


| Basic Information | |
|---|---|
| Family ID | F068596 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | YDGKYKEALALAQRLGDGLERSDAYRSGQYRVAPLPQNNGVR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.42 % |
| % of genes near scaffold ends (potentially truncated) | 93.55 % |
| % of genes from short scaffolds (< 2000 bps) | 87.90 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.645 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.194 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.258 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 1.61 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF13539 | Peptidase_M15_4 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.65 % |
| All Organisms | root | All Organisms | 44.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001850|RCM37_1008176 | All Organisms → Viruses → Predicted Viral | 2213 | Open in IMG/M |
| 3300001851|RCM31_10254717 | Not Available | 575 | Open in IMG/M |
| 3300002408|B570J29032_109004589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300002835|B570J40625_100748297 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300003497|JGI25925J51416_10012682 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
| 3300004481|Ga0069718_15820259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300004797|Ga0007764_11563002 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005527|Ga0068876_10036409 | All Organisms → Viruses → Predicted Viral | 3047 | Open in IMG/M |
| 3300005582|Ga0049080_10289074 | Not Available | 530 | Open in IMG/M |
| 3300006802|Ga0070749_10306597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300006875|Ga0075473_10079460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1288 | Open in IMG/M |
| 3300006875|Ga0075473_10236467 | Not Available | 738 | Open in IMG/M |
| 3300007171|Ga0102977_1001929 | Not Available | 2070 | Open in IMG/M |
| 3300007214|Ga0103959_1225106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6346 | Open in IMG/M |
| 3300007363|Ga0075458_10131838 | Not Available | 775 | Open in IMG/M |
| 3300007538|Ga0099851_1135246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300007541|Ga0099848_1045365 | Not Available | 1787 | Open in IMG/M |
| 3300007622|Ga0102863_1094421 | Not Available | 879 | Open in IMG/M |
| 3300007974|Ga0105747_1003988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3729 | Open in IMG/M |
| 3300007974|Ga0105747_1063105 | Not Available | 1111 | Open in IMG/M |
| 3300008113|Ga0114346_1017365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3938 | Open in IMG/M |
| 3300008116|Ga0114350_1097504 | Not Available | 936 | Open in IMG/M |
| 3300008266|Ga0114363_1172968 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300008266|Ga0114363_1186979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300009037|Ga0105093_10931763 | Not Available | 512 | Open in IMG/M |
| 3300009151|Ga0114962_10305914 | Not Available | 886 | Open in IMG/M |
| 3300009154|Ga0114963_10169129 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300009154|Ga0114963_10336499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300009159|Ga0114978_10107694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1833 | Open in IMG/M |
| 3300009165|Ga0105102_10165950 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300009180|Ga0114979_10410728 | Not Available | 791 | Open in IMG/M |
| 3300009184|Ga0114976_10096865 | All Organisms → Viruses → Predicted Viral | 1687 | Open in IMG/M |
| 3300010157|Ga0114964_10409195 | Not Available | 640 | Open in IMG/M |
| 3300010354|Ga0129333_10006002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11462 | Open in IMG/M |
| 3300010354|Ga0129333_10311963 | Not Available | 1406 | Open in IMG/M |
| 3300010354|Ga0129333_11007519 | Not Available | 700 | Open in IMG/M |
| 3300010354|Ga0129333_11584894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300010885|Ga0133913_12421436 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300012006|Ga0119955_1083124 | Not Available | 928 | Open in IMG/M |
| 3300012964|Ga0153916_11393417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300012968|Ga0129337_1451605 | Not Available | 515 | Open in IMG/M |
| 3300013005|Ga0164292_10711262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10138966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1626 | Open in IMG/M |
| 3300015050|Ga0181338_1022463 | Not Available | 983 | Open in IMG/M |
| 3300017707|Ga0181363_1062295 | Not Available | 654 | Open in IMG/M |
| 3300017707|Ga0181363_1076024 | Not Available | 578 | Open in IMG/M |
| 3300017716|Ga0181350_1072999 | Not Available | 878 | Open in IMG/M |
| 3300017722|Ga0181347_1061440 | Not Available | 1119 | Open in IMG/M |
| 3300017747|Ga0181352_1097156 | Not Available | 810 | Open in IMG/M |
| 3300017747|Ga0181352_1113710 | Not Available | 734 | Open in IMG/M |
| 3300017747|Ga0181352_1130092 | Not Available | 675 | Open in IMG/M |
| 3300017747|Ga0181352_1137718 | Not Available | 652 | Open in IMG/M |
| 3300017747|Ga0181352_1150163 | Not Available | 617 | Open in IMG/M |
| 3300017747|Ga0181352_1166041 | Not Available | 578 | Open in IMG/M |
| 3300017747|Ga0181352_1169255 | Not Available | 571 | Open in IMG/M |
| 3300017754|Ga0181344_1008800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3290 | Open in IMG/M |
| 3300017754|Ga0181344_1067116 | Not Available | 1060 | Open in IMG/M |
| 3300017766|Ga0181343_1015372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2411 | Open in IMG/M |
| 3300017766|Ga0181343_1217651 | Not Available | 520 | Open in IMG/M |
| 3300017777|Ga0181357_1051579 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
| 3300017777|Ga0181357_1312316 | Not Available | 531 | Open in IMG/M |
| 3300017780|Ga0181346_1117471 | Not Available | 1021 | Open in IMG/M |
| 3300017780|Ga0181346_1317500 | Not Available | 524 | Open in IMG/M |
| 3300017785|Ga0181355_1305014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300019784|Ga0181359_1095402 | Not Available | 1097 | Open in IMG/M |
| 3300019784|Ga0181359_1119133 | Not Available | 946 | Open in IMG/M |
| 3300020109|Ga0194112_10694135 | Not Available | 680 | Open in IMG/M |
| 3300020197|Ga0194128_10508268 | Not Available | 552 | Open in IMG/M |
| 3300021519|Ga0194048_10321921 | Not Available | 554 | Open in IMG/M |
| 3300021956|Ga0213922_1076421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300021962|Ga0222713_10033327 | Not Available | 4121 | Open in IMG/M |
| 3300021962|Ga0222713_10792201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300021962|Ga0222713_10855496 | Not Available | 503 | Open in IMG/M |
| 3300022179|Ga0181353_1028409 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300022179|Ga0181353_1112497 | Not Available | 658 | Open in IMG/M |
| 3300022200|Ga0196901_1223801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300022407|Ga0181351_1053210 | Not Available | 1683 | Open in IMG/M |
| 3300022407|Ga0181351_1226373 | Not Available | 602 | Open in IMG/M |
| 3300023311|Ga0256681_11149882 | Not Available | 506 | Open in IMG/M |
| 3300024560|Ga0256306_1162137 | Not Available | 512 | Open in IMG/M |
| 3300024567|Ga0256307_1047641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1023 | Open in IMG/M |
| 3300025445|Ga0208424_1004038 | Not Available | 1632 | Open in IMG/M |
| 3300025655|Ga0208795_1128522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300025732|Ga0208784_1156362 | Not Available | 673 | Open in IMG/M |
| 3300026457|Ga0255160_1010103 | All Organisms → Viruses → Predicted Viral | 1752 | Open in IMG/M |
| 3300027123|Ga0255090_1019369 | Not Available | 1202 | Open in IMG/M |
| 3300027492|Ga0255093_1084510 | Not Available | 591 | Open in IMG/M |
| 3300027621|Ga0208951_1199098 | Not Available | 501 | Open in IMG/M |
| 3300027712|Ga0209499_1248648 | Not Available | 615 | Open in IMG/M |
| 3300027733|Ga0209297_1000860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18476 | Open in IMG/M |
| 3300027734|Ga0209087_1304184 | Not Available | 567 | Open in IMG/M |
| 3300027741|Ga0209085_1193063 | Not Available | 832 | Open in IMG/M |
| 3300027747|Ga0209189_1323469 | Not Available | 593 | Open in IMG/M |
| 3300027777|Ga0209829_10093610 | Not Available | 1470 | Open in IMG/M |
| 3300027900|Ga0209253_10711900 | Not Available | 723 | Open in IMG/M |
| 3300027973|Ga0209298_10345137 | Not Available | 570 | Open in IMG/M |
| 3300028393|Ga0304728_1002291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12391 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1053400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2073 | Open in IMG/M |
| 3300031758|Ga0315907_11157606 | Not Available | 545 | Open in IMG/M |
| 3300031784|Ga0315899_11520158 | Not Available | 560 | Open in IMG/M |
| 3300031951|Ga0315904_10966281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300031951|Ga0315904_11398681 | Not Available | 522 | Open in IMG/M |
| 3300031963|Ga0315901_10354868 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300031963|Ga0315901_10545478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300031999|Ga0315274_11590636 | Not Available | 615 | Open in IMG/M |
| 3300031999|Ga0315274_11619859 | Not Available | 607 | Open in IMG/M |
| 3300032050|Ga0315906_10156421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2195 | Open in IMG/M |
| 3300032116|Ga0315903_10456036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300032177|Ga0315276_12628200 | Not Available | 502 | Open in IMG/M |
| 3300034021|Ga0335004_0688102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300034023|Ga0335021_0254371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300034061|Ga0334987_0453417 | Not Available | 795 | Open in IMG/M |
| 3300034061|Ga0334987_0775012 | Not Available | 538 | Open in IMG/M |
| 3300034062|Ga0334995_0505150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300034063|Ga0335000_0438144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300034082|Ga0335020_0210756 | Not Available | 969 | Open in IMG/M |
| 3300034104|Ga0335031_0317126 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300034104|Ga0335031_0826641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300034106|Ga0335036_0727169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300034109|Ga0335051_0160990 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300034111|Ga0335063_0101581 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300034168|Ga0335061_0309836 | Not Available | 825 | Open in IMG/M |
| 3300034272|Ga0335049_0535406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 739 | Open in IMG/M |
| 3300034283|Ga0335007_0721723 | Not Available | 554 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.45% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.03% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.23% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.61% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.61% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.61% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.81% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM37_10081761 | 3300001850 | Marine Plankton | NQKYMEALALAKRLGDGLERSDAYRSGQFRMPNLPQNNGVK* |
| RCM31_102547171 | 3300001851 | Marine Plankton | GKYKEALAMASRLGDGLERSDAYRSGQYRQAPLPQNSGVR* |
| B570J29032_1090045892 | 3300002408 | Freshwater | GVYNQKYMEALAMAKRLGDGLERSDAYRSGQARVPPLPQNRGVQ* |
| B570J40625_1007482973 | 3300002835 | Freshwater | EQDMMGVYNQKYMEALAMAKRLGDGLERSDAYRSGQARVPPLPQNRGVQ* |
| JGI25925J51416_100126826 | 3300003497 | Freshwater Lake | KYKEALMLAKRLGDGLERSDAYRSGQYRMAPLPQNNGVV* |
| Ga0069718_158202591 | 3300004481 | Sediment | DLVTLYNTKYNEALALAKRLGDGLERSDSYRNGQYRAPPLPRNNGVA* |
| Ga0007764_115630021 | 3300004797 | Freshwater Lake | KGEADMMALYDGKYKEALAMAQRLGDGLERSDAYRSGQFRLPPLAQNNGVR* |
| Ga0068876_100364096 | 3300005527 | Freshwater Lake | DVMGFYELKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQNTGVR* |
| Ga0049080_102890741 | 3300005582 | Freshwater Lentic | ETKYKEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR* |
| Ga0070749_103065971 | 3300006802 | Aqueous | QDMVALYDTKFKEALALAKRLGDGMERSDSYRSGQYRLSPLPQNNGVA* |
| Ga0075473_100794604 | 3300006875 | Aqueous | QLYDTKYKEALQLAKRLGDGLERSDSYRSGQYRVAPLPQNRGVV* |
| Ga0075473_102364673 | 3300006875 | Aqueous | ALALAKRLGDGLERSDAYRSGQARAMPLPQNNGVQ* |
| Ga0102977_10019291 | 3300007171 | Freshwater Lake | YMEALQLAKRLGDGLERSDAYRSGQSRVAPLPQNNGVK* |
| Ga0103959_12251061 | 3300007214 | Freshwater Lake | AYQKRYDEALALAKRLGDGLERSDAYRSGQARIPPLPQNSAVR* |
| Ga0075458_101318381 | 3300007363 | Aqueous | YMEALALAKRLGDGLERSDAYRSGQARAMPLPQNNGVQ* |
| Ga0099851_11352463 | 3300007538 | Aqueous | DTMKNYTDRYNEALLLAKRLGDGMDRSDAYRSGQFRMPNLPQNSGVR* |
| Ga0099848_10453651 | 3300007541 | Aqueous | LLLAKRLGDGMDRSDAYRSGQFRMPNLPQNSGVR* |
| Ga0102863_10944214 | 3300007622 | Estuarine | GKYKEAMAMAQRLGDGLERSDAYRSGQYRVAPLPQNSGVR* |
| Ga0105747_10039885 | 3300007974 | Estuary Water | YDGKYKEALMLAKRLGDGLERSDAYRSGQARVAPLPQNNGVQ* |
| Ga0105747_10631051 | 3300007974 | Estuary Water | IALYDGKYKEAMAMAQRLGDGLERSDAYRSGQYRVAPLPQNSGVR* |
| Ga0114346_10173651 | 3300008113 | Freshwater, Plankton | ADMLALYDGRYKEALALAKRLCDGLERSDAYRSGQSRVAPLPQNTGVV* |
| Ga0114350_10975043 | 3300008116 | Freshwater, Plankton | DKRYNEALALAKRLGDGMERSDAYRSGQMRMPNLPQNRGVI* |
| Ga0114363_11729682 | 3300008266 | Freshwater, Plankton | MALYDTKYKEALALAKRLGDGLERSDAYRSGQYRAAPLPQNNGVA* |
| Ga0114363_11869793 | 3300008266 | Freshwater, Plankton | QKYGEALQLAKRLGDGLERSDAYRSGQSRLPPLPQNSGVT* |
| Ga0105093_109317631 | 3300009037 | Freshwater Sediment | IMQGYDMKFKEAVALAKRLGDGLERSDAYRSGQFRAPPLPQNRGVS* |
| Ga0114962_103059144 | 3300009151 | Freshwater Lake | ALALAKRLGDGLERSDAYRSGQYREMPLPQNNGVR* |
| Ga0114963_101691291 | 3300009154 | Freshwater Lake | QKYMEALALAKRLGDGLERSDAYRSGQARVAPLPQNNGVQ* |
| Ga0114963_103364991 | 3300009154 | Freshwater Lake | IITLYDTKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQNTGIR* |
| Ga0114978_101076946 | 3300009159 | Freshwater Lake | GEPDVYAAYQKRYDEALMMAKRLGDGLERSDAYRSGQSRVAPLPQNNGVV* |
| Ga0105102_101659503 | 3300009165 | Freshwater Sediment | YDGKFKEAMMLAKRLGDGLERSDAYRSGQFRAPPLPQNNGVT* |
| Ga0114979_104107281 | 3300009180 | Freshwater Lake | EALALAKRLGDGLERSDAYRSGQYREAPLPQNTGIR* |
| Ga0114976_100968655 | 3300009184 | Freshwater Lake | YDTKYKEALALAKRLGDGLERSDAYRSGQYRQAPLPQNSGVA* |
| Ga0114964_104091953 | 3300010157 | Freshwater Lake | QDLIMLYDTKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQNTGVR* |
| Ga0129333_100060021 | 3300010354 | Freshwater To Marine Saline Gradient | KEALALAKRLGDGMERQDAYRSGQYRAAPLPQNNGVA* |
| Ga0129333_103119631 | 3300010354 | Freshwater To Marine Saline Gradient | LALAKRLGDGLERSDAYRSGQFRTPPLPQNNGVA* |
| Ga0129333_110075191 | 3300010354 | Freshwater To Marine Saline Gradient | KYMEALALAKRLGDGLERSDAYRSGQARAMPLPQNNGVQ* |
| Ga0129333_115848941 | 3300010354 | Freshwater To Marine Saline Gradient | MEALQLAKRLGDGLERSDAYRSGQARVPPLPQNKGVQ* |
| Ga0133913_124214364 | 3300010885 | Freshwater Lake | YKEALMQAKRLGDGLERSDAYRSGQYRTPPLPQNSGVM* |
| Ga0119955_10831244 | 3300012006 | Freshwater | LYDTKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQNTGIR* |
| Ga0153916_113934171 | 3300012964 | Freshwater Wetlands | KYKEALAMAKRLGDGLERSDAYRNGQYRMAPLPQNNGVS* |
| Ga0129337_14516051 | 3300012968 | Aqueous | AKYAEALGLAKRLGDGLERSDAYRSGQYRTPPLPQNSGVQ* |
| Ga0164292_107112622 | 3300013005 | Freshwater | LYDGKYKEALVLAKRLGDGLERSDSYRSGQYRLSPLPQNNGVA* |
| (restricted) Ga0172367_101389665 | 3300013126 | Freshwater | LSLAKRLGDGLERSDAYRSGQARMPPLPQNNAVR* |
| Ga0181338_10224631 | 3300015050 | Freshwater Lake | KALALAKRLGDGLERSDAYRSGQARLAPLPQNNGVQ* |
| Ga0181363_10622951 | 3300017707 | Freshwater Lake | MMALYAQRYAEALNMAKRLGDGLERSDAYRSGQFRVAPLPQNNGVA |
| Ga0181363_10760241 | 3300017707 | Freshwater Lake | YKEALALAQRLVDGLEGSDAYRSGQYRQAPLPQNNGVR |
| Ga0181350_10729991 | 3300017716 | Freshwater Lake | KEALGLAIRLGNGMERSDAYRSGQTRVAPLPQNTGVK |
| Ga0181347_10614404 | 3300017722 | Freshwater Lake | GLYDAKYKEALALAQRLGDGMERSDAYRSGQYRQAPLPQNSGVR |
| Ga0181352_10971563 | 3300017747 | Freshwater Lake | GRLALAQRLGDGLERSDAYRSGQYRQSPLPQNSGVR |
| Ga0181352_11137101 | 3300017747 | Freshwater Lake | EGEYNEALSLASLLGDGLVRIDAYRSGQFRLAPLPQNNGVR |
| Ga0181352_11300921 | 3300017747 | Freshwater Lake | DMMALYEGKYKEALSLAARLGDGLERSDAYRSGQFRLAPLPQNSGVR |
| Ga0181352_11377181 | 3300017747 | Freshwater Lake | IITGYDMKYKEALALAIRLGDGLERSDAYRSGQYRVAPLPQNNGVK |
| Ga0181352_11501631 | 3300017747 | Freshwater Lake | TKYKEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0181352_11660411 | 3300017747 | Freshwater Lake | KEALALAQRLGDGLERSDAYRSGQFRLPPLPQNNGVR |
| Ga0181352_11692551 | 3300017747 | Freshwater Lake | KEALALAQRLGDGLERSDAYRSGQFRVPPLAQNNGVR |
| Ga0181344_10088006 | 3300017754 | Freshwater Lake | GETDMMSLYNAKYQEALALAKRLGDGLERSDAYRSGQFRMPALPQNNGVK |
| Ga0181344_10671163 | 3300017754 | Freshwater Lake | KGEADLLALYSQRYGEALSQAKRLGDGLESSDAYRSGQFRLAPLPQNNGVR |
| Ga0181343_10153726 | 3300017766 | Freshwater Lake | EVDIITGYNQKYMEALALAKRLGDGLERSDAYRSGQYRTPALPQNTGVL |
| Ga0181343_12176511 | 3300017766 | Freshwater Lake | LYNQKYMEALQLAKRLGDGLERSDAYRSGQSRLAPLPQNNGVK |
| Ga0181357_10515791 | 3300017777 | Freshwater Lake | IITLYDIKYKEALALAKRLGDGLERSDAYRSGQAREAPLPQNFGVK |
| Ga0181357_13123162 | 3300017777 | Freshwater Lake | GLYDGKYKEALALAQRLGDGLERSDAYRSGQYRQSPLPQNSGVR |
| Ga0181346_11174711 | 3300017780 | Freshwater Lake | YKEALALAQRLGDGLERSDAYRSGQYRQSPLPQNSGVR |
| Ga0181346_13175001 | 3300017780 | Freshwater Lake | AKYKEALALAQRLGDGMERSDAYRSGQYRQAPLPQNSGVR |
| Ga0181355_13050141 | 3300017785 | Freshwater Lake | EALAMASRLGNGMERSDAYRSGQSRLAPLPQNNGVK |
| Ga0181359_10954024 | 3300019784 | Freshwater Lake | TMYETKYKEALALAQRLGDGMERSDAYRSGQYRQAPLPQNSGVR |
| Ga0181359_11191331 | 3300019784 | Freshwater Lake | MKGETDLIALYDGKYKEAMAMAQRLGDGLERSDAYRSGQARVAPLPQNNGVR |
| Ga0194112_106941351 | 3300020109 | Freshwater Lake | YTERYNEALLLAKRLGDGMERSDAYRSGQFRMPNLPQNTGVR |
| Ga0194128_105082682 | 3300020197 | Freshwater Lake | RYNEALLLAKRLGDGMERSDAYRSGQFRMPNLPQNTGVR |
| Ga0194048_103219211 | 3300021519 | Anoxic Zone Freshwater | YKEALGLAKRLGDGLERSDAYRSGQARVAPLPQNNGVQ |
| Ga0213922_10764213 | 3300021956 | Freshwater | YGEALQLAKRLGDGLERSDAYRSGQSRVAPLPQNSGVT |
| Ga0222713_100333275 | 3300021962 | Estuarine Water | LIALYNQKYMEALALAKRLGDGLERSDAYRSGQARVMPLPQNNGVQ |
| Ga0222713_107922012 | 3300021962 | Estuarine Water | NQKYMEALAMAKRLGDGLERSDAYRSGQYREAPLPQNHGVR |
| Ga0222713_108554962 | 3300021962 | Estuarine Water | DMVQLYNQKYMEALAQASRLGDGLERSDAYRSGQARVAPLPQNNGVK |
| Ga0181353_10284091 | 3300022179 | Freshwater Lake | GETDMMQLYDGKYKEALQMAKRLGDGLERSDSYRSGQSRVAPLPQNRGVV |
| Ga0181353_11124973 | 3300022179 | Freshwater Lake | ALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0196901_12238011 | 3300022200 | Aqueous | GRYNEALTLAKRLGDGMERSDAYRSGQFRMPNLPQNNGVR |
| Ga0181351_10532101 | 3300022407 | Freshwater Lake | YDGKYKEALALAQRLGDGLERSDAYRSGQYRQSPLPQNSGVR |
| Ga0181351_12263731 | 3300022407 | Freshwater Lake | IIGLYDGKYKEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0256681_111498822 | 3300023311 | Freshwater | LYDTKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQNNGIR |
| Ga0256306_11621371 | 3300024560 | Freshwater | TDLIALYDGKYKEAMAMAQRLGDGLERSDAYRSGQARVAPLPQNNGVR |
| Ga0256307_10476414 | 3300024567 | Freshwater | YDGKYKEAMAMAQRLGDGLERSDAYRSGQARVAPLPQNNGVR |
| Ga0208424_10040381 | 3300025445 | Aqueous | GKYMEALALAKRLGDGLERSDAYRSGQARAMPLPQNNGVQ |
| Ga0208795_11285221 | 3300025655 | Aqueous | MYIGRYNEALTLAKRLGDGMERSDAYRSGQFRMPNLPQNNGVR |
| Ga0208784_11563621 | 3300025732 | Aqueous | NGKYMEALALAKRLGDGLERSDAYRSGQARAMPLPQNNGVQ |
| Ga0255160_10101031 | 3300026457 | Freshwater | KYNQKYMEALALAKRLGDGLERSDAYRSGQFRAPPLPQNSGVA |
| Ga0255090_10193694 | 3300027123 | Freshwater | GETDLIALYDGKYKEAMAMAQRLGDGLERSDAYRSGQARVAPLPQNNGVR |
| Ga0255093_10845101 | 3300027492 | Freshwater | EALALAKRLGDGLERSDAYRSGQARVMPLPQNNGVQ |
| Ga0208951_11990981 | 3300027621 | Freshwater Lentic | DGKYKEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0209499_12486482 | 3300027712 | Freshwater Lake | LMALYISRYKEALMEAKRLGDGLERSDAYRSGQYREAPLPQNTGIR |
| Ga0209297_100086016 | 3300027733 | Freshwater Lake | DEALMMAKRLGDGLERSDAYRSGQSRVAPLPQNNGVV |
| Ga0209087_13041841 | 3300027734 | Freshwater Lake | TMYETKYKEALALAKRLSDGLERSDAYRSGQYRQAPLPQNNGVT |
| Ga0209085_11930633 | 3300027741 | Freshwater Lake | MIALYDGKYKEALALAQRLGDGLERSDAYRSGQYRVAPLPQNTGVR |
| Ga0209189_13234692 | 3300027747 | Freshwater Lake | ALYDTKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQNTGIR |
| Ga0209829_100936101 | 3300027777 | Freshwater Lake | YKEALALAKRLGDGLERSDAYRSGQYRESPLPQNTGIR |
| Ga0209253_107119003 | 3300027900 | Freshwater Lake Sediment | MMALYEGKYKEALSLAARLGDGLERSDAYRSGQFRLAPLPQNSGVR |
| Ga0209298_103451371 | 3300027973 | Freshwater Lake | DMMALYDTKYKEALALAKRLGDGLERSDAYRSGQARMAPLPQNNGVQ |
| Ga0304728_10022911 | 3300028393 | Freshwater Lake | EALALAKRLGDGLERSDAYRSGQYRESPLPQNTGIR |
| (restricted) Ga0247831_10534005 | 3300028559 | Freshwater | ADIIAGYDMKYKEALALAKRLGDGLERSDAYRSGQYREAPLPQTSGVR |
| Ga0315907_111576062 | 3300031758 | Freshwater | IITMYETKYKEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0315899_115201582 | 3300031784 | Freshwater | KYKEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0315904_109662813 | 3300031951 | Freshwater | ALQLAKCLGDGLERSDAYRSGQSRLAPLPQNNGVK |
| Ga0315904_113986812 | 3300031951 | Freshwater | YDGKYKEALALAKRLGDGLERSDAYRSGQYRMAPLPQNNGVV |
| Ga0315901_103548681 | 3300031963 | Freshwater | DTKYKEALALAKRLGDGLERSDAYRSGQYRAAPLPQNNGVA |
| Ga0315901_105454781 | 3300031963 | Freshwater | KGEQDMLALYNQKYMEALQLAKRLGDGLERSDAYRSGQARVAPLPQNNGVK |
| Ga0315274_115906362 | 3300031999 | Sediment | YNQKYMEALGLAKRLGDGLERSDAYRSGQYREAPLPQNNGVR |
| Ga0315274_116198591 | 3300031999 | Sediment | GYNQKYMEALALAQRLGDGLERSDAYRSGQYRQAPLPQNNGVR |
| Ga0315906_101564211 | 3300032050 | Freshwater | YMEALQLAKRLGDGLERSDAYRSGQSRLAPLPQNNGVK |
| Ga0315903_104560363 | 3300032116 | Freshwater | EALALAKRLGDGMERSDSYRSGQYRLSPLPQNNGVA |
| Ga0315276_126282002 | 3300032177 | Sediment | ADIIGLYDTKYKEALALAKRLGDGLERSDAYRSGQARVAPLPQNSGVQ |
| Ga0335004_0688102_373_513 | 3300034021 | Freshwater | MMGVYNQKYMEALAMAKRLGDGLERSDAYRSGQARVQPLPQNRGVQ |
| Ga0335021_0254371_1_132 | 3300034023 | Freshwater | LYNGKFMEALALAKRLGDGLERSDSYRSGQYRAPPLPSNRGVA |
| Ga0334987_0453417_3_131 | 3300034061 | Freshwater | YDGKYKEALALAQRLGDGLERSDAYRSGQYRVAPLPQNNGVR |
| Ga0334987_0775012_4_162 | 3300034061 | Freshwater | MKGETDMMALYDGKYKEALMQARRLGDGLERSDAYRSGQTRISPLPQNNGVQ |
| Ga0334995_0505150_2_127 | 3300034062 | Freshwater | NQKYMEALAMASRLGDGMERSDAYRSGQYRQAPLPQNNGVR |
| Ga0335000_0438144_47_205 | 3300034063 | Freshwater | MKGEQDMMGVYNQKYMEALAMAKRLGDGLERSDAYRSGQARVPPLPQNRGVQ |
| Ga0335020_0210756_860_967 | 3300034082 | Freshwater | ALAMAKRLGDGLERSDAYRSGQYRTPALPQNTGVL |
| Ga0335031_0317126_66_224 | 3300034104 | Freshwater | MKGEQDIMAFYDLKYKEALALAKRLGDGLERSDAYRSGQFREAPLPQNTGIR |
| Ga0335031_0826641_363_503 | 3300034104 | Freshwater | MIALYNQKYMEALQLAKRLGDGLERSDAYRSGQSRLAPLPQNNGVK |
| Ga0335036_0727169_444_584 | 3300034106 | Freshwater | MMAMYNQKYMEALQLAKRLGDGLERSDAYRSGQSRLAPLPQNNGVK |
| Ga0335051_0160990_18_158 | 3300034109 | Freshwater | MMGVYNQKYMEALAMAKRLGDGLERSDAYRSGQARVPPLPQNRGVQ |
| Ga0335063_0101581_1508_1666 | 3300034111 | Freshwater | MKGETDMLTLYEMKYKEALALAQRLGDGLERSDAYRSGQFRLAPLPQNSGVR |
| Ga0335061_0309836_654_812 | 3300034168 | Freshwater | MKGETDLLQLYDGKYKEALAMAQRLGDGLERSDAYRSGQFRVPPLAQNNGVR |
| Ga0335049_0535406_610_738 | 3300034272 | Freshwater | YNQKYMEALQLAKRLGDGLERSDAYRSGQARLAPLPQNRGVK |
| Ga0335007_0721723_1_150 | 3300034283 | Freshwater | ETDMMALYDGKYKEALALAQRLGDGLERSDAYRSGQFRLPPLPQNNGVR |
| ⦗Top⦘ |