


| Basic Information | |
|---|---|
| Family ID | F069058 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | EVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.16 % |
| % of genes from short scaffolds (< 2000 bps) | 85.48 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.258 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.742 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.419 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02219 | MTHFR | 13.71 |
| PF00004 | AAA | 5.65 |
| PF01135 | PCMT | 4.84 |
| PF12697 | Abhydrolase_6 | 3.23 |
| PF03401 | TctC | 2.42 |
| PF08238 | Sel1 | 2.42 |
| PF02668 | TauD | 2.42 |
| PF13207 | AAA_17 | 1.61 |
| PF13340 | DUF4096 | 0.81 |
| PF01418 | HTH_6 | 0.81 |
| PF00149 | Metallophos | 0.81 |
| PF07724 | AAA_2 | 0.81 |
| PF12695 | Abhydrolase_5 | 0.81 |
| PF00089 | Trypsin | 0.81 |
| PF08352 | oligo_HPY | 0.81 |
| PF00180 | Iso_dh | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 13.71 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 4.84 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 4.84 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 4.84 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 4.84 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.42 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.26 % |
| Unclassified | root | N/A | 17.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100497437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2306 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1072184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1027929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1038793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1007636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
| 3300000890|JGI11643J12802_11735067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti | 784 | Open in IMG/M |
| 3300000890|JGI11643J12802_11937086 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300000956|JGI10216J12902_109294776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 980 | Open in IMG/M |
| 3300002459|JGI24751J29686_10010444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1914 | Open in IMG/M |
| 3300002911|JGI25390J43892_10076820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300004479|Ga0062595_100523608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300005175|Ga0066673_10333053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300005181|Ga0066678_11105473 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005332|Ga0066388_103149534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300005353|Ga0070669_100644790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 891 | Open in IMG/M |
| 3300005436|Ga0070713_101967226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300005471|Ga0070698_101339741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300005539|Ga0068853_100237098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1671 | Open in IMG/M |
| 3300005546|Ga0070696_100527911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300005549|Ga0070704_100410494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1157 | Open in IMG/M |
| 3300005553|Ga0066695_10836010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300005555|Ga0066692_10056395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2203 | Open in IMG/M |
| 3300005556|Ga0066707_10165226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1411 | Open in IMG/M |
| 3300005568|Ga0066703_10647548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300005713|Ga0066905_101011656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300005713|Ga0066905_102083475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300005764|Ga0066903_100524642 | Not Available | 2018 | Open in IMG/M |
| 3300005843|Ga0068860_102411376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300006028|Ga0070717_10172944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1879 | Open in IMG/M |
| 3300006038|Ga0075365_10148095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300006178|Ga0075367_10772182 | Not Available | 612 | Open in IMG/M |
| 3300006871|Ga0075434_100260821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1752 | Open in IMG/M |
| 3300009036|Ga0105244_10590458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300009551|Ga0105238_12996747 | Not Available | 507 | Open in IMG/M |
| 3300010046|Ga0126384_10112563 | Not Available | 2032 | Open in IMG/M |
| 3300010046|Ga0126384_11321327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300010047|Ga0126382_11568481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300010358|Ga0126370_10143197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1731 | Open in IMG/M |
| 3300010359|Ga0126376_10338434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1328 | Open in IMG/M |
| 3300010360|Ga0126372_11032855 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300010360|Ga0126372_11894963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300010366|Ga0126379_12016805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300010376|Ga0126381_100803402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1351 | Open in IMG/M |
| 3300010398|Ga0126383_11111859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300010400|Ga0134122_12467846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 568 | Open in IMG/M |
| 3300012200|Ga0137382_10780410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300012212|Ga0150985_121973874 | Not Available | 502 | Open in IMG/M |
| 3300012361|Ga0137360_10022892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4205 | Open in IMG/M |
| 3300012469|Ga0150984_104133091 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012582|Ga0137358_10618755 | Not Available | 726 | Open in IMG/M |
| 3300012896|Ga0157303_10022793 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012917|Ga0137395_10201159 | Not Available | 1386 | Open in IMG/M |
| 3300012924|Ga0137413_11011004 | Not Available | 652 | Open in IMG/M |
| 3300012929|Ga0137404_10883082 | Not Available | 815 | Open in IMG/M |
| 3300012948|Ga0126375_10052006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2188 | Open in IMG/M |
| 3300012957|Ga0164303_10067317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1657 | Open in IMG/M |
| 3300012957|Ga0164303_10927223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300012961|Ga0164302_11792441 | Not Available | 518 | Open in IMG/M |
| 3300012971|Ga0126369_10315447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1571 | Open in IMG/M |
| 3300012988|Ga0164306_10227928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1323 | Open in IMG/M |
| 3300012988|Ga0164306_10903131 | Not Available | 720 | Open in IMG/M |
| 3300013297|Ga0157378_12666216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 552 | Open in IMG/M |
| 3300013306|Ga0163162_11646622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 732 | Open in IMG/M |
| 3300014969|Ga0157376_11857540 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300015264|Ga0137403_10513929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300016319|Ga0182033_10831671 | Not Available | 815 | Open in IMG/M |
| 3300016357|Ga0182032_10112234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1949 | Open in IMG/M |
| 3300016357|Ga0182032_11693215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 551 | Open in IMG/M |
| 3300016357|Ga0182032_11777395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300016371|Ga0182034_10108231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2009 | Open in IMG/M |
| 3300016404|Ga0182037_10775322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300017792|Ga0163161_11805421 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018055|Ga0184616_10215028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 723 | Open in IMG/M |
| 3300020001|Ga0193731_1066812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 942 | Open in IMG/M |
| 3300025910|Ga0207684_10727353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300025938|Ga0207704_10370162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1122 | Open in IMG/M |
| 3300025972|Ga0207668_10562290 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300026277|Ga0209350_1086227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300026326|Ga0209801_1320122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300026494|Ga0257159_1099663 | Not Available | 509 | Open in IMG/M |
| 3300026523|Ga0209808_1119048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1086 | Open in IMG/M |
| 3300026524|Ga0209690_1149018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 861 | Open in IMG/M |
| 3300027181|Ga0208997_1033911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300027646|Ga0209466_1030088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300027654|Ga0209799_1065443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300027874|Ga0209465_10448964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 645 | Open in IMG/M |
| 3300028536|Ga0137415_11447377 | Not Available | 511 | Open in IMG/M |
| 3300028721|Ga0307315_10140382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 729 | Open in IMG/M |
| 3300031199|Ga0307495_10183465 | Not Available | 564 | Open in IMG/M |
| 3300031546|Ga0318538_10339685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300031682|Ga0318560_10028605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2616 | Open in IMG/M |
| 3300031736|Ga0318501_10039979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2133 | Open in IMG/M |
| 3300031744|Ga0306918_10592915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300031751|Ga0318494_10414055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300031769|Ga0318526_10123229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300031779|Ga0318566_10052728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1936 | Open in IMG/M |
| 3300031797|Ga0318550_10000459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10819 | Open in IMG/M |
| 3300031805|Ga0318497_10665779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 584 | Open in IMG/M |
| 3300031832|Ga0318499_10179323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300031859|Ga0318527_10321256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031860|Ga0318495_10236933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
| 3300031912|Ga0306921_11123615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300031912|Ga0306921_12248695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300031941|Ga0310912_10883125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300031942|Ga0310916_11397327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300031942|Ga0310916_11573249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 534 | Open in IMG/M |
| 3300031954|Ga0306926_11473551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300031981|Ga0318531_10235597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300031981|Ga0318531_10543744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300032009|Ga0318563_10032972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2599 | Open in IMG/M |
| 3300032009|Ga0318563_10784869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 510 | Open in IMG/M |
| 3300032010|Ga0318569_10419237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 624 | Open in IMG/M |
| 3300032051|Ga0318532_10225165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300032060|Ga0318505_10018791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2661 | Open in IMG/M |
| 3300032076|Ga0306924_10786820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 1062 | Open in IMG/M |
| 3300032180|Ga0307471_102334656 | Not Available | 675 | Open in IMG/M |
| 3300032261|Ga0306920_102113164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300032261|Ga0306920_103694710 | Not Available | 562 | Open in IMG/M |
| 3300033550|Ga0247829_10954959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.23% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1004974371 | 3300000559 | Soil | DRAKTDFVAQEIAAMAITAPRKVSADDVRTLLAAAG* |
| AP72_2010_repI_A01DRAFT_10721841 | 3300000579 | Forest Soil | GFPIPQRLLEVGFDRAKTDFVAREVEAMAISVPRKVSAEDVRALLAAAY* |
| AF_2010_repII_A01DRAFT_10279294 | 3300000580 | Forest Soil | RLSEVGFDRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD* |
| AF_2010_repII_A01DRAFT_10387931 | 3300000580 | Forest Soil | FDRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD* |
| AP72_2010_repI_A10DRAFT_10076362 | 3300000651 | Forest Soil | LEVGFDRAKTDFVAREVEAMAISVPRKVSAEDVRALLAAAY* |
| JGI11643J12802_117350671 | 3300000890 | Soil | GKVDFVAGEVAAMSISAPRKVSAEDVRTLLSAAY* |
| JGI11643J12802_119370863 | 3300000890 | Soil | AKVDFVAGEVAAMSISAPRKVSAEDVRALLAAAY* |
| JGI10216J12902_1092947761 | 3300000956 | Soil | QRLAEVGFDRAKTDFVTQEVAALKITAPRKVSAEDVRTLLAAAD* |
| JGI24751J29686_100104441 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY* |
| JGI25390J43892_100768202 | 3300002911 | Grasslands Soil | EVGFDRAKTDFVAQEVAAMAISVPRKLSAEDVRTLLAAAY* |
| Ga0062595_1005236082 | 3300004479 | Soil | LTEVGFDRRKTDFVAPEIAAMGIGVPRKVSAEDARMLLAAAD* |
| Ga0066673_103330531 | 3300005175 | Soil | LTEVGFDRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD* |
| Ga0066678_111054732 | 3300005181 | Soil | IPQRLREVGFDRDKIEFVASEVAGMAISAPRPVSAADVRALLAAAS* |
| Ga0066388_1031495341 | 3300005332 | Tropical Forest Soil | SLPIPHRLSQVGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF* |
| Ga0070669_1006447901 | 3300005353 | Switchgrass Rhizosphere | EVGFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY* |
| Ga0070713_1019672261 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PIPQRLAEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY* |
| Ga0070698_1013397412 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GEVGFDRAKIDFVAGEVAALSISAPRKVSAEDVRALLAAAY* |
| Ga0068853_1002370981 | 3300005539 | Corn Rhizosphere | VGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY* |
| Ga0070696_1005279112 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY* |
| Ga0070704_1004104942 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY* |
| Ga0066695_108360101 | 3300005553 | Soil | EVGFDRAKTDFVAQEIAAMKILAPRKVLAEDVRTLLAAAA* |
| Ga0066692_100563951 | 3300005555 | Soil | GFPIPQRLREVGFDRAKTDFVAQEVAAMAISVPRKLSAEDVRTLLAAAY* |
| Ga0066707_101652261 | 3300005556 | Soil | FDRAKTDFVAQEVAAMSITVPCKVSAEDVRTLLAAAY* |
| Ga0066703_106475482 | 3300005568 | Soil | DRAKTDFVAQEIAAMKILAPRKVLAEDVRTLLAAAA* |
| Ga0066905_1010116561 | 3300005713 | Tropical Forest Soil | LLEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAW* |
| Ga0066905_1020834751 | 3300005713 | Tropical Forest Soil | FDRAKADFVAQEVEAMAISVPRKVAAEDVRTLLAAAY* |
| Ga0066903_1005246421 | 3300005764 | Tropical Forest Soil | GFPIPQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRTLLAAAY* |
| Ga0068860_1024113762 | 3300005843 | Switchgrass Rhizosphere | RRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD* |
| Ga0070717_101729444 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RLREVGFDRAKTDFIAQEVAAMSISVPRKVSAEDVRALLAAAY* |
| Ga0075365_101480953 | 3300006038 | Populus Endosphere | VGFDRAKADFVATEVEKLSISAPRTVSADDVRAVLAAAY* |
| Ga0075364_101274113 | 3300006051 | Populus Endosphere | GLDRGKIDFVATEVAKLAIAVPRKVSADDVRALLAAAY* |
| Ga0075367_107721822 | 3300006178 | Populus Endosphere | PIPHRLAEVGFDRAKVDFVADEVAAMSISAPRTVSADDVRAVLAAAY* |
| Ga0075431_1003502372 | 3300006847 | Populus Rhizosphere | DRGKIDFVAAEMAALAIRVPREVSARDVCALLAAAY* |
| Ga0075434_1002608213 | 3300006871 | Populus Rhizosphere | FDRGKTDFAAQEIAAMGISVPRKVSAEDVRMLLAAAD* |
| Ga0105244_105904582 | 3300009036 | Miscanthus Rhizosphere | PQRLAEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY* |
| Ga0105238_129967472 | 3300009551 | Corn Rhizosphere | GFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY* |
| Ga0126384_101125632 | 3300010046 | Tropical Forest Soil | EVGFDRAKTDFVAREVEAMSITVPRKVSAADVCTLLAAAW* |
| Ga0126384_113213271 | 3300010046 | Tropical Forest Soil | PQRLSEVGFDRTKTDFVAQEIAAMAISVPRKVSADDVRALLAAA* |
| Ga0126382_115684812 | 3300010047 | Tropical Forest Soil | FPIPQRLLEVGFDRAKADFVAQEVEAMAISVPRKVAAEDVRTLLAAAY* |
| Ga0126370_101431972 | 3300010358 | Tropical Forest Soil | IPQRLLEVGFDRAKTDFVAREVEAMAISVPRKVSAEDVHTLLAAAW* |
| Ga0126376_103384342 | 3300010359 | Tropical Forest Soil | FPIPQKLSEVGFDRGKIDFVADEVAAMAIKMPRPASAEDVRGLLAAAY* |
| Ga0126372_110328551 | 3300010360 | Tropical Forest Soil | GKIDFVAKEVAALGIKVPRPVAAEDVRALLAAAY* |
| Ga0126372_118949632 | 3300010360 | Tropical Forest Soil | FDRAKTDFVAQEVAAMAISLPRKVSAEDVRTLLAAAY* |
| Ga0126379_120168053 | 3300010366 | Tropical Forest Soil | RAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD* |
| Ga0126381_1008034021 | 3300010376 | Tropical Forest Soil | IPQRLLEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVHTLLAAAW* |
| Ga0126383_111118592 | 3300010398 | Tropical Forest Soil | FDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAY* |
| Ga0134122_124678462 | 3300010400 | Terrestrial Soil | RGFPIPRRLAEVGFDRAKADFVASEVEKLSISAPRTVSADDVRAVLAAAY* |
| Ga0137382_107804102 | 3300012200 | Vadose Zone Soil | LREVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAH* |
| Ga0150985_1219738741 | 3300012212 | Avena Fatua Rhizosphere | DVGFDRTKAEFVAGEIAAMAISVPRKVSAADVRTLLEAAY* |
| Ga0137360_100228921 | 3300012361 | Vadose Zone Soil | LREVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY* |
| Ga0150984_1041330911 | 3300012469 | Avena Fatua Rhizosphere | FDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY* |
| Ga0137358_106187551 | 3300012582 | Vadose Zone Soil | VGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY* |
| Ga0157303_100227931 | 3300012896 | Soil | RFDRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD* |
| Ga0137395_102011592 | 3300012917 | Vadose Zone Soil | PIPQRLGEVGFDRAKTDFVAQEIAAMKIFSPRKVSAEDVRTLLAAAY* |
| Ga0137413_110110042 | 3300012924 | Vadose Zone Soil | SDVGFDRAKTDFVAGEIAAMALSVPRRVSADDLRALLQAAY* |
| Ga0137404_108830822 | 3300012929 | Vadose Zone Soil | SDVGFDRTKAEFVAGEIAAMAISVPRKVSAADVRVLLEAAY* |
| Ga0126375_100520063 | 3300012948 | Tropical Forest Soil | GLGKVGFDRAKTEFVAQEIAAMKILTPRKVSAEDVRTLLAAAY* |
| Ga0164303_100673173 | 3300012957 | Soil | FDRAKVDFVADEVAAMSINAPRKVSADDVRAVLAAAY* |
| Ga0164303_109272231 | 3300012957 | Soil | EVGFDRAKVDFVSGEVAAMSISAPREVSADDVRAVLAAAY* |
| Ga0164302_117924411 | 3300012961 | Soil | EVGFDRAKADFVASEVEKLSISAPRTVSADDVRAVLAAAY* |
| Ga0126369_103154473 | 3300012971 | Tropical Forest Soil | GFDRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD* |
| Ga0164306_102279281 | 3300012988 | Soil | EVRFDRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD* |
| Ga0164306_109031311 | 3300012988 | Soil | FPIPRRLAEVGFDRAKVDFVADEVAAMSINAPRKVSADDVRAVLAAAY* |
| Ga0157378_126662162 | 3300013297 | Miscanthus Rhizosphere | LAEVGFDRAKADFVASEVEKLSISAPRTVSADDVRAVLAAAY* |
| Ga0163162_116466222 | 3300013306 | Switchgrass Rhizosphere | GFDRAKADFVATEVEKLSISAPRTVSADDVRAVLAAAY* |
| Ga0157376_118575402 | 3300014969 | Miscanthus Rhizosphere | FPIPQRLAEVGFDRAKVDFVADEVAAMSINAPRKVSADDVRAVLAAAY* |
| Ga0137403_105139293 | 3300015264 | Vadose Zone Soil | RLVEVGFDRAKTDFVAQEIVAMAITVPRKVSADDVRALLAAAG* |
| Ga0182033_108316711 | 3300016319 | Soil | KLSDVGFDPARIDFVAGEVAAMAINSPRKVSAADVRALLQSAC |
| Ga0182032_101122343 | 3300016357 | Soil | FDRAKTDFVAREVEAMTISVPRKVAAEDVRTLLAAAY |
| Ga0182032_116932151 | 3300016357 | Soil | RAKTDFVAQEVAAMAITVPRKVSAEDVRALLAAAY |
| Ga0182032_117773952 | 3300016357 | Soil | LLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW |
| Ga0182034_101082312 | 3300016371 | Soil | RGFPIPQRLREVGFDRAKTDFVAQEVAAMAISIPRKVSAEDVRTLLAAAY |
| Ga0182037_107753221 | 3300016404 | Soil | REVGFDRAKTDFVAQEVAAMAISIPRKVSAEDVRTLLAAAY |
| Ga0163161_118054212 | 3300017792 | Switchgrass Rhizosphere | FPIPQRLAEVGFDSAKVDFVAGEVAAMSISAPRKVSAEDVRALLAAAY |
| Ga0184616_102150281 | 3300018055 | Groundwater Sediment | PQRLAEVGFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY |
| Ga0193731_10668121 | 3300020001 | Soil | AEVGFDRAKVDFVAGEVAAMSISAPRKVSADDVRAVLAAAY |
| Ga0207684_107273532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FDRAKTDFVAQEVEAMAISVPRKVSAEDVRTLLAAAY |
| Ga0207700_119043061 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RDKIEFIAAEVGKLAIAVPRPVSGADVRALLAAAY |
| Ga0207704_103701621 | 3300025938 | Miscanthus Rhizosphere | RAKVDFVADEVAAMSISAPRTVSADDVRAVLAAAY |
| Ga0207668_105622901 | 3300025972 | Switchgrass Rhizosphere | RAKVDFVAGEVAAMSISAPRKVSAEDVRALLAAAY |
| Ga0209350_10862272 | 3300026277 | Grasslands Soil | RLREVGFDRAKTDFVAQEVAAMSITVPCKVSAEDVRTLLAAAY |
| Ga0209801_13201221 | 3300026326 | Soil | PIPQRLREVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAH |
| Ga0257159_10996632 | 3300026494 | Soil | REVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY |
| Ga0209808_11190481 | 3300026523 | Soil | PIPQRLTEVGFDRAKTDFVAQEIAAMKILAPRKVLAEDVRTLLAAAA |
| Ga0209690_11490182 | 3300026524 | Soil | REVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAH |
| Ga0208997_10339112 | 3300027181 | Forest Soil | SDVGFDRGKTDFVAAEIAKLAIAVPRAVSANDVRTLLAAA |
| Ga0209466_10300882 | 3300027646 | Tropical Forest Soil | LEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAGAY |
| Ga0209799_10654431 | 3300027654 | Tropical Forest Soil | LSEVGFDRAKTDFVAQQIAAMKILAPREVSAEDVRTLLAAAY |
| Ga0209465_104489642 | 3300027874 | Tropical Forest Soil | GFDRAKTDFVAQEVAAMAISLPRKVSAEDVRTLLAAAY |
| Ga0137415_114473771 | 3300028536 | Vadose Zone Soil | LSDVGFDRAKTDFVAGEIAAMAINVPRRVSTDDVRALLQAAY |
| Ga0307315_101403821 | 3300028721 | Soil | GFDRAKVDFVAGEVAAMSISAPRKVSADDVRAVLAAAY |
| Ga0307495_101834652 | 3300031199 | Soil | KLSDVGFDRAKIDFVAGEIAAMAISVPRQVSADDVRALLRAAY |
| Ga0318538_103396852 | 3300031546 | Soil | LLEVGFDRAKTDFVAREVEAMTISVPRKVAAEDVRTLLAAAY |
| Ga0318560_100286051 | 3300031682 | Soil | RAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD |
| Ga0318501_100399793 | 3300031736 | Soil | REVGFDRAKTDFIAQEVAAMAISVPRKVAAEDVRTLLAAAY |
| Ga0306918_105929152 | 3300031744 | Soil | RGFPIPQRLREVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVGALLAAAY |
| Ga0318494_104140551 | 3300031751 | Soil | QRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY |
| Ga0318526_101232292 | 3300031769 | Soil | QRLREVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAVAY |
| Ga0318566_100527284 | 3300031779 | Soil | GFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF |
| Ga0318550_100004591 | 3300031797 | Soil | LSQVGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF |
| Ga0318497_106657791 | 3300031805 | Soil | LGAIESDFAQEVAAMAITVPRKVSAEDVRALLAAAY |
| Ga0318499_101793231 | 3300031832 | Soil | VGFDRAKADFVAQEVEAMAISVPRKVSAEDVRALLAAAY |
| Ga0318527_103212561 | 3300031859 | Soil | GFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAVAY |
| Ga0318495_102369332 | 3300031860 | Soil | PQRLLEVGFDRAKTDFVAQEVAAMSISVPRKVAAEDVRTLLAAAY |
| Ga0306921_111236151 | 3300031912 | Soil | EVGFDRAKTDFVAQEIAAMAISLPRKVSAEDVRTLLAAAY |
| Ga0306921_122486952 | 3300031912 | Soil | PQRLLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW |
| Ga0310912_108831251 | 3300031941 | Soil | QRLREVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVGALLAAAY |
| Ga0310916_113973272 | 3300031942 | Soil | GFPIPQRLLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW |
| Ga0310916_115732492 | 3300031942 | Soil | GFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAY |
| Ga0306926_114735511 | 3300031954 | Soil | LEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAY |
| Ga0318531_102355971 | 3300031981 | Soil | QRLREVGFDRAKTDFVAQEVAAMAISIPRKVSAEDVRTLLAAAY |
| Ga0318531_105437442 | 3300031981 | Soil | LEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW |
| Ga0318563_100329721 | 3300032009 | Soil | FPIPQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY |
| Ga0318563_107848691 | 3300032009 | Soil | EVGFDRAKTDFIAQEVAEMAISVPRKVAAEDVRTLLAAAY |
| Ga0318569_104192371 | 3300032010 | Soil | VGFDRAKTDFVAQEVAAMAITVPRKVSAEDVRALLAAAY |
| Ga0318532_102251652 | 3300032051 | Soil | GFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY |
| Ga0318505_100187914 | 3300032060 | Soil | LPIPHRLSQVGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF |
| Ga0306924_107868201 | 3300032076 | Soil | PQRLREVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVRALLAAAY |
| Ga0307471_1023346561 | 3300032180 | Hardwood Forest Soil | DRAKIDFVAGEIAAMAISVPRKVSADDVRALLQAAY |
| Ga0307472_1027787362 | 3300032205 | Hardwood Forest Soil | FDRGKIEFVAGEVAGMGITVPRAVSGADVRALLAAAY |
| Ga0306920_1021131641 | 3300032261 | Soil | PQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY |
| Ga0306920_1036947102 | 3300032261 | Soil | IPQKLSDVGFDPARIDFVAGEVAAMAINSPRKVSAADVRALLQSAC |
| Ga0335081_110742102 | 3300032892 | Soil | AIAAMLQKFPIPERLGEIGFATGKIDFVAGEVAAQSIASPRQVTAEDVRELLRAAY |
| Ga0247829_109549591 | 3300033550 | Soil | AEVGFDRAKVDFVSGEVAAMSISAPRKASADDVRAVLAAAY |
| ⦗Top⦘ |