


| Basic Information | |
|---|---|
| Family ID | F068691 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 90.32 % |
| % of genes from short scaffolds (< 2000 bps) | 83.06 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.097 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.774 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.710 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 21.77 |
| PF13428 | TPR_14 | 12.90 |
| PF10009 | DUF2252 | 5.65 |
| PF13432 | TPR_16 | 4.03 |
| PF00892 | EamA | 4.03 |
| PF12681 | Glyoxalase_2 | 4.03 |
| PF07883 | Cupin_2 | 4.03 |
| PF14485 | DUF4431 | 1.61 |
| PF13416 | SBP_bac_8 | 1.61 |
| PF07719 | TPR_2 | 1.61 |
| PF04095 | NAPRTase | 1.61 |
| PF00497 | SBP_bac_3 | 0.81 |
| PF00860 | Xan_ur_permease | 0.81 |
| PF00873 | ACR_tran | 0.81 |
| PF03797 | Autotransporter | 0.81 |
| PF09976 | TPR_21 | 0.81 |
| PF11319 | VasI | 0.81 |
| PF09929 | DUF2161 | 0.81 |
| PF00144 | Beta-lactamase | 0.81 |
| PF13414 | TPR_11 | 0.81 |
| PF13181 | TPR_8 | 0.81 |
| PF12276 | DUF3617 | 0.81 |
| PF00561 | Abhydrolase_1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 1.61 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.81 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.10 % |
| Unclassified | root | N/A | 37.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02IVXSN | Not Available | 508 | Open in IMG/M |
| 3300002568|C688J35102_119830867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300005171|Ga0066677_10182126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300005175|Ga0066673_10272557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
| 3300005181|Ga0066678_10016542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3761 | Open in IMG/M |
| 3300005557|Ga0066704_10285074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1119 | Open in IMG/M |
| 3300005561|Ga0066699_10960382 | Not Available | 594 | Open in IMG/M |
| 3300005564|Ga0070664_102165040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 528 | Open in IMG/M |
| 3300005614|Ga0068856_101683725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300006038|Ga0075365_10078557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300006057|Ga0075026_100814612 | Not Available | 567 | Open in IMG/M |
| 3300006755|Ga0079222_12405609 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006845|Ga0075421_102500679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300006846|Ga0075430_101643675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300006903|Ga0075426_10704897 | Not Available | 757 | Open in IMG/M |
| 3300009094|Ga0111539_12900805 | Not Available | 555 | Open in IMG/M |
| 3300009147|Ga0114129_10034311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7165 | Open in IMG/M |
| 3300009147|Ga0114129_10703162 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300010043|Ga0126380_10874917 | Not Available | 744 | Open in IMG/M |
| 3300010043|Ga0126380_11831185 | Not Available | 550 | Open in IMG/M |
| 3300010048|Ga0126373_13316586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300010337|Ga0134062_10324103 | Not Available | 735 | Open in IMG/M |
| 3300010358|Ga0126370_10495661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
| 3300010360|Ga0126372_12201923 | Not Available | 600 | Open in IMG/M |
| 3300010362|Ga0126377_12007363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300010362|Ga0126377_13248978 | Not Available | 525 | Open in IMG/M |
| 3300010366|Ga0126379_11364430 | Not Available | 815 | Open in IMG/M |
| 3300010366|Ga0126379_12126398 | Not Available | 663 | Open in IMG/M |
| 3300010366|Ga0126379_13784979 | Not Available | 507 | Open in IMG/M |
| 3300010398|Ga0126383_10381423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1440 | Open in IMG/M |
| 3300010398|Ga0126383_10903943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300010398|Ga0126383_12710578 | Not Available | 578 | Open in IMG/M |
| 3300010400|Ga0134122_12084108 | Not Available | 608 | Open in IMG/M |
| 3300011119|Ga0105246_11476285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 637 | Open in IMG/M |
| 3300011269|Ga0137392_10943715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300012199|Ga0137383_11051734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300012200|Ga0137382_10340602 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300012200|Ga0137382_10517986 | Not Available | 848 | Open in IMG/M |
| 3300012204|Ga0137374_10358080 | Not Available | 1174 | Open in IMG/M |
| 3300012358|Ga0137368_10729819 | Not Available | 620 | Open in IMG/M |
| 3300012359|Ga0137385_10024209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5437 | Open in IMG/M |
| 3300012362|Ga0137361_10201998 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300012892|Ga0157294_10255292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300012914|Ga0157297_10156027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300012923|Ga0137359_10048689 | All Organisms → cellular organisms → Bacteria | 3684 | Open in IMG/M |
| 3300012930|Ga0137407_12187011 | Not Available | 528 | Open in IMG/M |
| 3300012930|Ga0137407_12320051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300012955|Ga0164298_10925224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300012986|Ga0164304_10049202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2286 | Open in IMG/M |
| 3300013297|Ga0157378_10196062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1907 | Open in IMG/M |
| 3300013308|Ga0157375_12274975 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300013500|Ga0120195_1004960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300015200|Ga0173480_10499871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300015373|Ga0132257_103959903 | Not Available | 539 | Open in IMG/M |
| 3300015374|Ga0132255_104741628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300016294|Ga0182041_10932314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300016404|Ga0182037_12165909 | Not Available | 500 | Open in IMG/M |
| 3300018082|Ga0184639_10120899 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300020579|Ga0210407_10399778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1075 | Open in IMG/M |
| 3300021078|Ga0210381_10350040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 540 | Open in IMG/M |
| 3300021170|Ga0210400_10496853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300021358|Ga0213873_10149077 | Not Available | 703 | Open in IMG/M |
| 3300021372|Ga0213877_10125787 | Not Available | 796 | Open in IMG/M |
| 3300025315|Ga0207697_10273213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300025898|Ga0207692_10924880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 574 | Open in IMG/M |
| 3300025918|Ga0207662_11163099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 548 | Open in IMG/M |
| 3300025930|Ga0207701_11182912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300025932|Ga0207690_11001961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300025937|Ga0207669_10425366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300025939|Ga0207665_11459086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300026326|Ga0209801_1095971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1286 | Open in IMG/M |
| 3300026332|Ga0209803_1239818 | Not Available | 630 | Open in IMG/M |
| 3300026469|Ga0257169_1069323 | Not Available | 569 | Open in IMG/M |
| 3300026552|Ga0209577_10352912 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300026557|Ga0179587_10970069 | Not Available | 560 | Open in IMG/M |
| 3300026708|Ga0208712_103409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora radicis | 601 | Open in IMG/M |
| 3300027546|Ga0208984_1048091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300027846|Ga0209180_10238049 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300027866|Ga0209813_10377166 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027874|Ga0209465_10158171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300028754|Ga0307297_10193084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300028778|Ga0307288_10440162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 534 | Open in IMG/M |
| 3300028814|Ga0307302_10359390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300031446|Ga0170820_10021175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300031544|Ga0318534_10852836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300031545|Ga0318541_10052143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2103 | Open in IMG/M |
| 3300031545|Ga0318541_10217592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
| 3300031549|Ga0318571_10069286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
| 3300031668|Ga0318542_10420635 | Not Available | 691 | Open in IMG/M |
| 3300031682|Ga0318560_10720869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031744|Ga0306918_10377608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1102 | Open in IMG/M |
| 3300031751|Ga0318494_10193704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1156 | Open in IMG/M |
| 3300031765|Ga0318554_10141594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1363 | Open in IMG/M |
| 3300031769|Ga0318526_10352925 | Not Available | 601 | Open in IMG/M |
| 3300031779|Ga0318566_10424820 | Not Available | 653 | Open in IMG/M |
| 3300031796|Ga0318576_10110899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
| 3300031797|Ga0318550_10184281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1008 | Open in IMG/M |
| 3300031859|Ga0318527_10074322 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300031890|Ga0306925_10090710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3244 | Open in IMG/M |
| 3300031896|Ga0318551_10527217 | Not Available | 678 | Open in IMG/M |
| 3300031897|Ga0318520_10579757 | Not Available | 696 | Open in IMG/M |
| 3300031912|Ga0306921_10083851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3673 | Open in IMG/M |
| 3300031981|Ga0318531_10027575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2311 | Open in IMG/M |
| 3300031981|Ga0318531_10595938 | Not Available | 501 | Open in IMG/M |
| 3300032000|Ga0310903_10264140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300032064|Ga0318510_10462477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300032065|Ga0318513_10641704 | Not Available | 520 | Open in IMG/M |
| 3300032180|Ga0307471_101739821 | Not Available | 776 | Open in IMG/M |
| 3300033289|Ga0310914_10257650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300033289|Ga0310914_11124888 | Not Available | 686 | Open in IMG/M |
| 3300033290|Ga0318519_10604025 | Not Available | 666 | Open in IMG/M |
| 3300034417|Ga0364941_212186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 505 | Open in IMG/M |
| 3300034690|Ga0364923_0086425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026708 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN628 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_01670330 | 2170459003 | Grass Soil | RGASETVTAKVRAASPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| C688J35102_1198308672 | 3300002568 | Soil | VTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0066677_101821261 | 3300005171 | Soil | GTLQLNRDASERVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0066673_102725573 | 3300005175 | Soil | KKFKGTLQLNRDASERVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0066678_100165424 | 3300005181 | Soil | ETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0070714_1008650301 | 3300005435 | Agricultural Soil | AELVRAKIRSANSQEEGGLLKAFLGFVDRHFGDQVATITIHYH* |
| Ga0066704_102850743 | 3300005557 | Soil | AKVRASTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0066699_109603822 | 3300005561 | Soil | TLQLNRDASERVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0070664_1021650402 | 3300005564 | Corn Rhizosphere | LKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0068856_1016837252 | 3300005614 | Corn Rhizosphere | AKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0070702_1005755642 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VTARIRSSQPEDERRLLNSFLGFVDRQCGDQVLSITIHYG* |
| Ga0075365_100785572 | 3300006038 | Populus Endosphere | GSVDLKRGESEVVTAQVRAANPEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0075026_1008146122 | 3300006057 | Watersheds | SETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0079222_124056091 | 3300006755 | Agricultural Soil | EVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0075421_1025006791 | 3300006845 | Populus Rhizosphere | AATPEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0075430_1016436752 | 3300006846 | Populus Rhizosphere | GAAEAVTAKVRAATPEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0075426_107048971 | 3300006903 | Populus Rhizosphere | KKFKGSLELNRGVSEAVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTSITIHYR* |
| Ga0111539_129008051 | 3300009094 | Populus Rhizosphere | KGSLELNRGVSEAVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTSITIHYR* |
| Ga0114129_100343115 | 3300009147 | Populus Rhizosphere | KKFKGTLDLSRGDSEGVTAKVRAPTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0114129_107031623 | 3300009147 | Populus Rhizosphere | ASETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0105249_107335591 | 3300009553 | Switchgrass Rhizosphere | PAEAVTARIRSSQPEDERRLLNSFLGFVDRQCGDQVLSITIHYG* |
| Ga0126380_108749171 | 3300010043 | Tropical Forest Soil | AATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0126380_118311851 | 3300010043 | Tropical Forest Soil | ASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0126373_133165861 | 3300010048 | Tropical Forest Soil | CIRAAAPEAERRLLSSFLGFVDRHSKDQVATITIHYR* |
| Ga0134062_103241033 | 3300010337 | Grasslands Soil | VRASTPEDDRKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0126370_104956611 | 3300010358 | Tropical Forest Soil | TARIRAAAPEAERRLLSSFLGFVDRHSKDQVATITIHYR* |
| Ga0126372_122019232 | 3300010360 | Tropical Forest Soil | FKGTLQLSRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0126377_120073631 | 3300010362 | Tropical Forest Soil | VVTAQVRAANPEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0126377_132489782 | 3300010362 | Tropical Forest Soil | GASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0126379_113644301 | 3300010366 | Tropical Forest Soil | QLNRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0126379_121263982 | 3300010366 | Tropical Forest Soil | LQLNRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0126379_137849791 | 3300010366 | Tropical Forest Soil | KFKGTLQLNRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0126383_103814233 | 3300010398 | Tropical Forest Soil | TAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0126383_109039431 | 3300010398 | Tropical Forest Soil | SRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0126383_127105782 | 3300010398 | Tropical Forest Soil | ELKRGASEAVAAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0134122_120841082 | 3300010400 | Terrestrial Soil | LNRGVSEAVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTSITIHYR* |
| Ga0105246_114762852 | 3300011119 | Miscanthus Rhizosphere | SVRLKREPSEVVIANIRSPTPEDERKLLSSFLGFVDRHSGDQVTTITIHYR* |
| Ga0137392_109437151 | 3300011269 | Vadose Zone Soil | IVTARIRATTPEGERRLLSSFLGFVDRHSEDQVATITIHYR* |
| Ga0137388_110051001 | 3300012189 | Vadose Zone Soil | NLKRGPADVVTAKVRSSQPEDERRLLNSFLGFVDRQCGDQVLSITIHYG* |
| Ga0137383_110517341 | 3300012199 | Vadose Zone Soil | GPSEVVTARIRATTPEEERRLLSSFLGFVDRNSEDQVATITIHYE* |
| Ga0137382_103406021 | 3300012200 | Vadose Zone Soil | RGAAETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITVHYH* |
| Ga0137382_105179861 | 3300012200 | Vadose Zone Soil | VTAKVRATTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0137374_103580801 | 3300012204 | Vadose Zone Soil | TLELARGDSDAVTAKVRATTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0137369_102463622 | 3300012355 | Vadose Zone Soil | TAKIRSTQSESERRLLNSFLGFVDRHCGTDVASITIHYR* |
| Ga0137368_107298191 | 3300012358 | Vadose Zone Soil | GTLDLARGDSDAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0137385_100242091 | 3300012359 | Vadose Zone Soil | KVRASTPEDERKLLSSFLGFVDCHAGDQVTTITIHYR* |
| Ga0137361_102019982 | 3300012362 | Vadose Zone Soil | NYAGSVQLERGDSETVVAKVRAAAPEDERKLLSSFLGFVDRHAGDQVLRITIEYR* |
| Ga0137390_113788301 | 3300012363 | Vadose Zone Soil | KVSSRTAEDEGGLLKAFLGFVDRHFGNQVATITIHYH* |
| Ga0157294_102552922 | 3300012892 | Soil | AASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0157297_101560272 | 3300012914 | Soil | LKRGASEVVTARVRATTPEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0137359_100486894 | 3300012923 | Vadose Zone Soil | VRAAAPEDERKLLSSFLGFVDRHAGDQVLRITIEYR* |
| Ga0137407_121870112 | 3300012930 | Vadose Zone Soil | KRGTSEAVTARVRAPTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0137407_123200511 | 3300012930 | Vadose Zone Soil | KHKKFKGTLELARGDSDAVTAKVRATTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0164298_109252241 | 3300012955 | Soil | TAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0164304_100492021 | 3300012986 | Soil | QATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0157378_101960622 | 3300013297 | Miscanthus Rhizosphere | VQLKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0157375_122749752 | 3300013308 | Miscanthus Rhizosphere | KVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0120195_10049601 | 3300013500 | Terrestrial | LNRGASDTVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR* |
| Ga0173480_104998711 | 3300015200 | Soil | QLKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR* |
| Ga0132257_1039599031 | 3300015373 | Arabidopsis Rhizosphere | KVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH* |
| Ga0132255_1047416282 | 3300015374 | Arabidopsis Rhizosphere | IRAAAPEAERRLLSSFLGFVDRHSDDKVATITIHYR* |
| Ga0182041_109323143 | 3300016294 | Soil | REPQEVVSAKIRAATPEDERKLLSSFLGFVDRHSKDQIATITIHYR |
| Ga0182033_118526722 | 3300016319 | Soil | LADLVTAKIRSSQSESERRLLASFLGFVDRHCGDDVSTIMIQYK |
| Ga0182037_121659091 | 3300016404 | Soil | QLSRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0184639_101208992 | 3300018082 | Groundwater Sediment | VQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0187770_105603001 | 3300018090 | Tropical Peatland | GADMVKAKIRSGTSQDEGGLLKAFLGLVDRHFGEKVATITIHYH |
| Ga0210407_103997783 | 3300020579 | Soil | SEAVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTSITIHYR |
| Ga0210381_103500401 | 3300021078 | Groundwater Sediment | VVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0210400_104968533 | 3300021170 | Soil | KVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0213873_101490772 | 3300021358 | Rhizosphere | LQLNRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0213877_101257871 | 3300021372 | Bulk Soil | NRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0207697_102732131 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | TAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0207692_109248801 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0207662_111630991 | 3300025918 | Switchgrass Rhizosphere | RGSVQLKRGASEVVTARVRATTPEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0207701_111829121 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0207690_110019611 | 3300025932 | Corn Rhizosphere | RAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0207669_104253661 | 3300025937 | Miscanthus Rhizosphere | ASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0207665_114590861 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VQLKRGPSEVISARIRAGTPEDERKLLSSFLGFLDRHSKGQVATITIH |
| Ga0209801_10959711 | 3300026326 | Soil | RDASERVTAKVRASTPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0209803_12398182 | 3300026332 | Soil | SETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0257169_10693232 | 3300026469 | Soil | YTGSVELKRGAAETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0209577_103529123 | 3300026552 | Soil | GASETVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0179587_109700691 | 3300026557 | Vadose Zone Soil | GTLQLKRGTAEGVTAKDRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0208712_1034091 | 3300026708 | Soil | EAVTARVRAATPEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0208984_10480912 | 3300027546 | Forest Soil | GSVQLKRGASEVVTARVRATTPEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0209180_102380491 | 3300027846 | Vadose Zone Soil | AVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0209813_103771661 | 3300027866 | Populus Endosphere | VQLKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0209465_101581711 | 3300027874 | Tropical Forest Soil | RAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0307297_101930841 | 3300028754 | Soil | KVRATTPEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0307288_104401622 | 3300028778 | Soil | EVVTAKVRATTPEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0307302_103593901 | 3300028814 | Soil | GPSEVVTAKVRATTPEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0170820_100211751 | 3300031446 | Forest Soil | VQLKRGASEVVTAKVRATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0318534_108528362 | 3300031544 | Soil | SEVVTARVRAPTPEEERRLLSSFLGFVDRHSGDHVDTVTIQYR |
| Ga0318541_100521431 | 3300031545 | Soil | LQLNRGESEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318541_102175923 | 3300031545 | Soil | RGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318571_100692863 | 3300031549 | Soil | EAVTARVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318542_104206352 | 3300031668 | Soil | AKVRAPSPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0318560_107208691 | 3300031682 | Soil | SEVVTAKVRAPTPEEERRLLSSFLGFVDRHSGDEVDTVTIQYR |
| Ga0306918_103776083 | 3300031744 | Soil | GASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318494_101937043 | 3300031751 | Soil | AKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318554_101415943 | 3300031765 | Soil | GALQLSRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0318526_103529252 | 3300031769 | Soil | TLQLSRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318566_104248201 | 3300031779 | Soil | TLQLNRGESEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318576_101108991 | 3300031796 | Soil | TAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318550_101842813 | 3300031797 | Soil | KGTLQLNRGESEAVTAKVRAATPEGERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318527_100743223 | 3300031859 | Soil | SVQLSRGQSEVVTAKVRAPTPEEERRLLSSFLGFVDRHSGDEVDTVTIQYR |
| Ga0306925_100907105 | 3300031890 | Soil | VRAATPEGERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318551_105272172 | 3300031896 | Soil | FKGTLQLNRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318520_105797571 | 3300031897 | Soil | VRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0306921_100838511 | 3300031912 | Soil | VTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0310912_113375891 | 3300031941 | Soil | SLTREDADMVKAKIRSGTSQDEGGLLKAFLGFVDRHFGEKVATITIHYH |
| Ga0318531_100275751 | 3300031981 | Soil | LQLSRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0318531_105959381 | 3300031981 | Soil | KGSLALSRDASEAVTAKVRAPSPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0310903_102641401 | 3300032000 | Soil | NYRGSVQLKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR |
| Ga0318510_104624772 | 3300032064 | Soil | MYRGSVQLSRGQSEVVTAKVRAPTPEEERRLLSSFLGFVDRHSGDHVDTVTIQYR |
| Ga0318513_106417041 | 3300032065 | Soil | KGTLQLNRGESEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0307471_1017398211 | 3300032180 | Hardwood Forest Soil | LQLKRGDSEAVTAKVRAATAEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0310914_102576501 | 3300033289 | Soil | EAVTAKVRAPSPEDERKLLSSFLGFVDRHAGDQVTTITIHYR |
| Ga0310914_107430201 | 3300033289 | Soil | GDAELVRAKVNSRTAEDEGGLLKAFLGFVDRHFGDQVATITIHYH |
| Ga0310914_111248882 | 3300033289 | Soil | ASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0318519_106040252 | 3300033290 | Soil | FKGTLQLSRGASEAVTAKVRAATPEDERKLLSSFLGFVDRHAGDQVTTITIHYH |
| Ga0364943_0220511_575_697 | 3300034354 | Sediment | VTAKIRSSVREDERRLLNSFLGFVDRQCGEQVLSITIHYG |
| Ga0364941_212186_342_503 | 3300034417 | Sediment | RGSVQLKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYW |
| Ga0364923_0086425_1_132 | 3300034690 | Sediment | SEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYW |
| ⦗Top⦘ |