


| Basic Information | |
|---|---|
| Family ID | F069080 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AEVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKQVASAAA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.03 % |
| % of genes near scaffold ends (potentially truncated) | 89.52 % |
| % of genes from short scaffolds (< 2000 bps) | 92.74 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.161 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.581 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.516 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 13.89% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02391 | MoaE | 31.45 |
| PF03454 | MoeA_C | 4.84 |
| PF02597 | ThiS | 4.84 |
| PF01063 | Aminotran_4 | 4.03 |
| PF04209 | HgmA_C | 3.23 |
| PF08241 | Methyltransf_11 | 3.23 |
| PF07889 | DUF1664 | 1.61 |
| PF04909 | Amidohydro_2 | 1.61 |
| PF00072 | Response_reg | 0.81 |
| PF10805 | DUF2730 | 0.81 |
| PF13011 | LZ_Tnp_IS481 | 0.81 |
| PF13545 | HTH_Crp_2 | 0.81 |
| PF06296 | RelE | 0.81 |
| PF04773 | FecR | 0.81 |
| PF08459 | UvrC_RNaseH_dom | 0.81 |
| PF13550 | Phage-tail_3 | 0.81 |
| PF00809 | Pterin_bind | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF01066 | CDP-OH_P_transf | 0.81 |
| PF13683 | rve_3 | 0.81 |
| PF13711 | DUF4160 | 0.81 |
| PF01934 | HepT-like | 0.81 |
| PF13374 | TPR_10 | 0.81 |
| PF01266 | DAO | 0.81 |
| PF13419 | HAD_2 | 0.81 |
| PF08897 | DUF1841 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 31.45 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 8.06 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 4.84 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 4.84 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 4.84 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.23 |
| COG0322 | Excinuclease UvrABC, nuclease subunit | Replication, recombination and repair [L] | 0.81 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.81 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.81 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.81 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.81 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10221816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
| 3300004080|Ga0062385_10619422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 687 | Open in IMG/M |
| 3300004080|Ga0062385_10898254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300004082|Ga0062384_100623943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300004082|Ga0062384_100769346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 670 | Open in IMG/M |
| 3300004091|Ga0062387_101251491 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005167|Ga0066672_10854037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300005363|Ga0008090_14071048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300005438|Ga0070701_11215902 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005468|Ga0070707_102204020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005540|Ga0066697_10279216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 986 | Open in IMG/M |
| 3300005554|Ga0066661_10213602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1195 | Open in IMG/M |
| 3300005555|Ga0066692_10970093 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005557|Ga0066704_10275993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1140 | Open in IMG/M |
| 3300005558|Ga0066698_10321618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1071 | Open in IMG/M |
| 3300005559|Ga0066700_10818688 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005574|Ga0066694_10560892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300005587|Ga0066654_10932852 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005598|Ga0066706_11171068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300005610|Ga0070763_10217386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1025 | Open in IMG/M |
| 3300005713|Ga0066905_101056360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 719 | Open in IMG/M |
| 3300006176|Ga0070765_101223247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 709 | Open in IMG/M |
| 3300006796|Ga0066665_10163452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1699 | Open in IMG/M |
| 3300006800|Ga0066660_11374193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300007258|Ga0099793_10671796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300009012|Ga0066710_100075803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4348 | Open in IMG/M |
| 3300009101|Ga0105247_10153574 | Not Available | 1519 | Open in IMG/M |
| 3300010039|Ga0126309_10663325 | Not Available | 665 | Open in IMG/M |
| 3300010043|Ga0126380_11150326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 665 | Open in IMG/M |
| 3300010043|Ga0126380_11939940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300010046|Ga0126384_12180421 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010048|Ga0126373_10297994 | Not Available | 1607 | Open in IMG/M |
| 3300010048|Ga0126373_11857603 | Not Available | 666 | Open in IMG/M |
| 3300010048|Ga0126373_12822675 | Not Available | 542 | Open in IMG/M |
| 3300010335|Ga0134063_10620674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300010366|Ga0126379_11565078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300010376|Ga0126381_101594831 | Not Available | 943 | Open in IMG/M |
| 3300010376|Ga0126381_104062369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 569 | Open in IMG/M |
| 3300010379|Ga0136449_100017306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 18807 | Open in IMG/M |
| 3300010379|Ga0136449_103894802 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Lachnaceae → Lachnellula | 560 | Open in IMG/M |
| 3300010400|Ga0134122_12515417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300010400|Ga0134122_13143022 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010401|Ga0134121_12644011 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300011269|Ga0137392_11554074 | Not Available | 520 | Open in IMG/M |
| 3300011270|Ga0137391_10352093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1265 | Open in IMG/M |
| 3300011270|Ga0137391_10624194 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300011999|Ga0120148_1005997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3307 | Open in IMG/M |
| 3300012205|Ga0137362_10740003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300012208|Ga0137376_11229069 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012212|Ga0150985_109943354 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012212|Ga0150985_110410880 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012285|Ga0137370_10608834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300012363|Ga0137390_10627464 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300012363|Ga0137390_11714735 | Not Available | 562 | Open in IMG/M |
| 3300012469|Ga0150984_120449753 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012923|Ga0137359_10429972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1169 | Open in IMG/M |
| 3300012930|Ga0137407_11727567 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012971|Ga0126369_10683973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1102 | Open in IMG/M |
| 3300012975|Ga0134110_10038848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1870 | Open in IMG/M |
| 3300012989|Ga0164305_10925921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 734 | Open in IMG/M |
| 3300012989|Ga0164305_12220868 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300013503|Ga0120127_10023870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1105 | Open in IMG/M |
| 3300013764|Ga0120111_1028108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1522 | Open in IMG/M |
| 3300014501|Ga0182024_10096309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4331 | Open in IMG/M |
| 3300014968|Ga0157379_11815968 | Not Available | 599 | Open in IMG/M |
| 3300015242|Ga0137412_10503416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 927 | Open in IMG/M |
| 3300015371|Ga0132258_12310552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1348 | Open in IMG/M |
| 3300016270|Ga0182036_10280858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1258 | Open in IMG/M |
| 3300016270|Ga0182036_10847041 | Not Available | 747 | Open in IMG/M |
| 3300016371|Ga0182034_11346487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300016387|Ga0182040_10187928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1508 | Open in IMG/M |
| 3300016404|Ga0182037_10198432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1555 | Open in IMG/M |
| 3300017973|Ga0187780_10772159 | Not Available | 695 | Open in IMG/M |
| 3300017995|Ga0187816_10518403 | Not Available | 538 | Open in IMG/M |
| 3300018058|Ga0187766_11004812 | Not Available | 594 | Open in IMG/M |
| 3300021178|Ga0210408_11127437 | Not Available | 602 | Open in IMG/M |
| 3300021407|Ga0210383_11145613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300021432|Ga0210384_10580799 | Not Available | 1008 | Open in IMG/M |
| 3300021559|Ga0210409_11385319 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021560|Ga0126371_10674409 | Not Available | 1182 | Open in IMG/M |
| 3300021560|Ga0126371_13808861 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300022498|Ga0242644_1035821 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300022532|Ga0242655_10056075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas arctica | 985 | Open in IMG/M |
| 3300022713|Ga0242677_1054918 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300022726|Ga0242654_10225803 | Not Available | 661 | Open in IMG/M |
| 3300022726|Ga0242654_10310233 | Not Available | 583 | Open in IMG/M |
| 3300025915|Ga0207693_11089717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300025929|Ga0207664_11860046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300025939|Ga0207665_10467726 | Not Available | 970 | Open in IMG/M |
| 3300026550|Ga0209474_10138309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1597 | Open in IMG/M |
| 3300027546|Ga0208984_1086419 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027603|Ga0209331_1037630 | Not Available | 1237 | Open in IMG/M |
| 3300027662|Ga0208565_1044535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1446 | Open in IMG/M |
| 3300027824|Ga0209040_10132108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1370 | Open in IMG/M |
| 3300030399|Ga0311353_10187075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1954 | Open in IMG/M |
| 3300030730|Ga0307482_1291319 | Not Available | 523 | Open in IMG/M |
| 3300031231|Ga0170824_107358288 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031545|Ga0318541_10025381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 2885 | Open in IMG/M |
| 3300031546|Ga0318538_10008781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4088 | Open in IMG/M |
| 3300031546|Ga0318538_10087619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1590 | Open in IMG/M |
| 3300031640|Ga0318555_10005863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5068 | Open in IMG/M |
| 3300031640|Ga0318555_10146179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1264 | Open in IMG/M |
| 3300031708|Ga0310686_110135223 | Not Available | 1039 | Open in IMG/M |
| 3300031719|Ga0306917_10545572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300031719|Ga0306917_10916644 | Not Available | 685 | Open in IMG/M |
| 3300031771|Ga0318546_11042044 | Not Available | 575 | Open in IMG/M |
| 3300031792|Ga0318529_10267031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 797 | Open in IMG/M |
| 3300031797|Ga0318550_10465930 | Not Available | 610 | Open in IMG/M |
| 3300031798|Ga0318523_10389630 | Not Available | 693 | Open in IMG/M |
| 3300031835|Ga0318517_10009541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3429 | Open in IMG/M |
| 3300031879|Ga0306919_11039635 | Not Available | 626 | Open in IMG/M |
| 3300031896|Ga0318551_10069328 | Not Available | 1823 | Open in IMG/M |
| 3300031941|Ga0310912_10126112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1911 | Open in IMG/M |
| 3300031945|Ga0310913_10013873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4896 | Open in IMG/M |
| 3300031946|Ga0310910_10929900 | Not Available | 681 | Open in IMG/M |
| 3300031954|Ga0306926_11079963 | Not Available | 950 | Open in IMG/M |
| 3300031954|Ga0306926_12681960 | Not Available | 541 | Open in IMG/M |
| 3300031954|Ga0306926_12829630 | Not Available | 523 | Open in IMG/M |
| 3300031959|Ga0318530_10215338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 789 | Open in IMG/M |
| 3300032039|Ga0318559_10167601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1002 | Open in IMG/M |
| 3300032076|Ga0306924_12026974 | Not Available | 592 | Open in IMG/M |
| 3300032515|Ga0348332_13738783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 652 | Open in IMG/M |
| 3300032954|Ga0335083_10863744 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300033004|Ga0335084_11633365 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_102218161 | 3300004080 | Bog Forest Soil | TGSAAEVTPVGEIAGEGGHHRFTPGAICRLMWEDFDRTVGKQVATAA* |
| Ga0062385_106194221 | 3300004080 | Bog Forest Soil | VGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKQVASAAA* |
| Ga0062385_108982543 | 3300004080 | Bog Forest Soil | AEVTPVGEIIGEHGHYRFTPSTICRLMWEDYDRKVGKQVASAA* |
| Ga0062384_1006239431 | 3300004082 | Bog Forest Soil | AEVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKQVASAAA* |
| Ga0062384_1007693463 | 3300004082 | Bog Forest Soil | TPVGEIIGEHGHYRFTPSTICRLMWEDYDRKVGKQVASAA* |
| Ga0062387_1012514911 | 3300004091 | Bog Forest Soil | VGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKTVAASAA* |
| Ga0066672_108540371 | 3300005167 | Soil | VTPVGEIIGEIGHYRFTPGTICRLMWEDYDRAVGKNVAATAA* |
| Ga0008090_140710481 | 3300005363 | Tropical Rainforest Soil | MQARARGVGGQVTPVGEIIGAVGHYRFTPGTIRRLMREDYDRLVGKKVE |
| Ga0070701_112159021 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | EVTPVGEIIGDVGHYRFTPSTICRLMWEDYDRAVGKQDATSAAAE* |
| Ga0070707_1022040202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEVTPVGEIIGEIGHYRFTPGTICRLMWEDYDRAVGKNVAATAA* |
| Ga0066697_102792161 | 3300005540 | Soil | AEVTPVGEIIGAVGHYRFTPGTICRLMWEDYDRLVGKRVAATAA* |
| Ga0066661_102136024 | 3300005554 | Soil | RPAHAGSAAEVTPVGEIVGSVGHYRFTPGTICRLMWEDYDRLVGKRVAATAA* |
| Ga0066692_109700931 | 3300005555 | Soil | TPVGEVAGEVGHYRFTPGAICRLMWEDFDCTVGKQVATAA* |
| Ga0066704_102759931 | 3300005557 | Soil | PVGEIIGEHGHYHFTPGTICRLVWEDYDRKVGKRVASAA* |
| Ga0066698_103216181 | 3300005558 | Soil | LTGSAAEVTPVGEIIGEHGHYHFTPGTICRLVWEDYDRKVGKRVASAA* |
| Ga0066700_108186883 | 3300005559 | Soil | AEVTPVGEIIGEIGHYRFTPGTICRLMWEDYDRAVGKNVAASAA* |
| Ga0066694_105608921 | 3300005574 | Soil | SAAEVTPVGEIIGEHGHYRFTPGTICRLMWEDFDRTVGKQVATAAA* |
| Ga0066654_109328522 | 3300005587 | Soil | AEITPVGEVEGAIGHYRFTPGAICQLMIEDYDVATGKNVKAAAAE* |
| Ga0066706_111710681 | 3300005598 | Soil | LTGSAAEVTPVGEVAGEVGNYRFTPGAICRLMWEDFDRTVGKQVATAA* |
| Ga0070763_102173861 | 3300005610 | Soil | TGSAAEVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRMVGKRVANAA* |
| Ga0066905_1010563602 | 3300005713 | Tropical Forest Soil | MQARARGVGGQVTPVGEIIGAVGHCRFTPGTICRLMREDYDRLVGKKVAVTAA* |
| Ga0070765_1012232472 | 3300006176 | Soil | EGAIGHYRFTPGAICHLMIEDYDQATGKNVKAAAAA* |
| Ga0066665_101634522 | 3300006796 | Soil | LEAGEVGNYRFTPGAICRLTWEDFDCTVGKQVVTAA* |
| Ga0066660_113741932 | 3300006800 | Soil | FLTGSAAEVTPVGEIIGAVGHYRFTPGTICRLMWEDDDRLVGKKVAATAA* |
| Ga0099793_106717962 | 3300007258 | Vadose Zone Soil | EVTPVGEIIGEISHYRFTPGTICRLMWEDYDRAVGKNVAATAA* |
| Ga0066710_1000758037 | 3300009012 | Grasslands Soil | LEAGEVGNYRFTPGAICRLTWEDFDCTVGKQVVTAA |
| Ga0105247_101535742 | 3300009101 | Switchgrass Rhizosphere | EIIGDRGHYRFTPGTICRLMWEDYDRAVGKQEATSAAAE* |
| Ga0126309_106633252 | 3300010039 | Serpentine Soil | EIIGKIGHYRFTPGAICRLMWEDYDRAVGKQVAATAA* |
| Ga0126380_111503262 | 3300010043 | Tropical Forest Soil | AAEVTPVGEVIGEHGHYRFTPGTICRLMWEDYDRAVGKQVATAA* |
| Ga0126380_119399402 | 3300010043 | Tropical Forest Soil | GEIIGAVGHCRFTPGTICRLMREDYDRLVGKKVAVTAA* |
| Ga0126384_121804212 | 3300010046 | Tropical Forest Soil | GEIVGEHGNFKFTPATICRLMWEDYDRTVGKQVANAA* |
| Ga0126373_102979941 | 3300010048 | Tropical Forest Soil | IGEHGHYRFTPGTICRLMWEDYDRTVGKQVANAA* |
| Ga0126373_118576031 | 3300010048 | Tropical Forest Soil | TPVGEIDGAIGHYRFTPGAICKLMIEDYDRITGKTVDKAAAE* |
| Ga0126373_128226752 | 3300010048 | Tropical Forest Soil | GEVVGKAGNFRFTPGAICRLMWEDFDRAVGKQVATAA* |
| Ga0134063_106206741 | 3300010335 | Grasslands Soil | GSAAEVTPVGEIVGSVGHYRLTPGTICRLMWEDYDRLVGKKVAATAA* |
| Ga0126379_115650782 | 3300010366 | Tropical Forest Soil | MQARARGVGGQVTPVGEIIGAVGHYRFTPGTICRLMREDYDRLVGKKVAVTAA* |
| Ga0126381_1015948314 | 3300010376 | Tropical Forest Soil | GEIIGEHGHYHFTPGTICRLMWEDYDREVGKRVASAA* |
| Ga0126381_1040623693 | 3300010376 | Tropical Forest Soil | SAAEVTPVGEVIGEHGHYRFTPGTICRLMWEDYDRTVGKQVANAA* |
| Ga0136449_10001730621 | 3300010379 | Peatlands Soil | AAEITPVGEIHGAIGKYRFTPGAICRLMWEDYDRATGKAATAAAAE* |
| Ga0136449_1038948021 | 3300010379 | Peatlands Soil | VTPVGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKKVASAA* |
| Ga0134122_125154172 | 3300010400 | Terrestrial Soil | FLTGSAAEVTPVGEIIGEHGHYHFTPGMICRLMWEDYDRMVGKRVASAA* |
| Ga0134122_131430221 | 3300010400 | Terrestrial Soil | IVGQYGNYRFTPGRICRLMWEDYDRAVGKQLIAA* |
| Ga0134121_126440111 | 3300010401 | Terrestrial Soil | EVTPVGEIVGQYGNYRFTPGRICRLMWEDYDRAVGKQLIAA* |
| Ga0137392_115540741 | 3300011269 | Vadose Zone Soil | AEVTPVGEIIGEVGHYRFTPGALCRLMWEDFDRLVGKQVAATAA* |
| Ga0137391_103520933 | 3300011270 | Vadose Zone Soil | TGSAAEVTPVGEIIGEVGHFRFTPGALCRLMWEDFDRLVGKQVAASAA* |
| Ga0137391_106241943 | 3300011270 | Vadose Zone Soil | TGSAAEVTPVGEIIGEVGHFRFTPGALCRLMWEDFDRLVGKQVAATAA* |
| Ga0120148_10059972 | 3300011999 | Permafrost | VTGGEIIGAVGHYRFTPGTICRLMWEDYDRTVGKQVAAAAE* |
| Ga0137362_107400033 | 3300012205 | Vadose Zone Soil | TAEITPVGEIEGAIAHYRFTPGAICRLMNEDYDQATGKNVKAAAAA* |
| Ga0137376_112290693 | 3300012208 | Vadose Zone Soil | GEIVGSVGHYRFTPGTICRLMWEDYDRLVGKRVAATAA* |
| Ga0150985_1099433542 | 3300012212 | Avena Fatua Rhizosphere | VEGAIGHYRFTPGAICQLMIEDYDVATGKNVKAAAAE* |
| Ga0150985_1104108802 | 3300012212 | Avena Fatua Rhizosphere | SAAEVTPVGEIVGQYGTYRFTPGRICRLMWEDYDRAVGKQLAAA* |
| Ga0137370_106088342 | 3300012285 | Vadose Zone Soil | IIGTGGHYRFTPGTICRLMWEDYDRLVGKKVAATAA* |
| Ga0137390_106274641 | 3300012363 | Vadose Zone Soil | AAEVTPVGEIIGEVGHFRFTPGALCRLMWEDFDRLVGKQVAATAA* |
| Ga0137390_117147351 | 3300012363 | Vadose Zone Soil | GEVIGQIGHYRFAPGTICRLMWEDYDRAVGKQVASAA* |
| Ga0150984_1204497531 | 3300012469 | Avena Fatua Rhizosphere | TPVGEIVGQYGTYRFTPGRICRLMWEDYDRAVGKQLAAA* |
| Ga0137359_104299721 | 3300012923 | Vadose Zone Soil | TGSAAEVTPVGEIIGEIGHYRFTPGTICRLMWEDYDRTVGKQIASAA* |
| Ga0137407_117275672 | 3300012930 | Vadose Zone Soil | VAGEVGNYRFTPGAICRLMWEDFDRTVGKQVATAA* |
| Ga0126369_106839733 | 3300012971 | Tropical Forest Soil | MQARARGVGGQVTPVGEIIGAVGHYRFTPGTICRLMREDYDRLVGKKVAATAA* |
| Ga0134110_100388483 | 3300012975 | Grasslands Soil | VTPVGEIVGSVGHYRFTPGTICRLMWEDYDRLVGKRVAATAA* |
| Ga0164305_109259212 | 3300012989 | Soil | VTPVGEIVESAGHYRFTPGTICRLMWEDYDRLVGKRVAATAA* |
| Ga0164305_122208681 | 3300012989 | Soil | AEVTPVGEIIGEHGHYRFMPGTICRLMWEDYDRTVGKQVASAA* |
| Ga0120127_100238701 | 3300013503 | Permafrost | VTVGEIIGAVGHYRFTPGTICRLMWEDYDRTVGKQLAAAAE* |
| Ga0120111_10281081 | 3300013764 | Permafrost | VTVGEIIGAVGHYRFTPGTICRLMWEDYDRTVGKQVAAAAE* |
| Ga0182024_100963093 | 3300014501 | Permafrost | MTPVGEIIGEVGHFCFTSVALCRLMWEDFDRLVWSPTPG* |
| Ga0157379_118159681 | 3300014968 | Switchgrass Rhizosphere | TPVGEIIGEIGHYRFTPGTICRLMWEDYDRAVGKQEATSAAAE* |
| Ga0137412_105034163 | 3300015242 | Vadose Zone Soil | GEIIGTGGHYRFTPGTICRLMWEDYDRLVGKKVAATAA* |
| Ga0132258_123105521 | 3300015371 | Arabidopsis Rhizosphere | EIIAKHGHYRFTPSTICRLMWEDYDRAVGKRVASAA* |
| Ga0182036_102808584 | 3300016270 | Soil | TPVGEIAGEVGNYRFTPGVICRLMSEDFDHIVGKKVATAA |
| Ga0182036_108470412 | 3300016270 | Soil | TPVGEIVGKAGNFRFTPSAICRLMWEDFDRAVGKRVATAA |
| Ga0182034_113464872 | 3300016371 | Soil | AAEVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKKVATASAA |
| Ga0182040_101879284 | 3300016387 | Soil | EVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKKVATASAA |
| Ga0182037_101984321 | 3300016404 | Soil | EVTPVGEIVGKVGNYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0187780_107721592 | 3300017973 | Tropical Peatland | AEITPVGEIDGAIGRYRFTPGAICQLMIDDYDIATGKHAKAAAAE |
| Ga0187816_105184032 | 3300017995 | Freshwater Sediment | EITPVGEIVGAIGHYRFTPSTVCRLMWEDYDRATGKKVDKAAAE |
| Ga0187766_110048121 | 3300018058 | Tropical Peatland | EITPVGEIAGAIVHYRFTPGAICRLMIEDYDRATGKTATAAAAE |
| Ga0210408_111274371 | 3300021178 | Soil | AEVTPVGEVIGEIGHYRFAPGTICRLMWEDYDRAVGKQVASAA |
| Ga0210383_111456131 | 3300021407 | Soil | VTPVGEVIGEHGHYRFTPGTICRLMWEDYDRRVGKRVASAA |
| Ga0210384_105807991 | 3300021432 | Soil | GSVAEVTPVGEIIGNIGHYRFTPGTICRLMWEDYDRLVGKKVAATAA |
| Ga0210409_113853192 | 3300021559 | Soil | IIGEHGHYRFTPGTICRLMWEDYDRNVGKQVASAA |
| Ga0126371_106744094 | 3300021560 | Tropical Forest Soil | VGEVIGEHGHYRFTPGTICRLMWEDYDRTVGKQVANAA |
| Ga0126371_138088611 | 3300021560 | Tropical Forest Soil | EVTPVGEIIGEHGHYRFTPGTICRLMWEDYDREVGKRVANAA |
| Ga0242644_10358213 | 3300022498 | Soil | SAAEVTPVGEIIGERGHYRFTPGTICRLMWEDYDRAVGKKVAATAA |
| Ga0242655_100560751 | 3300022532 | Soil | EIIGERGHYRFTPGTICRLMWEDYDRAVGKKVAATAA |
| Ga0242677_10549181 | 3300022713 | Soil | GEIIGERGHYRFTPGTICRLMWEDYDRAVGKKVAATAA |
| Ga0242654_102258032 | 3300022726 | Soil | SAAEVTPVGEIVGEIGHYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0242654_103102331 | 3300022726 | Soil | PVGEIIGEHGHYRFTPGTFCRLMWEDYDRMVGKRVASAA |
| Ga0207693_110897171 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAEVTPVGEIIGEGGHYRFTPGTICRLMWEDYDRAVGKKVAATAA |
| Ga0207664_118600462 | 3300025929 | Agricultural Soil | AEVTPVGEIIGTVGHYRFTPGALCRLMWEDFDRLVGKQPASSAAA |
| Ga0207665_104677261 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVTPVGEIVGEGGDYRFTPGTICRLLWEDYDRLVGKRVAATAA |
| Ga0209474_101383092 | 3300026550 | Soil | VTPVGEIIGSIGHYRFTPGTICRLMWEDYYRLVGKRVEATAA |
| Ga0208984_10864193 | 3300027546 | Forest Soil | AEVTPVGEINGEGGHYRFTPGTICRLMWEDYDRLVGKKVAATAAA |
| Ga0209331_10376304 | 3300027603 | Forest Soil | SAAEVTPVGEVAGEVGNYRFTPGAICRLMWEDFDRTVGKQVATAA |
| Ga0208565_10445354 | 3300027662 | Peatlands Soil | TPVGEIHGAIGKYRFTPGAICRLMWEDYDRATGKAATAAAAE |
| Ga0209040_101321083 | 3300027824 | Bog Forest Soil | SAAEVTPVGEIIGERGHYRFTPGTICRLMWEDYDHTVGKNVTAATAA |
| Ga0311353_101870754 | 3300030399 | Palsa | TPVGEVSGHAGNFRFTPGAICRLMWEDFDRTVGKKVAAAAAAE |
| Ga0307482_12913191 | 3300030730 | Hardwood Forest Soil | EIAGEVGDYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0170824_1073582883 | 3300031231 | Forest Soil | VGEIAGEVGHYRFTPGTICRLMWEDFDRTVGKQVATAA |
| Ga0318541_100253816 | 3300031545 | Soil | TPVGEIVGKVGNYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0318538_100087817 | 3300031546 | Soil | TGSAAEVTPVGEIAGEVGHYRFTPGTICRLMSDDFDRAVGKQVATAA |
| Ga0318538_100876191 | 3300031546 | Soil | VGEIAGEVGHHRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0318555_100058631 | 3300031640 | Soil | EVTPVGEIAGEVGHYRFTPGTICRLMSDDFDRAVGKQVATAA |
| Ga0318555_101461791 | 3300031640 | Soil | AEVTPVGEIAGEVGHYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0310686_1101352231 | 3300031708 | Soil | EVTPVGEIDGAIGRYRFTPGAICRLMWEDYDRATGKKVDQAAASQAAE |
| Ga0306917_105455722 | 3300031719 | Soil | SAAEVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRTVGKKVATASAA |
| Ga0306917_109166441 | 3300031719 | Soil | VTPVGQIIGEIGHYRFTPGTICRLMWEDYDRAVGKQVASAA |
| Ga0318546_110420441 | 3300031771 | Soil | TGSAAEVTPVGEIVGEVGHYRFTPGAFCRLMSDDFDRAVGKQVATAA |
| Ga0318529_102670313 | 3300031792 | Soil | GSAAEVTPVGEIVGEVGHYRFTPGAFCRLMSDDFDRAVGKQVATAA |
| Ga0318550_104659301 | 3300031797 | Soil | AAEVTPVGEIVGKVGNYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0318523_103896301 | 3300031798 | Soil | VTPVGEIIGKVGNYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0318517_100095417 | 3300031835 | Soil | TPVGEIAGEVGHYRFTPGTICRLMSDDFDRAVGKQVATAA |
| Ga0306919_110396352 | 3300031879 | Soil | SAAEVTPVGEIAGKIGNYRFTPGAICRLMWEDFDHAVGKKVAIATEAPP |
| Ga0318551_100693281 | 3300031896 | Soil | SAAEVTPVGEIAGEVGHYRFTPGAICRLMWEDFDRVVGKQVATAA |
| Ga0310912_101261124 | 3300031941 | Soil | TPVGEIAGEVGHHRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0310913_100138737 | 3300031945 | Soil | GSAAEVTPVGEIAGEVGHYRFTPGTICRLMSDDFDRAVGKQVATAA |
| Ga0310910_109299002 | 3300031946 | Soil | AAEVTPVGEIIGKVGNYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0306926_110799634 | 3300031954 | Soil | SAAEVTPVGEIVGKVGNFRFTPGAICRLIWEDFDRAVGKQVATAA |
| Ga0306926_126819601 | 3300031954 | Soil | AAEITPVGQIDGAIGHYRFTPGALCQVMIEDYDSATGKHIKAAAAE |
| Ga0306926_128296302 | 3300031954 | Soil | EVTPVGEIIGEHGHYRFTPGTICRLMWEDYDRKVGKQVASAA |
| Ga0318530_102153381 | 3300031959 | Soil | PVGEIVGEVGHYRFTPGAFCRLMSDDFDRAVGKQVATAA |
| Ga0318559_101676014 | 3300032039 | Soil | EVTPVGEIVGEVGHYRFTPGAICQLMWEDFDCAVGKQVAAA |
| Ga0306924_120269741 | 3300032076 | Soil | TPVGEIVGEVGHYRFTPGAICRLMWEDFDRAVGKQVATAA |
| Ga0348332_137387833 | 3300032515 | Plant Litter | LPRQAPVLTGSAAEITRIGEIIGESGHYRFTPGAMWEDYDRTIGKKIAATAA |
| Ga0335083_108637442 | 3300032954 | Soil | EIDGAIGHYRFTPGTICRLMCEDYDRATGKTTNAAAAE |
| Ga0335084_116333651 | 3300033004 | Soil | DGAIGRYRFTPSTICRLMWEDYDRATGKTANAAAAE |
| ⦗Top⦘ |