


| Basic Information | |
|---|---|
| Family ID | F068964 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 49 residues |
| Representative Sequence | PRSIQPIVQQSAQFNLVDAKLAGSTPLSAYYDNSYIDEIKRSGWLAELWR |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.16 % |
| % of genes from short scaffolds (< 2000 bps) | 89.52 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.484 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.31% β-sheet: 0.00% Coil/Unstructured: 57.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 20.97 |
| PF01717 | Meth_synt_2 | 8.87 |
| PF03781 | FGE-sulfatase | 3.23 |
| PF08240 | ADH_N | 2.42 |
| PF09084 | NMT1 | 1.61 |
| PF13620 | CarboxypepD_reg | 1.61 |
| PF14076 | DUF4258 | 1.61 |
| PF01850 | PIN | 1.61 |
| PF01061 | ABC2_membrane | 0.81 |
| PF13483 | Lactamase_B_3 | 0.81 |
| PF01494 | FAD_binding_3 | 0.81 |
| PF13379 | NMT1_2 | 0.81 |
| PF00107 | ADH_zinc_N | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF13602 | ADH_zinc_N_2 | 0.81 |
| PF00355 | Rieske | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 8.87 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 3.23 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.61 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.61 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.61 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.81 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.81 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.39 % |
| Unclassified | root | N/A | 1.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_292996_length_1482_cov_7.367746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1514 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2228817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 1003 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1046400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300000956|JGI10216J12902_102210413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1093 | Open in IMG/M |
| 3300000956|JGI10216J12902_104536817 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300003987|Ga0055471_10079822 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300003987|Ga0055471_10147201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300003987|Ga0055471_10290168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300003992|Ga0055470_10075127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300004156|Ga0062589_101757757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 621 | Open in IMG/M |
| 3300004463|Ga0063356_103420508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 684 | Open in IMG/M |
| 3300004463|Ga0063356_104483120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 601 | Open in IMG/M |
| 3300004479|Ga0062595_100478773 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300004633|Ga0066395_10017821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2771 | Open in IMG/M |
| 3300004782|Ga0062382_10049298 | Not Available | 1541 | Open in IMG/M |
| 3300005093|Ga0062594_100719218 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005166|Ga0066674_10045968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1961 | Open in IMG/M |
| 3300005345|Ga0070692_10797750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300005356|Ga0070674_101961456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300005438|Ga0070701_10653591 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005457|Ga0070662_100438581 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005526|Ga0073909_10025012 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300005536|Ga0070697_100074016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2798 | Open in IMG/M |
| 3300005563|Ga0068855_100074728 | All Organisms → cellular organisms → Bacteria | 3935 | Open in IMG/M |
| 3300005577|Ga0068857_100161451 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300005764|Ga0066903_100972580 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300006046|Ga0066652_100105868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2279 | Open in IMG/M |
| 3300006237|Ga0097621_100236214 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300006845|Ga0075421_101248174 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006846|Ga0075430_100266049 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300006854|Ga0075425_101052658 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 927 | Open in IMG/M |
| 3300006854|Ga0075425_102631884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300006903|Ga0075426_10171586 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300006904|Ga0075424_100895372 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300006969|Ga0075419_11403793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300007076|Ga0075435_101741694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300009012|Ga0066710_100272472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2462 | Open in IMG/M |
| 3300009012|Ga0066710_103984038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300009053|Ga0105095_10776259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 536 | Open in IMG/M |
| 3300009087|Ga0105107_10840162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 639 | Open in IMG/M |
| 3300009094|Ga0111539_13038509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300009100|Ga0075418_12980783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300009147|Ga0114129_11924746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300009148|Ga0105243_10817991 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300009148|Ga0105243_12991851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300009162|Ga0075423_12944470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300009176|Ga0105242_12084170 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009553|Ga0105249_11816741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300009609|Ga0105347_1016172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2542 | Open in IMG/M |
| 3300009609|Ga0105347_1153666 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009678|Ga0105252_10227379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300009818|Ga0105072_1004759 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300010048|Ga0126373_13260291 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010329|Ga0134111_10157972 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010359|Ga0126376_12969024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300010360|Ga0126372_11813694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300010362|Ga0126377_12741820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300010375|Ga0105239_11754586 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010400|Ga0134122_12945897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300011430|Ga0137423_1166184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300011434|Ga0137464_1134459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300011434|Ga0137464_1277759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 506 | Open in IMG/M |
| 3300011445|Ga0137427_10239013 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012041|Ga0137430_1024709 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300012199|Ga0137383_10298382 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300012355|Ga0137369_10113310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2205 | Open in IMG/M |
| 3300012362|Ga0137361_10808405 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012509|Ga0157334_1070902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300012924|Ga0137413_10138310 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300012944|Ga0137410_10600942 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300012986|Ga0164304_10736526 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300013297|Ga0157378_11406882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300014154|Ga0134075_10037108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1992 | Open in IMG/M |
| 3300014269|Ga0075302_1091387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiomargarita → Candidatus Thiomargarita nelsonii | 673 | Open in IMG/M |
| 3300014311|Ga0075322_1147039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Pseudorivibacter → Pseudorivibacter rhizosphaerae | 577 | Open in IMG/M |
| 3300014870|Ga0180080_1071744 | Not Available | 597 | Open in IMG/M |
| 3300014874|Ga0180084_1039178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300014878|Ga0180065_1037664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 1018 | Open in IMG/M |
| 3300015242|Ga0137412_10426496 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300015373|Ga0132257_103180680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300017657|Ga0134074_1304715 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017966|Ga0187776_10887461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300018063|Ga0184637_10482776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 723 | Open in IMG/M |
| 3300018077|Ga0184633_10298881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300018081|Ga0184625_10481265 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018084|Ga0184629_10126030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1279 | Open in IMG/M |
| 3300018089|Ga0187774_10028700 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300018422|Ga0190265_10352201 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300018429|Ga0190272_10399080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300018476|Ga0190274_12085300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 664 | Open in IMG/M |
| 3300019997|Ga0193711_1042055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300020021|Ga0193726_1284885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300020186|Ga0163153_10029186 | All Organisms → cellular organisms → Bacteria | 4204 | Open in IMG/M |
| 3300020583|Ga0210401_11550573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300021063|Ga0206227_1096999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300021081|Ga0210379_10047208 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300021081|Ga0210379_10193981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 874 | Open in IMG/M |
| 3300025312|Ga0209321_10545020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 512 | Open in IMG/M |
| 3300025795|Ga0210114_1108822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 560 | Open in IMG/M |
| 3300025935|Ga0207709_10947113 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300026550|Ga0209474_10133112 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300027252|Ga0209973_1063631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300027513|Ga0208685_1103915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300027775|Ga0209177_10194722 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300027840|Ga0209683_10016326 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300027873|Ga0209814_10457064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300028381|Ga0268264_10371246 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300030006|Ga0299907_10264115 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300030006|Ga0299907_10313497 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300031229|Ga0299913_10385440 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300031538|Ga0310888_10361398 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031538|Ga0310888_10515307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 717 | Open in IMG/M |
| 3300031719|Ga0306917_10843910 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031740|Ga0307468_100655761 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300031820|Ga0307473_10546193 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031833|Ga0310917_10421665 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031892|Ga0310893_10567590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031908|Ga0310900_11743650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300032013|Ga0310906_10808838 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300032144|Ga0315910_10627598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 833 | Open in IMG/M |
| 3300033419|Ga0316601_100851283 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300033481|Ga0316600_10962814 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300033513|Ga0316628_100534648 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300033513|Ga0316628_102254678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 721 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.48% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.61% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.61% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_00803690 | 2140918013 | Soil | WQQIDAKLAASTPTSAYYDNSYIEEIKKSGFYAQLWR |
| ICChiseqgaiiDRAFT_22288172 | 3300000033 | Soil | VKDPTVTASSXQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFYAQLWR* |
| AP72_2010_repI_A100DRAFT_10464001 | 3300000837 | Forest Soil | TADSIQPIVQQSAQFNLVDAKLANSTPMTAYYDNSYIDELKRSGWLAELWK* |
| JGI10216J12902_1022104132 | 3300000956 | Soil | QPIVQQAAEWNQIDAKLAASTPTSAYYDNSYIDEIKKSGFFAQLWR* |
| JGI10216J12902_1045368174 | 3300000956 | Soil | QPIVQQAAEWNQIDAKLAASTPTGAYYDNSYIDEIKKSGFFAQLWR* |
| Ga0055471_100798221 | 3300003987 | Natural And Restored Wetlands | QPIVQQSTEFNVVDAKLAASTPISAYYDNSYIDEIKKSGFFTQLWK* |
| Ga0055471_101472012 | 3300003987 | Natural And Restored Wetlands | QPIVQQSTEFNVVDAKLAANTPISAYYDNSYIDEIKKSGFFTQLWK* |
| Ga0055471_102901682 | 3300003987 | Natural And Restored Wetlands | PSSIQPIVQQLIESNLVDTKLANSTPLSAYYDNSYIDEIKKSGFFAQLWR* |
| Ga0055470_100751272 | 3300003992 | Natural And Restored Wetlands | LIEFGLVDPNLASTTPVSAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0062589_1017577572 | 3300004156 | Soil | IQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFYAQLWR* |
| Ga0063356_1034205082 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PIVQQSAQFNIVDAKLAGSTPLSAYYDNSYIDEIKRSGFFAQLWK* |
| Ga0063356_1044831202 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PIVQQSAQFNIVDAKLAGSTPMSAYYDNSYIDEIKKSGFFTQLWK* |
| Ga0062595_1004787731 | 3300004479 | Soil | DPTVTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR* |
| Ga0066395_100178211 | 3300004633 | Tropical Forest Soil | IKDPTVSPASIQPIVQHAVQWNLVDAKAANGTPLTAYYDNSYVEEIKKSGFFAELWK* |
| Ga0062382_100492982 | 3300004782 | Wetland Sediment | VTASSIQPIVQQAAEWNQIDAKLTASTPTGAYYDNSYIDEIKKSGFFAQLWR* |
| Ga0062594_1007192181 | 3300005093 | Soil | PIVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR* |
| Ga0066674_100459681 | 3300005166 | Soil | KDPTISPVSIQPIVQQSAQWNLVDAKLATSTPLSAYYDNSYVEEIKRSGFLSELWR* |
| Ga0070692_107977502 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR* |
| Ga0070674_1019614562 | 3300005356 | Miscanthus Rhizosphere | KDPTVTPGSIRPIVQQSTEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK* |
| Ga0070701_106535911 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | SIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR* |
| Ga0070662_1004385811 | 3300005457 | Corn Rhizosphere | DPTVTPGSIRPIVQQSTEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK* |
| Ga0073909_100250123 | 3300005526 | Surface Soil | IFVKDPTVTPGSIQPILQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR* |
| Ga0070697_1000740163 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DPTVSPASIQPIVQHAVQWNLVDAKAANSTPLTAYYDNSYVEEIKKSGFFTELWK* |
| Ga0068855_1000747286 | 3300005563 | Corn Rhizosphere | EFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK* |
| Ga0068857_1001614511 | 3300005577 | Corn Rhizosphere | ATDIFVKDPTVTPGSIRPIVQQSAEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK* |
| Ga0066903_1009725803 | 3300005764 | Tropical Forest Soil | FVKDPTVTPDSIQPIVQQSAQFNLVDAKLANSTPMTAYYDNSYIEELKRSGWLAELWK* |
| Ga0066652_1001058683 | 3300006046 | Soil | YVKDPTVSPVSIQPIVQQSAQWNLVDAKLASSTPLSAYYDNSYVEEIKRSGFLSELWR* |
| Ga0097621_1002362143 | 3300006237 | Miscanthus Rhizosphere | VTPGSIRPIVQQSTEFNLIDAQLAANTPVSAYYDNSYVEEIKRSRWLAELWK* |
| Ga0075421_1012481741 | 3300006845 | Populus Rhizosphere | IFVKDPTVTPGSIRPIIQQSTEFNLIDAKLAATTAVSAYYDNSYVEEIKRSGWLADLWK* |
| Ga0075430_1002660492 | 3300006846 | Populus Rhizosphere | SASIQPIVQQSAQFNLVDAKLAGSTPIAAYYDNSYVDEIKKSGWLADLWR* |
| Ga0075425_1010526581 | 3300006854 | Populus Rhizosphere | QFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK* |
| Ga0075425_1026318842 | 3300006854 | Populus Rhizosphere | LDVFVKDPTVSPSSIQPIVQHAVQWNLVDAKVANSTPLAAFYDNSYVEEIKRSGFFAELWK* |
| Ga0075426_101715861 | 3300006903 | Populus Rhizosphere | TPGSIRPIVQQSTEFNLIDAKLAATTPASAYYDNSYVDEIKRSGWLAELWR* |
| Ga0075424_1008953722 | 3300006904 | Populus Rhizosphere | VQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR* |
| Ga0075419_114037932 | 3300006969 | Populus Rhizosphere | SAQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK* |
| Ga0075435_1017416942 | 3300007076 | Populus Rhizosphere | IVQQSTEFNLIDAQLAANTPVSAYYDNSYVEEIKRSRWLAELWK* |
| Ga0066710_1002724721 | 3300009012 | Grasslands Soil | QFNLVDAKLAGSTPLSAYYDNSYIDEIKRSGWLAELWR |
| Ga0066710_1039840382 | 3300009012 | Grasslands Soil | VFIKDPTVTAASIQPIVQQSAQFNLVDAKLANSTPLTAYYDNSYVEELKRSGWLAELWK |
| Ga0105095_107762592 | 3300009053 | Freshwater Sediment | VKDPAVTPGSIQPIVQQSAQFNLIDAKLAATTPVSAYYDNSYVDEIKKSGFFTQLWK* |
| Ga0105107_108401621 | 3300009087 | Freshwater Sediment | DPAVTPGSIQPIVQQSAQFNLVDAKLAASTPVSAYYDNSYVDEIKKSGFFAQLWK* |
| Ga0111539_130385091 | 3300009094 | Populus Rhizosphere | TEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR* |
| Ga0075418_129807831 | 3300009100 | Populus Rhizosphere | DPTVTSASIQPIVQQSAQFNLVDAKLAGSTPIAAYYDNSYVDEIKKSGWLADLWR* |
| Ga0114129_119247461 | 3300009147 | Populus Rhizosphere | PRSIQPIVQQSAQFNLVDAKLAGSTPLSAYYDNSYIDEIKRSGWLAELWR* |
| Ga0105243_108179912 | 3300009148 | Miscanthus Rhizosphere | IVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR* |
| Ga0105243_129918512 | 3300009148 | Miscanthus Rhizosphere | TVTAGSIRPIVQQSTEFNLIDAKLAANTPVSAYYDNSYVEEIKRSGWLAELWK* |
| Ga0075423_129444702 | 3300009162 | Populus Rhizosphere | VTADSIQPIVQQSAQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK* |
| Ga0105242_120841702 | 3300009176 | Miscanthus Rhizosphere | IQPIVQQAAEWNQIDAKQAAATLVSTYYDNSYIDEIKKSGFFAQLWR* |
| Ga0105249_118167412 | 3300009553 | Switchgrass Rhizosphere | FVKDPTVTPDSIRPIVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR* |
| Ga0105347_10161721 | 3300009609 | Soil | QIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0105347_11536661 | 3300009609 | Soil | KDPTVNASSIQPIVQQAAEWNQIDAKMAASTPTSAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0105252_102273791 | 3300009678 | Soil | QAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0105072_10047591 | 3300009818 | Groundwater Sand | QSAQFNLVDAKLANSTPLTAYYDNSYVDELKRSGWLAELWK* |
| Ga0126373_132602911 | 3300010048 | Tropical Forest Soil | DPTVSFASIQPIVQHAVQWNLVDAKAANSTPLTAYYDNSYVEEIKRSGFFAELWK* |
| Ga0134111_101579721 | 3300010329 | Grasslands Soil | WNLVDAKLASSTPLSAYYDNSYVEEIKRSGFLSELWR* |
| Ga0126376_129690241 | 3300010359 | Tropical Forest Soil | TEFNLIDAKLSATTPVSAYYDNSYVEEIKRSGWLAELWK* |
| Ga0126372_118136941 | 3300010360 | Tropical Forest Soil | PSSIQPIVQQSAQWNLIDAKLASSTPLSAYYDNSYVDEINLSGFFSELWK* |
| Ga0126377_127418202 | 3300010362 | Tropical Forest Soil | VDAKMAHTTPMTAYYDNTYVEELKRSGWLAELWK* |
| Ga0105239_117545861 | 3300010375 | Corn Rhizosphere | STEFNLIDAQLAANTPVSAYYDNSYVEEIKRSRWLAELWK* |
| Ga0134122_129458972 | 3300010400 | Terrestrial Soil | TAQSIQPIVQQSAQFNLVDAKLAANTPLSAYYDNSYIDEIKKSGFFSQLWK* |
| Ga0137423_11661841 | 3300011430 | Soil | VTASSIQPIVQQAAEWQQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0137464_11344591 | 3300011434 | Soil | PIVQQAAEWQQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0137464_12777592 | 3300011434 | Soil | NSIQPIVQQSAQFNLIDTKLANATPMSAYYDNIYIDEIKRSGWLAELWR* |
| Ga0137427_102390133 | 3300011445 | Soil | SIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0137430_10247092 | 3300012041 | Soil | KDPTVTASSIQPIVQQAAEWNQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0137383_102983822 | 3300012199 | Vadose Zone Soil | VDAKLAGGTPTSDYSDNSYVEEIKRAGWLAELWR* |
| Ga0137369_101133103 | 3300012355 | Vadose Zone Soil | FLVDTKLAGSMPLSAYYDNSFVEEIKRSGWLAELWR* |
| Ga0137361_108084051 | 3300012362 | Vadose Zone Soil | ADSIQPIVQQSVQFNLVDAKAASSVPLSAYYDNSYVEELKRSGWLAELWK* |
| Ga0157334_10709021 | 3300012509 | Soil | DIFVKDPTVTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR |
| Ga0137413_101383101 | 3300012924 | Vadose Zone Soil | FNLVDAKLAGNTPIAAYYDNSYVDEIKKSGWLADLWR* |
| Ga0137410_106009421 | 3300012944 | Vadose Zone Soil | LDVFVKDPTVTPGSIQPIVQQSAQFNLIDAKLAGSTPIGAYYDNSYVDEIKRTGWLADLWR* |
| Ga0164304_107365261 | 3300012986 | Soil | TVTPDSIRPIVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR* |
| Ga0157378_114068822 | 3300013297 | Miscanthus Rhizosphere | VQQSTEFNLIDAKLAANTPVSAYYDNSYVEEIKRSGWLAELWK* |
| Ga0134075_100371083 | 3300014154 | Grasslands Soil | LEVYVKDPTVSPVSIQPIVQQSAQWNLVDAKLATSTPLSAYYDNSYVEEIKRSGFLSELWR* |
| Ga0075302_10913872 | 3300014269 | Natural And Restored Wetlands | PIVQQSAQFNLVDTKLANATPMSAYYDNSYVEEIKRSGWLAELWR* |
| Ga0075322_11470391 | 3300014311 | Natural And Restored Wetlands | SIQPVVQQLIESNLIDSKIAGATPVSAYYDDSYIAVIKKSGFYAQLWPRS* |
| Ga0180080_10717441 | 3300014870 | Soil | IDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR* |
| Ga0180084_10391781 | 3300014874 | Soil | QSAQWNLIDAKAANSTPLSAYYDNSYVDEIKQSGFLAELWR* |
| Ga0180065_10376641 | 3300014878 | Soil | PTVTPGSIQPIVQQSAQWNLIDAKAANSTPLSAYYDNSYVDEIKRSGFLAELWK* |
| Ga0137412_104264962 | 3300015242 | Vadose Zone Soil | AHALVDAKLAGNTPIGAYYDNSYVDEIKRAGWLADLWR* |
| Ga0132257_1031806801 | 3300015373 | Arabidopsis Rhizosphere | TVTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR* |
| Ga0134074_13047152 | 3300017657 | Grasslands Soil | VSIQPIVQQSAQWNLVDAKLASSTPLSAYYDNTYVEEIKRSGFLSELWR |
| Ga0187776_108874611 | 3300017966 | Tropical Peatland | KDPTVTPSSIQPIVQQSAQFNLIDVKLANSTPLSAYYDNSYIEEIKKSGFFAQLWR |
| Ga0184637_104827761 | 3300018063 | Groundwater Sediment | PIVQQSAQFNLIDAKLANNTPLSAYYDNNYIEEIKRSGWLAELWR |
| Ga0184633_102988812 | 3300018077 | Groundwater Sediment | RFALDIYVKDPTVTASSIQPIIQQAAEWNQIDAKLASATPTSAYYDNSYIEEIKKSGFFAQLWR |
| Ga0184625_104812652 | 3300018081 | Groundwater Sediment | DSIQPIVQQSAQFNLVDVKLATSTPMTAYYDNSYVEELKRSGWLAELWK |
| Ga0184629_101260301 | 3300018084 | Groundwater Sediment | PIVQQSAQFNLIDTKLANATPMSAYYDNSYVDEIKRSGWLAELWR |
| Ga0187774_100287001 | 3300018089 | Tropical Peatland | IQPIVQQSAQFNLIDVKLANSTPLSAYYDNSYIDEIKRSGWLAELWR |
| Ga0190265_103522013 | 3300018422 | Soil | FNLIDAKLAATTPVSAYYDNSYVDEIKKSGFFTQLWK |
| Ga0190272_103990803 | 3300018429 | Soil | VQQAAEWNQIDAKLAASTPTSAYYDNSFIDEIKKSGFFAQLWK |
| Ga0190274_120853001 | 3300018476 | Soil | QQSAQFNLVEAKLASNTPMSAYYDNSYVDDLKRSGWLAELWR |
| Ga0193711_10420551 | 3300019997 | Soil | FNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR |
| Ga0193726_12848851 | 3300020021 | Soil | FALDIFVKDPTVTAQSIQPIVQQSAQFNLVDAKLAANTPLSAYYDNSYIDAIKKSGFFSQLWK |
| Ga0163153_100291865 | 3300020186 | Freshwater Microbial Mat | VTASSIQPIVQQAAEWNQIDAKLAASTQTSAYYDNSYIEEIKKSGFFAQLWR |
| Ga0210401_115505731 | 3300020583 | Soil | SIQPIVQHAVQWNLVEAKAANSTPMSAYYDNSYVEEIKKSGFFTELWK |
| Ga0206227_10969992 | 3300021063 | Deep Subsurface Sediment | IQPIVQQSAQFNLVDAKLAGSTPITAYFDNSYVDEIKRTGWLTELWR |
| Ga0210379_100472083 | 3300021081 | Groundwater Sediment | AQFNLVDGKLANSTPMTAYYDNSYVEELKRSGWLAELWK |
| Ga0210379_101939812 | 3300021081 | Groundwater Sediment | VTPGSIQPIVQQSAQWNLIDAKAANSTPLSAYYDNSYVDEIKRSGFLAELWK |
| Ga0209321_105450201 | 3300025312 | Soil | YVKDPTVTPSSIQPIVQQLVESGLIDAKLANTTPLSAYYDNSYIDEIKRSGFFAQLWK |
| Ga0210114_11088221 | 3300025795 | Natural And Restored Wetlands | FLLSASAYAAPASIQPIVQQSAHWHLIDVKAAGATRLSAYCDNSYVDEIKRSGFLAELWK |
| Ga0207709_109471131 | 3300025935 | Miscanthus Rhizosphere | VTPGSIRPIVQQSAEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK |
| Ga0209474_101331123 | 3300026550 | Soil | QWNLVDAKLASSTPLSAYYDNSYVEEIKRSGFLSELWR |
| Ga0209973_10636311 | 3300027252 | Arabidopsis Thaliana Rhizosphere | PIVQQSAEFNVVDAKLASNTPIGAYYDNSYIEEIKKSGFFTQLWK |
| Ga0208685_11039152 | 3300027513 | Soil | LDIYVKDPTVTASSIQPIVQQAAEWQQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLW |
| Ga0209177_101947222 | 3300027775 | Agricultural Soil | PTVTSDSIRPIVQQSTEFNLIDAKLAANTPMSAYYDNSYVEEIKRSGWLAELWK |
| Ga0209683_100163263 | 3300027840 | Wetland Sediment | VTASSIQPIVQQAAEWNQIDAKLTASTPTGAYYDNSYIDEIKKSGFFAQLWR |
| Ga0209814_104570642 | 3300027873 | Populus Rhizosphere | AQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK |
| Ga0268264_103712461 | 3300028381 | Switchgrass Rhizosphere | IQPIVQQSAQFNLVDARLAGSTPIGAYYDNSYVDEIKRAGWLADLWR |
| Ga0299907_102641151 | 3300030006 | Soil | DIYVKDPTVTPSSIQPIVQQLVESGLIDAKLANTTPLSAYYDNSYIDEIKRSGFFAQLWK |
| Ga0299907_103134972 | 3300030006 | Soil | IFVKDPTVTLGSIQPIVQQSAQWNLIDAKAAVATPLSAYYDNSYVDEIKRSGFLAELWK |
| Ga0299913_103854401 | 3300031229 | Soil | ALDIFVKDPTVTAGSIQPIVQQSAQWNLIDAKAAVATPLSAYYDNSYVDEIKRSGFLAELWK |
| Ga0310888_103613982 | 3300031538 | Soil | IRPIVQQSTEFNLIDAKLAANTPVSAYYDNSYVEEIKRSGWLAELWK |
| Ga0310888_105153072 | 3300031538 | Soil | AAEWQQIDAKLAASTPTSAYCDNSYIEEIKKSGFFPQIWR |
| Ga0306917_108439102 | 3300031719 | Soil | DVFVRDPTVTPNSIQPIVHQSVQFNLVDAKVANSTPLTAYYDNSYVEELKRSGWLAELWK |
| Ga0307468_1006557611 | 3300031740 | Hardwood Forest Soil | TPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR |
| Ga0307473_105461932 | 3300031820 | Hardwood Forest Soil | VFIKDPTVSPASIQPIVQHAVQWNLVDAKAANSTPLTAYYDNSYVEEIKKSGFFTELWK |
| Ga0310917_104216651 | 3300031833 | Soil | VTPGSIRPIVQQSTEFNLIDSKLAGNTPVSAYYDNSYIEEIKRSGWLAELWR |
| Ga0310893_105675902 | 3300031892 | Soil | PASIQPIVQQSAQFNLIDAKLAGNTPIGAYYDNSYVDEIKRSGWLADLWR |
| Ga0310900_117436501 | 3300031908 | Soil | SAQFNLVDAKLVNSTPLTAYYDNSYVDELKRSGWLAELWK |
| Ga0310906_108088382 | 3300032013 | Soil | IVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR |
| Ga0315910_106275981 | 3300032144 | Soil | IVDAKTAGNTPMSAYYDNSYIEEIKKSGFFAQLWK |
| Ga0316601_1008512833 | 3300033419 | Soil | TVTASSIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR |
| Ga0316600_109628141 | 3300033481 | Soil | KAPTVTASSIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR |
| Ga0316628_1005346481 | 3300033513 | Soil | LIESNLVDAKLANATPLSAYYDNSYIEEIKKSGFFAQLWR |
| Ga0316628_1022546782 | 3300033513 | Soil | QLIESNLVDTKLANSTPLSAYYDNSYIEEIKKSGFFAQLWR |
| ⦗Top⦘ |