


| Basic Information | |
|---|---|
| Family ID | F069069 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | SPRITRFWCAPDRGYIPMRVQQKKDDDVQWTLEIQSLKRE |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 89.52 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.935 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.355 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 35.29% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00692 | dUTPase | 39.52 |
| PF06559 | DCD | 25.81 |
| PF10609 | ParA | 6.45 |
| PF14890 | Intein_splicing | 3.23 |
| PF01850 | PIN | 1.61 |
| PF13614 | AAA_31 | 0.81 |
| PF07992 | Pyr_redox_2 | 0.81 |
| PF00437 | T2SSE | 0.81 |
| PF04014 | MazE_antitoxin | 0.81 |
| PF01979 | Amidohydro_1 | 0.81 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF13450 | NAD_binding_8 | 0.81 |
| PF11769 | DUF3313 | 0.81 |
| PF12840 | HTH_20 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 65.32 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 39.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.94 % |
| Unclassified | root | N/A | 33.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS02I0B1I | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10411040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300005093|Ga0062594_101637570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales | 669 | Open in IMG/M |
| 3300005175|Ga0066673_10020939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3011 | Open in IMG/M |
| 3300005341|Ga0070691_10238855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300005363|Ga0008090_10029946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300005434|Ga0070709_10113295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1826 | Open in IMG/M |
| 3300005455|Ga0070663_100033879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3532 | Open in IMG/M |
| 3300005541|Ga0070733_10355064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300005541|Ga0070733_10562430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300005541|Ga0070733_10789173 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005577|Ga0068857_101130054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300005993|Ga0080027_10085078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1174 | Open in IMG/M |
| 3300006050|Ga0075028_100347468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300006176|Ga0070765_102084132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300006237|Ga0097621_100334638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
| 3300006354|Ga0075021_10354231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300006791|Ga0066653_10137767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1170 | Open in IMG/M |
| 3300009038|Ga0099829_11563702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 544 | Open in IMG/M |
| 3300009088|Ga0099830_11455043 | Not Available | 570 | Open in IMG/M |
| 3300009093|Ga0105240_10707821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1099 | Open in IMG/M |
| 3300010049|Ga0123356_10262016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300010049|Ga0123356_10410938 | Not Available | 1493 | Open in IMG/M |
| 3300010361|Ga0126378_12471203 | Not Available | 593 | Open in IMG/M |
| 3300010371|Ga0134125_10747013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 1077 | Open in IMG/M |
| 3300010376|Ga0126381_100723251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1425 | Open in IMG/M |
| 3300010376|Ga0126381_100833491 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300010379|Ga0136449_103546659 | Not Available | 593 | Open in IMG/M |
| 3300011119|Ga0105246_12420095 | Not Available | 515 | Open in IMG/M |
| 3300011120|Ga0150983_10790413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti | 1039 | Open in IMG/M |
| 3300012205|Ga0137362_11577906 | Not Available | 543 | Open in IMG/M |
| 3300012206|Ga0137380_11703238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300012210|Ga0137378_10329580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1419 | Open in IMG/M |
| 3300012469|Ga0150984_117156907 | Not Available | 1323 | Open in IMG/M |
| 3300012977|Ga0134087_10408196 | Not Available | 663 | Open in IMG/M |
| 3300013307|Ga0157372_10965194 | Not Available | 988 | Open in IMG/M |
| 3300014155|Ga0181524_10511080 | Not Available | 509 | Open in IMG/M |
| 3300014158|Ga0181521_10407495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → environmental samples → uncultured Sphingomonadaceae bacterium | 668 | Open in IMG/M |
| 3300014165|Ga0181523_10390281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiolinaceae → Thiolinea → Thiolinea disciformis | 776 | Open in IMG/M |
| 3300014325|Ga0163163_12108466 | Not Available | 623 | Open in IMG/M |
| 3300014499|Ga0182012_10192308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300014501|Ga0182024_12173228 | Not Available | 608 | Open in IMG/M |
| 3300014654|Ga0181525_10045667 | Not Available | 2523 | Open in IMG/M |
| 3300015051|Ga0137414_1063997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
| 3300015052|Ga0137411_1171455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1361 | Open in IMG/M |
| 3300015054|Ga0137420_1494741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 2962 | Open in IMG/M |
| 3300016357|Ga0182032_10286139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1296 | Open in IMG/M |
| 3300016387|Ga0182040_10571717 | Not Available | 912 | Open in IMG/M |
| 3300017937|Ga0187809_10265418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 624 | Open in IMG/M |
| 3300017966|Ga0187776_10312183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001 | 1026 | Open in IMG/M |
| 3300017972|Ga0187781_10261255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300017974|Ga0187777_10361184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1000 | Open in IMG/M |
| 3300017975|Ga0187782_10931843 | Not Available | 674 | Open in IMG/M |
| 3300018007|Ga0187805_10436251 | Not Available | 610 | Open in IMG/M |
| 3300018008|Ga0187888_1285557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiolinaceae → Thiolinea → Thiolinea disciformis | 637 | Open in IMG/M |
| 3300018058|Ga0187766_10398118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 910 | Open in IMG/M |
| 3300018482|Ga0066669_10753086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter tundripaludum | 860 | Open in IMG/M |
| 3300020582|Ga0210395_11190022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
| 3300020583|Ga0210401_10124370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2418 | Open in IMG/M |
| 3300021180|Ga0210396_10875099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 767 | Open in IMG/M |
| 3300021358|Ga0213873_10147845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 706 | Open in IMG/M |
| 3300021420|Ga0210394_10646661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 928 | Open in IMG/M |
| 3300021477|Ga0210398_10472049 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300021478|Ga0210402_10430185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1226 | Open in IMG/M |
| 3300022515|Ga0224546_1030506 | Not Available | 522 | Open in IMG/M |
| 3300023268|Ga0247765_1099044 | Not Available | 616 | Open in IMG/M |
| 3300024290|Ga0247667_1066495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 665 | Open in IMG/M |
| 3300024295|Ga0224556_1015737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1935 | Open in IMG/M |
| 3300025505|Ga0207929_1106786 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300025898|Ga0207692_10576108 | Not Available | 721 | Open in IMG/M |
| 3300025913|Ga0207695_10524344 | Not Available | 1066 | Open in IMG/M |
| 3300025914|Ga0207671_10753354 | Not Available | 773 | Open in IMG/M |
| 3300025915|Ga0207693_10650301 | Not Available | 819 | Open in IMG/M |
| 3300025926|Ga0207659_11760436 | Not Available | 527 | Open in IMG/M |
| 3300025941|Ga0207711_11203597 | Not Available | 699 | Open in IMG/M |
| 3300025986|Ga0207658_10973758 | Not Available | 773 | Open in IMG/M |
| 3300026078|Ga0207702_10417330 | Not Available | 1297 | Open in IMG/M |
| 3300026078|Ga0207702_10480711 | Not Available | 1209 | Open in IMG/M |
| 3300026305|Ga0209688_1117646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → unclassified Chromatiaceae → Chromatiaceae bacterium | 505 | Open in IMG/M |
| 3300026959|Ga0207852_1034030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 520 | Open in IMG/M |
| 3300026959|Ga0207852_1036338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
| 3300027167|Ga0208096_103766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 754 | Open in IMG/M |
| 3300027297|Ga0208241_1072106 | Not Available | 553 | Open in IMG/M |
| 3300027548|Ga0209523_1046850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 882 | Open in IMG/M |
| 3300027853|Ga0209274_10519781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 616 | Open in IMG/M |
| 3300027867|Ga0209167_10027914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2703 | Open in IMG/M |
| 3300027894|Ga0209068_10428983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001 | 756 | Open in IMG/M |
| 3300028047|Ga0209526_10307127 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300028047|Ga0209526_10454982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001 | 841 | Open in IMG/M |
| 3300028047|Ga0209526_10710282 | Not Available | 632 | Open in IMG/M |
| 3300028558|Ga0265326_10031464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
| 3300028792|Ga0307504_10351845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 568 | Open in IMG/M |
| 3300028800|Ga0265338_11007269 | Not Available | 564 | Open in IMG/M |
| 3300028906|Ga0308309_11622598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 550 | Open in IMG/M |
| 3300029951|Ga0311371_10463382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1690 | Open in IMG/M |
| 3300030053|Ga0302177_10184404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1158 | Open in IMG/M |
| 3300030490|Ga0302184_10030323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2803 | Open in IMG/M |
| 3300031028|Ga0302180_10240389 | Not Available | 956 | Open in IMG/M |
| 3300031057|Ga0170834_107406538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 828 | Open in IMG/M |
| 3300031090|Ga0265760_10138631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001 | 791 | Open in IMG/M |
| 3300031231|Ga0170824_103927780 | Not Available | 846 | Open in IMG/M |
| 3300031234|Ga0302325_12129832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 686 | Open in IMG/M |
| 3300031236|Ga0302324_101428719 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300031469|Ga0170819_17894371 | Not Available | 637 | Open in IMG/M |
| 3300031543|Ga0318516_10052110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2228 | Open in IMG/M |
| 3300031573|Ga0310915_11085277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 556 | Open in IMG/M |
| 3300031708|Ga0310686_112084147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1188 | Open in IMG/M |
| 3300031736|Ga0318501_10350290 | Not Available | 793 | Open in IMG/M |
| 3300031736|Ga0318501_10382537 | Not Available | 759 | Open in IMG/M |
| 3300031744|Ga0306918_10075883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2324 | Open in IMG/M |
| 3300031753|Ga0307477_10303656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1101 | Open in IMG/M |
| 3300031754|Ga0307475_11530015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031777|Ga0318543_10174181 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031799|Ga0318565_10026982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2573 | Open in IMG/M |
| 3300031819|Ga0318568_10069173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2070 | Open in IMG/M |
| 3300031945|Ga0310913_11126181 | Not Available | 548 | Open in IMG/M |
| 3300031954|Ga0306926_12293799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → unclassified Ectothiorhodospiraceae → Ectothiorhodospiraceae bacterium WFHF3C12 | 598 | Open in IMG/M |
| 3300031959|Ga0318530_10049365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1579 | Open in IMG/M |
| 3300031962|Ga0307479_10760502 | Not Available | 946 | Open in IMG/M |
| 3300032039|Ga0318559_10318880 | Not Available | 722 | Open in IMG/M |
| 3300032205|Ga0307472_101369089 | Not Available | 685 | Open in IMG/M |
| 3300032770|Ga0335085_10834087 | Not Available | 1011 | Open in IMG/M |
| 3300032895|Ga0335074_10174710 | Not Available | 2670 | Open in IMG/M |
| 3300032955|Ga0335076_10014882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 7816 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.61% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027167 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_01575070 | 2170459012 | Grass Soil | RITRFWCAPDRGYVPMRVEQKKGDDVQWTMEIKSFTRD |
| JGIcombinedJ51221_104110402 | 3300003505 | Forest Soil | SRRANSPRVNRYWCAPARGFVPLRAQQKKGDDVEWTMEIQSLTRD* |
| Ga0062594_1016375701 | 3300005093 | Soil | YSPRVTRFWCAPDKGYVPMQVQQKKGNDVQWTLQIQSLTR* |
| Ga0066673_100209396 | 3300005175 | Soil | SPRVTRFWCAPWRGYVPLRVQQKRGDDIEWTMEIQSLTRE* |
| Ga0070691_102388552 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | IYGSQKEGSPRVTRFWCAPSHGFIPMKVEQKRKDEIEWTMLIESVERD* |
| Ga0008090_100299463 | 3300005363 | Tropical Rainforest Soil | SPRITRFWCAPDRGYIPMRVQQKKGEDVQWTLEIQSLKRE* |
| Ga0070709_101132951 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YSPRTTRFWCAPGKGFIPMKVEQTKGDDVQWTLQIESLKR* |
| Ga0070663_1000338794 | 3300005455 | Corn Rhizosphere | GAQKVGSPRITRFWCAPSQGFVPMRVEQKKDDEVQWTMQLQSVKRDQS* |
| Ga0070733_103550641 | 3300005541 | Surface Soil | TRFWCAPSMGYLPLRIEQKRTDSVEWSMDIRSVRRD* |
| Ga0070733_105624301 | 3300005541 | Surface Soil | SPRITRFWCAPDRGYIPMKVEQKKGDDVQWTLQIQSLTRN* |
| Ga0070733_107891732 | 3300005541 | Surface Soil | RFWCAPARGYVPVRVQQKRLDSVEWTMEIETLQAD* |
| Ga0068857_1011300541 | 3300005577 | Corn Rhizosphere | GSQKEGSPRVTRFWCAPSRGFIPMKVEQKRKDEIEWTMLIESVERD* |
| Ga0080027_100850782 | 3300005993 | Prmafrost Soil | PRITRFWCAPERGYVPMRVEQKKGNDVQWTMEVKSFTRD* |
| Ga0075028_1003474682 | 3300006050 | Watersheds | AYSPRVNRYWCAPDRGYVPLRVQQKRGDEVEWTMEIQSLKRE* |
| Ga0070765_1020841321 | 3300006176 | Soil | ANSPRVNSYWCAPDHGYIPLRVQQKRANDVEWTMEIQSLKRE* |
| Ga0097621_1003346381 | 3300006237 | Miscanthus Rhizosphere | FWCAPSRGYIPMRVEQKKDDDVQWTMQLQSVTRG* |
| Ga0075021_103542313 | 3300006354 | Watersheds | RITRFWCAPSLGFIPLRVEQKKAEDVQWAMQVQTVKR* |
| Ga0066653_101377671 | 3300006791 | Soil | IIYRSERENSPRVTRFWCAPWRGYVPLRVQQKRGDDIEWTMEIQSLTRE* |
| Ga0099829_115637021 | 3300009038 | Vadose Zone Soil | VTRFWCAPWRGDVPMRVEQKRGDDIEWTMEIRSLSRE* |
| Ga0099830_114550431 | 3300009088 | Vadose Zone Soil | SEREGSPRVTRFWCAPSRGYVPMRVEQKRGDDIEWTMEIRSLSRE* |
| Ga0105240_107078212 | 3300009093 | Corn Rhizosphere | SPRVTRFWCAPSLGYIPLRVEQKKGKDDIEWTMQVQSVKREP* |
| Ga0123356_102620161 | 3300010049 | Termite Gut | RFWCAPDRGFIPLRVQQKRGDEVQWTLEIQSLNRP* |
| Ga0123356_104109382 | 3300010049 | Termite Gut | YSPRTTRFWCAPERGYIPVRVEQTKDQSVEWTMQIQSLKRD* |
| Ga0126378_124712032 | 3300010361 | Tropical Forest Soil | RITRFWCAPGRGYVPLKVEQTRGDEVQWTMEIQSLTRAP* |
| Ga0134125_107470131 | 3300010371 | Terrestrial Soil | RVTRFWCAPSRGYIPMRVEQKKDDDVQWTMQMQSVTRE* |
| Ga0126381_1007232511 | 3300010376 | Tropical Forest Soil | SPRVTRFWCAPARGYIPLKVEQTRGDDVQWTMEIERLTRE* |
| Ga0126381_1008334912 | 3300010376 | Tropical Forest Soil | VNRYWLAPDRGYIPMRVQQKRGDDVQWTMEIRSLKRQ* |
| Ga0136449_1035466591 | 3300010379 | Peatlands Soil | PGSPRITRFWCAPDRGYIPLKVEQTRGDEVQWTLEIESLSRP* |
| Ga0105246_124200952 | 3300011119 | Miscanthus Rhizosphere | RVTRFWCAPDKGYVPMQVQQKKGNDVQWTLQIQSLTR* |
| Ga0150983_107904132 | 3300011120 | Forest Soil | AGSPRITRFWCAPDRGYIPLKVEQTRGDEVQWTLEIESLSRP* |
| Ga0137362_115779062 | 3300012205 | Vadose Zone Soil | VIYRSEREGSPRVTRFWCAPWRGYVPMRVEQKRGDDIEWTMEIRSLSRE* |
| Ga0137380_117032382 | 3300012206 | Vadose Zone Soil | GSPRVTRFWCAPSRGYIPMRVEQKKDDEVQWAMQVETVKRD* |
| Ga0137378_103295801 | 3300012210 | Vadose Zone Soil | RVTRFWCAPSRGYIPLRVEQKKGDEVQWAMQVQSAKRD* |
| Ga0150984_1171569072 | 3300012469 | Avena Fatua Rhizosphere | RFWCAPSRGYIPMRVEQKKDDEVQWTMQLQSVTRE* |
| Ga0134087_104081962 | 3300012977 | Grasslands Soil | VTRFWCAPSRGYIPMRVEQKKGDDVQWTMQLQSVTRE* |
| Ga0157372_109651941 | 3300013307 | Corn Rhizosphere | RFWCAPALGYIPMRVQQKRKDDVEWTMEVQSVKRD* |
| Ga0181524_105110802 | 3300014155 | Bog | TRFWCAPSEGYLPMRVEQKRIDSVEWTMEIRSLKRG* |
| Ga0181521_104074952 | 3300014158 | Bog | QHPGSPRITRFWCAPSKGYVPMRVQQKRIDSVEWTMEIETLKSQ* |
| Ga0181523_103902811 | 3300014165 | Bog | QHEGSPRVTRFWCAPSEGYLPMRVEQKRIDSVEWTMEIRSLKRG* |
| Ga0163163_121084661 | 3300014325 | Switchgrass Rhizosphere | QYSPRVTRFWCAPSLGYIPLRVEQKRKDDVEWTMQVQSVKREP* |
| Ga0182012_101923083 | 3300014499 | Bog | HPGSPRVTRFWCAPSRGYLPMRVEQKRINSVEWTMDIRSLQRD* |
| Ga0182024_121732282 | 3300014501 | Permafrost | RSEKQNSPRTTRFWCAPSLGYIPLRVEQKRKDDVEWTMQVQSVKRE* |
| Ga0181525_100456671 | 3300014654 | Bog | RVTRFWCAPSKGFVPVRVQQKRIDSVEWAMEIESLEAP* |
| Ga0137414_10639973 | 3300015051 | Vadose Zone Soil | SSQKEGSPRVTQFWCAPSLGYIPLRVQQRRDHQIEWTMQIQSLKRD* |
| Ga0137411_11714553 | 3300015052 | Vadose Zone Soil | EGSPRVTRFWCAPWRGHVPMRVEQKRGDEIEWTMEIRSLSRE* |
| Ga0137420_14947418 | 3300015054 | Vadose Zone Soil | PRVTRFWCAPWRGYVPMRVEQKRGDEIEWTMEIRSLSRE* |
| Ga0182032_102861391 | 3300016357 | Soil | KKNSPRITRFWCAPDRGYIPLRVQQKKDDDVQWTLEIQSLKRQ |
| Ga0182040_105717171 | 3300016387 | Soil | PRVTRFWCAPDRGFIPMKVQQTKDGDVQWTMEIQSLRR |
| Ga0187809_102654181 | 3300017937 | Freshwater Sediment | PRITRFWCAPERGYIPMKVEQKKDDDVQWTLEIQSLKRQ |
| Ga0187776_103121833 | 3300017966 | Tropical Peatland | NSPHVNRYWCAPDRGYIPVRVQQKRGDDVQWTMEIESLRRE |
| Ga0187781_102612554 | 3300017972 | Tropical Peatland | SPRINSYWCAPLQGYIPVRVQQKRGDDVEWTMEIQSLKRE |
| Ga0187777_103611843 | 3300017974 | Tropical Peatland | AQKAGSPRITRFWCAPERGYVPMKVEQTRGDEVQWTMEIESLTRAP |
| Ga0187782_109318431 | 3300017975 | Tropical Peatland | RPGSQRANRYWCAPDRGYIPLRAEQKVDDDIQWTMNIESLKRD |
| Ga0187805_104362511 | 3300018007 | Freshwater Sediment | TRFWCAPERGYIPLKVEQTRGDDVQWTMEIESLTR |
| Ga0187888_12855571 | 3300018008 | Peatland | RVTRFWCAPSEGYLPMRVEQKRIDSVEWTMEIRSLKRG |
| Ga0187766_103981182 | 3300018058 | Tropical Peatland | NRYWCAPDRGYIPLRVQQKRGDEVQWTMEIRTLKRE |
| Ga0066669_107530863 | 3300018482 | Grasslands Soil | SPRVTRFWCAPWRGYVPLRVQQKRGDDIEWTMEIQSLTRE |
| Ga0210395_111900221 | 3300020582 | Soil | TSRKANSPRVNSYWCAPDQGYIPLRVQQKRADEVEWTMEILSLKRE |
| Ga0210401_101243703 | 3300020583 | Soil | QKTYSPRITRFWCAPDRGYIPMKVEQKKGDDVQWTLQIQGLTRN |
| Ga0210396_108750992 | 3300021180 | Soil | RKNSPHVNRYWCAPERGYIPMRVEQKRGDEVQWAMEIQSLKRQ |
| Ga0213873_101478451 | 3300021358 | Rhizosphere | RATRFWCAPERGYVPVKVEQAIGQDVQWTLLIQSLKR |
| Ga0210394_106466612 | 3300021420 | Soil | EGSPRVTRFWCAPDRGYIPMRVEQTRDKDVEWTMQIRSLKRE |
| Ga0210398_104720491 | 3300021477 | Soil | RVTRFWCSPERGYVPIKVEQTKGSDVQWTLEIQSLTR |
| Ga0210402_104301851 | 3300021478 | Soil | NSPRATRFWCAPSRGYIPLKVEQKRGDDVEWAMEITSLKRE |
| Ga0224546_10305061 | 3300022515 | Soil | VVYTSQKANSPRVNSYWCAPDRGYIPMRVQQKRGEEVEWTMEIESVKRQ |
| Ga0247765_10990441 | 3300023268 | Plant Litter | RVTRFWCAPSRGFIPMRVEQKKGGDVQWTMQLQAVTRE |
| Ga0247667_10664951 | 3300024290 | Soil | YRAQKKYSPRTTRFWCAPDKGFIPMKVEQTKGDEVQWTLQIESLKR |
| Ga0224556_10157371 | 3300024295 | Soil | PRITRFWCAPEHGYVPLKVEQRIGEDVQWSMEIMSLTGG |
| Ga0207929_11067862 | 3300025505 | Arctic Peat Soil | RVTRFWCAPSRGYVPVRVEQKRIDSVEWTLEIQTLAGD |
| Ga0207692_105761082 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YSPRVTRFWCAPDKGYVPMQVQQKKGNDVQWTLQIQSLTR |
| Ga0207695_105243442 | 3300025913 | Corn Rhizosphere | SPRVTRFWCAPSLGYIPLRVEQKKGKDDIEWTMQVQSVKREP |
| Ga0207671_107533542 | 3300025914 | Corn Rhizosphere | FKSEKQYSPRVTRFWCAPSLGYIPLRVEQKKGKDDIEWTMQVQSVKREP |
| Ga0207693_106503012 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QKKYSPRITSFWCAPDRGYIPMKVQQKKGEDVQWTLEIQSLTRQ |
| Ga0207659_117604361 | 3300025926 | Miscanthus Rhizosphere | RSEKQYSPRVTRFWCAPSLGYIPLRVQQKRKDDVEWTMQVQSVKREQ |
| Ga0207711_112035972 | 3300025941 | Switchgrass Rhizosphere | PRVTRFWCAPSRGFIPMRVEQKKDDEVQWTMQVQSVTRG |
| Ga0207658_109737582 | 3300025986 | Switchgrass Rhizosphere | RVTRFWCAPSRGYIPVRIEQTKGDDVQWTMQVQSVKRD |
| Ga0207702_104173301 | 3300026078 | Corn Rhizosphere | RFWCAPSRGYIPMRVEQKKDDDVQWTMQVQSVTRG |
| Ga0207702_104807112 | 3300026078 | Corn Rhizosphere | TPIGSIATIVYASQKEGSPRVTRFWCAPARGFIPMKVEQKRKDEVEWTLLIESVQRE |
| Ga0209688_11176462 | 3300026305 | Soil | SPRVTRFWCAPWRGYVPLRVQQKRGEDVEWTMEIQSLTRE |
| Ga0207852_10340302 | 3300026959 | Tropical Forest Soil | KAHSPRITRFWCAPDRGYVPMKVEQTKGDDVQWTMEIRSLKRQ |
| Ga0207852_10363382 | 3300026959 | Tropical Forest Soil | SQRPNSARINRYWCAPERGQIPMRVQQKVDDDVQWTMEIRSFKRE |
| Ga0208096_1037662 | 3300027167 | Forest Soil | YSSQKAYSPRINSYWCAPDRGYIPMRVQQKRGDDVEWTMEIQSLKRE |
| Ga0208241_10721061 | 3300027297 | Forest Soil | PRITRFWCAPDRGYIPMKVEQKKGDDVQWTLQIQSVTRN |
| Ga0209523_10468503 | 3300027548 | Forest Soil | TVVYRAQKAGSPRVTRFWCAPERGYIPLRVEQTRGDDVQWTMEIQSLRRE |
| Ga0209274_105197811 | 3300027853 | Soil | ANSPRVNSYWCAPEQGYLPLRVQQKRADEVEWTMEILSLKRE |
| Ga0209167_100279144 | 3300027867 | Surface Soil | FQSHKQGSPRVNLFWCAPARNYIPLRVEQRRKGEVQWTMQIESLTLGPG |
| Ga0209068_104289832 | 3300027894 | Watersheds | PRITRFWCAPSLGFIPLRVEQKKAEDVQWAMQVQTVKR |
| Ga0209526_103071273 | 3300028047 | Forest Soil | RFWCAPTKGYVPMRVQQKRIDSVEWTMEIESFKTD |
| Ga0209526_104549821 | 3300028047 | Forest Soil | RFWCAPARGYIPMRVEQKRGDDIEWSMEIRSLKRE |
| Ga0209526_107102822 | 3300028047 | Forest Soil | RFWCAPARGYIPMRVEQKRGDDIEWSMEIRSLSRE |
| Ga0265326_100314643 | 3300028558 | Rhizosphere | RITRFWCAPARGYVPLKVEQRIGNDVQWSMEIMRLTGG |
| Ga0307504_103518451 | 3300028792 | Soil | PRVTRFWCAPWRGYVPMRVEQKRGDDIEWTMEIRSLSRE |
| Ga0265338_110072691 | 3300028800 | Rhizosphere | RFWCAPAEGYIPMKVEQTKGDDVQWTLQIQSLKRD |
| Ga0308309_116225981 | 3300028906 | Soil | VNYTSRKANSPRVNSYWCAPDHGYIPLRVQQKRANEVEWTMEIQSLKRE |
| Ga0311371_104633821 | 3300029951 | Palsa | SEKQYSPRITRFWCAPSLGYIPLRVQQTRNDDVEWTMQVQSVKRE |
| Ga0302177_101844041 | 3300030053 | Palsa | AYSPRVTRFWCAPGNGYIPMKVEQTKGDDVQWTLQIQSLKRD |
| Ga0302184_100303234 | 3300030490 | Palsa | RFWCAPSKGFVPVRVQQKRIDSVEWAMEIQSLEAP |
| Ga0302180_102403891 | 3300031028 | Palsa | QKAYSPRVTRFWCAPGNGYIPMKVEQTKGDDVQWTLQIQSLKRD |
| Ga0170834_1074065382 | 3300031057 | Forest Soil | VYRAQKANSPRITRFWCAPGRGYIPLKVEQTKGDDVQWTMEIQSLERH |
| Ga0265760_101386311 | 3300031090 | Soil | RKANSPRVNSYWCAPEQGYLPLRVQQKRADEVEWTMEILSLKRE |
| Ga0170824_1039277801 | 3300031231 | Forest Soil | RTTRFWCAPSLGYIPLRVQQTRKDDVEWTMQVKSVKREQ |
| Ga0302325_121298321 | 3300031234 | Palsa | SQRANSPRFNRYWCAPDRGYIPMRVQQKRGDEVQWTMEIESVKRQ |
| Ga0302324_1014287191 | 3300031236 | Palsa | RFWCAPSKGYVPLRVEQKRLDEVEWTMEIETLKAQ |
| Ga0170819_178943711 | 3300031469 | Forest Soil | RSQKTGSPRVTRFWCAPSRGYIPMRVEQKKGDDVQWTMQVQSVKRD |
| Ga0318516_100521104 | 3300031543 | Soil | KKNSPRITRFWCAPDRGYVPMRVQQKKDEDVQWTLEIQSLKRE |
| Ga0310915_110852771 | 3300031573 | Soil | KSQKKYSPRITRFWCAPDRGYVPMRVQQKKDDDVQWTLEIQSLKRE |
| Ga0310686_1120841471 | 3300031708 | Soil | REGSPRVTRFWCAPDRGYIPMRVEQTRGKDVEWTMEIRSLKRE |
| Ga0318501_103502901 | 3300031736 | Soil | RFWCAPDRGYIPLRVQQKKDDDVQWTLEIQSLKRQ |
| Ga0318501_103825371 | 3300031736 | Soil | SPRITRFWCAPDRGYIPMRVQQKKDDDVQWTLEIQSLKRE |
| Ga0306918_100758831 | 3300031744 | Soil | SPRITRFWCAPDRGYVPMRVQQRKGDDVQWTLEIQSLKRE |
| Ga0307477_103036561 | 3300031753 | Hardwood Forest Soil | RENSPRVTRFWCAPWRGYVPLRVEQKRGDEIEWTMEIKSLSRE |
| Ga0307475_115300152 | 3300031754 | Hardwood Forest Soil | GAIATVVYRAQKAGSPRVTRFWCAPERGYIPLRVEQTRGDDVQWSMEIERLRRE |
| Ga0318543_101741811 | 3300031777 | Soil | KYSPRITRFWCAPDRGYVPMRVQQKRDEDVQWTLEIASLTRR |
| Ga0318565_100269821 | 3300031799 | Soil | NSPRITRFWCAPDRGYVPMRVQQKKDEDVQWTLEIQSLKRE |
| Ga0318568_100691734 | 3300031819 | Soil | NSPRITRFWCAPDHGYIPMRVQQKKDDDVQWTLEIQSLQRQ |
| Ga0310913_111261811 | 3300031945 | Soil | IFSSQRVNSPHVNRYWLAPDRGYIPMRVQQKRDDDVQWTMEIQSLQR |
| Ga0306926_122937991 | 3300031954 | Soil | VATVVYTSQRAGSPRITRFWCAPDKGFIPLRVEQRRQNDVEWRMDIQSLNRP |
| Ga0318530_100493653 | 3300031959 | Soil | KNSPRITRFWCAPDRGYVPMRVQQKKDEDVQWTLEIQSLKRE |
| Ga0307479_107605022 | 3300031962 | Hardwood Forest Soil | TRFWCAPSLGYIPVRVEQTKGQRDVEWTMQVQSVKREP |
| Ga0318559_103188802 | 3300032039 | Soil | QKKYSPRITRFWCAPDRGYIPMRVQQKKDDDVQWTLEIQSLKRE |
| Ga0307472_1013690892 | 3300032205 | Hardwood Forest Soil | TRFWCAPHQGYVPVKVEQTKGDEVQWTMEIRSLSRQ |
| Ga0335085_108340872 | 3300032770 | Soil | SPRITSFWCAPDRGYIPMKVQQKKGDDVQWTLEIQSLTRQ |
| Ga0335074_101747104 | 3300032895 | Soil | AHHTGSPRTTRFWCAPSLGYVPLRVQQKRLNEVEWTLQIRSLQRG |
| Ga0335076_100148821 | 3300032955 | Soil | ITRFWCASDRGFIPVRVQQKRDDDVQWTLEIQSLSRQ |
| ⦗Top⦘ |