rhizosphere | AWQIRIKAQMRLSCTRNAFLLRGSLRAWEGASEVCHRDWDRSIARDFL* |
| Ga0137403_113304111 | 3300015264 | Vadose Zone Soil | ETQMRLSCTREVFLLQASLRAWEGANEVCRRDWDRAIARDFL* |
| Ga0182033_105264751 | 3300016319 | Soil | IQLSSTRTDFRLRGDLRAWEGTDEVCGREWDRSIPRDFV |
| Ga0182032_103173112 | 3300016357 | Soil | RVETQLRLSATGSDFRLQGSLHAWDGANEICRRDWDRSIPRDFS |
| Ga0182034_107664281 | 3300016371 | Soil | MRLSCNRDAFLLHGRLRASEGANEVCHREWDRSIPRDFM |
| Ga0182040_100451222 | 3300016387 | Soil | MSRDEWQIRIETQMRLSSSRDAFLLQGGLGACERANERCSRDWDRSIHRDFL |
| Ga0182040_107379911 | 3300016387 | Soil | TQMRLSSTRNDFLLQGSLRAWEGASEVCHREWGRCIARDFM |
| Ga0182037_100234323 | 3300016404 | Soil | MSRDEWQIRIETQMRLSSSRDAFLLQGGLRACERANELCSRDWDRSIHRDFL |
| Ga0187807_12269022 | 3300017926 | Freshwater Sediment | NEWQIRVETQMRLSSTGNAFLLQGSLRAWEGANEVCRRNRDRSIPRDFM |
| Ga0187778_101620491 | 3300017961 | Tropical Peatland | IRVETQMRLSSTGNAFLLQGSLRAWEGANEVCRRNRDRSIPRDFM |
| Ga0187783_102234075 | 3300017970 | Tropical Peatland | RLSCTRNTFLLQGTLRAWEGGKEMCSREWNRTIARDFL |
| Ga0187782_106363371 | 3300017975 | Tropical Peatland | RIETQLRLSSTANAFLLQGSLRAWEGADEVCRRDWDRSVPRDFL |
| Ga0187766_107577632 | 3300018058 | Tropical Peatland | ETRIRLSCTREAFLLQAHLRAWEGASEVCHREWNRSIPRDFL |
| Ga0187784_108865071 | 3300018062 | Tropical Peatland | TQMRLSSTDKAFLLQASLRAFEGANEVCRRDWDRSIPRDFM |
| Ga0187769_103176552 | 3300018086 | Tropical Peatland | ATRDTFVLQGSFRAFEGANEVCHREWNRTIARDFL |
| Ga0193735_11507401 | 3300020006 | Soil | VETRLRMSSTDNAFLLQGSLRAFEGSNEVCRRDWDRSIPRDFL |
| Ga0193753_101722632 | 3300020034 | Soil | LSCTRDMFLLRASLRAWEGASEVCHREWDRSIPRDLS |
| Ga0210403_112350591 | 3300020580 | Soil | SRLRGREWQIRIETQLRLSSTGNAFLLQGSLRAWEGTNEVCRRDWDRSIPRDFS |
| Ga0210399_106886231 | 3300020581 | Soil | LSCTRDTFLLQASLHAFEGANEVCRRDWDRTIPRDFL |
| Ga0210380_104995012 | 3300021082 | Groundwater Sediment | RLSCNRDVFLLQGDLRAWEGADEVCHREWDLAIPRDFV |
| Ga0210406_104366463 | 3300021168 | Soil | QMRLSCTRDTFLLQASLRAWEGENEVCRRDWDRAIAREFL |
| Ga0210405_101103031 | 3300021171 | Soil | IRVETQMRMSSTGNAFLLQGRLRAFEGDNEVCRRDWDRSIPRDFL |
| Ga0210385_112158051 | 3300021402 | Soil | HMRLSSTGNAFLLQGSLRAFEGDNEVCRRDWDRSIPRDFL |
| Ga0210397_110445091 | 3300021403 | Soil | LSSSRNAFLLQGSMRAFEGANEVCRRDWDRSIPRDFL |
| Ga0210389_106021723 | 3300021404 | Soil | STAKAFLLQGSVRAFEGANEVCRRDWDRSIPRDFS |
| Ga0210386_102479795 | 3300021406 | Soil | SVGNAFLLQATLRAWEGANEVCHRDWDRSIPRDFL |
| Ga0210383_108546732 | 3300021407 | Soil | ETHMRLSSTGNAFLLQGSLRAFEGDNEVCRRDWDRSIPRDFL |
| Ga0210391_100917635 | 3300021433 | Soil | QLRLSATANAFLLQGSLRAFEGANEVCRRDWDRSIPRDFS |
| Ga0210391_103961241 | 3300021433 | Soil | RLSSTADAFLLQGSVRAFEGPNEVCRRDWDRSIPRDFS |
| Ga0210391_115219171 | 3300021433 | Soil | THMRLSATGNAFQLQGSMRAFEGANEVCRRDWDRSIPRDFL |
| Ga0210398_115655771 | 3300021477 | Soil | TQMRLSSTGNAFLLQGSLRAFEGANEVCRRDWDRSIPRDFS |
| Ga0210402_106830153 | 3300021478 | Soil | QMRLSSTGNAFLLKGSLRAWEGANEVCRRDWDRSIPRDFS |
| Ga0210410_104508221 | 3300021479 | Soil | MRLSCTREALVLRASLRAWEGTSEVCHREWDRSIPRDLV |
| Ga0212123_104207931 | 3300022557 | Iron-Sulfur Acid Spring | RVRVETVMRLSCTKDAFLLQATLRAHEGANEVCNREWHHSIARDLM |
| Ga0207671_100403426 | 3300025914 | Corn Rhizosphere | TQMRLSSTRDAFLLQASLRAFEGPNEVCRRDWDRTIPRDFL |
| Ga0207700_100376341 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IETQMRLSCTRDVFLLQASLRAWEGGTEVCHRDWDRAIAREFL |
| Ga0257165_10580022 | 3300026507 | Soil | MRLSCTREVFLLQASLRAWEGANEVCRRDWDRAIARDFL |
| Ga0208730_10047851 | 3300027047 | Forest Soil | RMSSTGNAFLLQGSLRAWEGANEVCHRDWDRSIPRDFS |
| Ga0209734_10461251 | 3300027535 | Forest Soil | SSTRNAFLLQGSMRAFEGANEVCRRDWDRSIPRDFL |
| Ga0209115_10481312 | 3300027567 | Forest Soil | QMRLSSTGDNFLLQGSLRAFEGENEVCRRDWDRSIPRDFS |
| Ga0209330_10064501 | 3300027619 | Forest Soil | LSATANAFLLQGSLRAFEGANEVCRRDWDRSIPRDFS |
| Ga0209117_10639021 | 3300027645 | Forest Soil | QIRVETQMRLTSTRDTFLLQGSLRAWEAANEVCRRDWDRSIPRDFL |
| Ga0207826_10651361 | 3300027680 | Tropical Forest Soil | SSMGNAFLLQGSLRAWEGTNEVCRRDWDRSIPRDFL |
| Ga0209626_10756691 | 3300027684 | Forest Soil | RLSASRNAFLLQGSMRAFEGANEMCRRDWDRSIPRDFL |
| Ga0209773_101871451 | 3300027829 | Bog Forest Soil | MRLTSTGSAFLLQGSFRAFEGTNEVCRRDWDRSIPRDFL |
| Ga0209167_105033041 | 3300027867 | Surface Soil | WQIRVETQLRMSSTRDAFLLQGSLRAWDGANEVCRRDWERSVPRDFM |
| Ga0209006_105590141 | 3300027908 | Forest Soil | WQIRVETQLRLSATGNTFLLQGSMRAFEGANEMCRRDWDRSIPRDFL |
| Ga0209526_103405841 | 3300028047 | Forest Soil | QIRVETQLKLTATANAFLLQGSMRAFEGTNEVCRRDWDRSIPRDFL |
| Ga0268266_121648232 | 3300028379 | Switchgrass Rhizosphere | RLTCTSEAFRLQAALRASEGATEVCHRDWDCTIARDLT |
| Ga0302219_100136791 | 3300028747 | Palsa | SCTRNAFLLQGSLRAWEGANEMCHREWDRTIARDFL |
| Ga0265338_109706331 | 3300028800 | Rhizosphere | SCTKDAFLLQTSLRAWEGPDVVCHREWNCSIPRDLM |
| Ga0307286_101160041 | 3300028876 | Soil | STRDIFLLQGSLRAFEGANEVCRRDWDQSIPRDFL |
| Ga0311372_124575991 | 3300030520 | Palsa | VGVETQLRMSCTGNAFLLQGSLRAWEGANELCSREWNRTIARDFL |
| Ga0265763_10007591 | 3300030763 | Soil | LRMSCTADAFLLQGSLRAFEGANEVCRRDWDRSVPRDFL |
| Ga0318515_100407514 | 3300031572 | Soil | CTRDVFLLLASLRAWEGDDEVCRRDWDRSIARDFL |
| Ga0310686_1077126571 | 3300031708 | Soil | IRVETQMRRSATSNSFLLQGSLRAFEGENEVCRRDWDRTIPRDFA |
| Ga0307476_106350791 | 3300031715 | Hardwood Forest Soil | MSSTGNAFLLQGSLRAWEGANEVCHRDWDRSIPRDFS |
| Ga0310813_103616112 | 3300031716 | Soil | IETSTRLSCTREAFLLQASLRALEGPDEVCRRSWDCTIPRDCA |
| Ga0307468_1003164931 | 3300031740 | Hardwood Forest Soil | RLSCTRDVFLLQASLRAWEGGTEVCHRDWDRAIAREFL |
| Ga0306918_111721321 | 3300031744 | Soil | IRVETQLRLSCTHDAFLLQGSLRAWDGANEVCRRDWDRSIPRDFL |
| Ga0318492_100467743 | 3300031748 | Soil | WHIRIETWMRLSCNRDVFLLQASLRAWDGANEVCRRDWDRAIARNFL |
| Ga0318535_104396431 | 3300031764 | Soil | HIRIETWMRLSCNRDVFLLQASLRAWDGANEVCRRDWDRAIARNFL |
| Ga0318546_108621842 | 3300031771 | Soil | LSCNRDVFRLQASLRAWEGANEVCRRDWDRAIARDFL |
| Ga0318546_109503811 | 3300031771 | Soil | MSRDEWQIRIETQMRLSSSRDAFLLQGGLRACERANERCSRDWDRSVHRDFL |
| Ga0318529_101007363 | 3300031792 | Soil | IRIETWMRLSCNRDVFLLQASLRAWDGANEVCRRDWDRAIARNFL |
| Ga0318548_100780542 | 3300031793 | Soil | MSRDAWQVRIETQLRLSCNRDVFLLQASLRAWDEATEVCRRDWDLAIPRDFL |
| Ga0318550_105100961 | 3300031797 | Soil | QIGVETQMRLSSTSNAFLLQGSLRAWEGANEVCHRDWDRSIPRDFL |
| Ga0302315_102919213 | 3300031837 | Palsa | TQLRMSCTGNAFLLQGSLRAWEGANELCRREWNRTIARDFL |
| Ga0318511_104589682 | 3300031845 | Soil | LRLTCNRDVFRLQASLRAWEGANEVCRRDWDRAIARDFL |
| Ga0306921_111920771 | 3300031912 | Soil | CNRDVFRLQASLRAWEGANEVCRRDWDRAIARDFL |
| Ga0307479_112348551 | 3300031962 | Hardwood Forest Soil | RLSSTANAFLLQGGLRAWEGANEVCHREWDRSIPRDFM |
| Ga0318531_102598001 | 3300031981 | Soil | IRIETHLRLSCTGKAFLLQGSLRACEGVKEVCCREWDRTIARDFL |
| Ga0318531_103414013 | 3300031981 | Soil | NWQIRIETQMRLSSTRNDFLLQGSLRAWEGASEVCHREWGRCIARDFM |
| Ga0318559_106178831 | 3300032039 | Soil | MSRDEWQIRIETQMRLSSSRDAFLPQGGLRACERANELCSRDWDRSIHRDF |
| Ga0318506_105716792 | 3300032052 | Soil | QLRLSCNRDVFRLQASLRAWEGANEVCRRDWDRAIARDFL |
| Ga0318540_103938861 | 3300032094 | Soil | QMRLSSTRNDFLLQGSLRAWEGASEVCHREWGRCIARDFM |
| Ga0307472_1020938901 | 3300032205 | Hardwood Forest Soil | MRLSCTREVFLLQASLRAWEGADEVCRRDWDRAIARDFL |
| Ga0335078_106543031 | 3300032805 | Soil | MSSTRDAFLLHGSLRAWEGANEVIHRDWDRSIPRDFS |
| Ga0335078_127480301 | 3300032805 | Soil | LSSTANAFLLQGSLRAFEGTNEVCRRDWDRSVARDFL |
| Ga0335073_107684193 | 3300033134 | Soil | DAFLLQGSVRALEGANEVCRRDWDRSIPRDFSISI |
| Ga0310914_103555483 | 3300033289 | Soil | MRLSCNRDVFLLQASLRAWDGANEVCRRDWDRAIARNFL |
| Ga0310914_113983481 | 3300033289 | Soil | IRVETQLRMSSTGSAFLLHGSLRAFEGDNEVCRRDWDRSIPRDFL |
| ⦗Top⦘ |