


| Basic Information | |
|---|---|
| Family ID | F068564 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VVRVSKPCYVLLAVFIGKTRLIDNLYIEPKSPGSEELVFHF |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 84.68 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.452 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.613 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.452 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.78% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 14.52 |
| PF02934 | GatB_N | 4.03 |
| PF03743 | TrbI | 3.23 |
| PF02637 | GatB_Yqey | 3.23 |
| PF00990 | GGDEF | 2.42 |
| PF02265 | S1-P1_nuclease | 1.61 |
| PF00248 | Aldo_ket_red | 0.81 |
| PF01594 | AI-2E_transport | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF17186 | Lipocalin_9 | 0.81 |
| PF14371 | DUF4412 | 0.81 |
| PF13442 | Cytochrome_CBB3 | 0.81 |
| PF01902 | Diphthami_syn_2 | 0.81 |
| PF07963 | N_methyl | 0.81 |
| PF08534 | Redoxin | 0.81 |
| PF00210 | Ferritin | 0.81 |
| PF00572 | Ribosomal_L13 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 7.26 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 7.26 |
| COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 3.23 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 3.23 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.81 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.39 % |
| Unclassified | root | N/A | 1.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1023843 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300001593|JGI12635J15846_10430961 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100670246 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300002910|JGI25615J43890_1090758 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300002914|JGI25617J43924_10222685 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300002917|JGI25616J43925_10341520 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300004080|Ga0062385_10038436 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300005174|Ga0066680_10635646 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005181|Ga0066678_10821882 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005332|Ga0066388_101495782 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005446|Ga0066686_10074267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2138 | Open in IMG/M |
| 3300005554|Ga0066661_10662314 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005555|Ga0066692_10334744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300005556|Ga0066707_10035211 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
| 3300005574|Ga0066694_10009263 | All Organisms → cellular organisms → Bacteria | 4155 | Open in IMG/M |
| 3300006032|Ga0066696_10535727 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006086|Ga0075019_10785317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300006162|Ga0075030_100535142 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300006806|Ga0079220_10009436 | All Organisms → cellular organisms → Bacteria | 3721 | Open in IMG/M |
| 3300006806|Ga0079220_10278855 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300007255|Ga0099791_10370061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300007255|Ga0099791_10389828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300007255|Ga0099791_10691396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300007258|Ga0099793_10367339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300007265|Ga0099794_10256617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300007265|Ga0099794_10567209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300009038|Ga0099829_10925238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300009038|Ga0099829_11678912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009088|Ga0099830_10456214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300009090|Ga0099827_11703865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300009137|Ga0066709_102956446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300010048|Ga0126373_10044190 | All Organisms → cellular organisms → Bacteria | 3933 | Open in IMG/M |
| 3300010322|Ga0134084_10099626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 926 | Open in IMG/M |
| 3300010325|Ga0134064_10097650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300010359|Ga0126376_12481789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 566 | Open in IMG/M |
| 3300010366|Ga0126379_10014003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5769 | Open in IMG/M |
| 3300010366|Ga0126379_13235692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300011271|Ga0137393_10612130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300012096|Ga0137389_10910857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300012096|Ga0137389_11302623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300012189|Ga0137388_10033349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4034 | Open in IMG/M |
| 3300012189|Ga0137388_10129444 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300012189|Ga0137388_10531310 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012189|Ga0137388_10603277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300012189|Ga0137388_11954501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012203|Ga0137399_10127029 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300012203|Ga0137399_10238722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| 3300012203|Ga0137399_10509488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300012207|Ga0137381_10349402 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300012208|Ga0137376_11565553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300012209|Ga0137379_11019793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012210|Ga0137378_10247842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
| 3300012359|Ga0137385_11052886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300012362|Ga0137361_11736701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012363|Ga0137390_10634690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300012582|Ga0137358_10422623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300012685|Ga0137397_10400524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300012927|Ga0137416_12209055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012929|Ga0137404_10234376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
| 3300012972|Ga0134077_10421501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300014166|Ga0134079_10765898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300015051|Ga0137414_1097493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300017656|Ga0134112_10506559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300017936|Ga0187821_10474458 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017943|Ga0187819_10414601 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300017966|Ga0187776_11021408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 609 | Open in IMG/M |
| 3300017999|Ga0187767_10335670 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300019278|Ga0187800_1826460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300020199|Ga0179592_10017814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3131 | Open in IMG/M |
| 3300020199|Ga0179592_10066914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300020579|Ga0210407_10301947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300020581|Ga0210399_10989215 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300020583|Ga0210401_10369076 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300020583|Ga0210401_11290348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300021088|Ga0210404_10295047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300021170|Ga0210400_10162435 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300021178|Ga0210408_10957028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300021178|Ga0210408_11204458 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300021181|Ga0210388_10578175 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300021181|Ga0210388_10911850 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021403|Ga0210397_11134725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021406|Ga0210386_10792629 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300021432|Ga0210384_10041348 | All Organisms → cellular organisms → Bacteria | 4229 | Open in IMG/M |
| 3300021476|Ga0187846_10484372 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021477|Ga0210398_10135770 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300021478|Ga0210402_10672939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 957 | Open in IMG/M |
| 3300021478|Ga0210402_11399022 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300022726|Ga0242654_10333229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300024323|Ga0247666_1012616 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300024330|Ga0137417_1027635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300026314|Ga0209268_1001865 | All Organisms → cellular organisms → Bacteria | 10264 | Open in IMG/M |
| 3300026314|Ga0209268_1013134 | All Organisms → cellular organisms → Bacteria | 3250 | Open in IMG/M |
| 3300026320|Ga0209131_1166540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300026328|Ga0209802_1218541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300026334|Ga0209377_1022170 | All Organisms → cellular organisms → Bacteria | 3201 | Open in IMG/M |
| 3300026359|Ga0257163_1026333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300026499|Ga0257181_1035582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300026529|Ga0209806_1290035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300026538|Ga0209056_10340448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300026542|Ga0209805_1133781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300026542|Ga0209805_1416709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 519 | Open in IMG/M |
| 3300026551|Ga0209648_10209842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1477 | Open in IMG/M |
| 3300026551|Ga0209648_10534854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300026551|Ga0209648_10567025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027591|Ga0209733_1041159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
| 3300027645|Ga0209117_1179368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300027645|Ga0209117_1197714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027655|Ga0209388_1101255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300027748|Ga0209689_1000454 | All Organisms → cellular organisms → Bacteria | 28083 | Open in IMG/M |
| 3300027824|Ga0209040_10399082 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027898|Ga0209067_10625487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300027903|Ga0209488_10877748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027903|Ga0209488_11204822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300027911|Ga0209698_10336494 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300028145|Ga0247663_1099184 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031720|Ga0307469_11838029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300031799|Ga0318565_10069725 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300031945|Ga0310913_10025888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3697 | Open in IMG/M |
| 3300031962|Ga0307479_10979761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300032059|Ga0318533_10726370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 729 | Open in IMG/M |
| 3300032205|Ga0307472_101134440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300033829|Ga0334854_113571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium | 651 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10238431 | 3300001154 | Forest Soil | RVNKPCYAVLAVFIGKTRLIDNLYIEPKSLDSDELVFHF* |
| JGI12635J15846_104309613 | 3300001593 | Forest Soil | VRVARPCYAVLAVFLGKTRLIDNLLIEPAPAGSEEFVFQL* |
| JGIcombinedJ26739_1006702463 | 3300002245 | Forest Soil | PCYALLAVFIGKTRLIDNLYLEPVGESEELAYHL* |
| JGI25615J43890_10907581 | 3300002910 | Grasslands Soil | RVSKPSYILLAVFIGKTRLIDNLYIEPKSQVSEELVFHF* |
| JGI25617J43924_102226852 | 3300002914 | Grasslands Soil | KSFEPVLRVNKPCYVLLAVFIGKTRLIDNLYVEPKSPDSEELVFQF* |
| JGI25616J43925_103415201 | 3300002917 | Grasslands Soil | PVVQVRRSCYALLAVFIGKTRLIDNLLIESASADSEELLFHF* |
| Ga0062385_100384364 | 3300004080 | Bog Forest Soil | VRVARPCYTVLAVFLGKTRLIDNLYIEPAATGTDELIVNI* |
| Ga0066680_106356462 | 3300005174 | Soil | RVNKPCYVLLAVFIGKTRLIDNLYIEPKSPDSEDLVFHF* |
| Ga0066678_108218821 | 3300005181 | Soil | EPVVRVRKPCYVLLAVFIGKTRLIDNLYIEPKSSDSEELVFHF* |
| Ga0066388_1014957823 | 3300005332 | Tropical Forest Soil | DAESFEPVPRVNRACYVLLAVFIGKTRLIDNLYVEPKSPGSDELVFHL* |
| Ga0070667_1019540811 | 3300005367 | Switchgrass Rhizosphere | RISRPCYILLAAFFGKTRLIDNLYIEPTATGSDELHAQL* |
| Ga0066686_100742671 | 3300005446 | Soil | AEVVDAERFEPVLKVNKPCYVLLAVFIGKTRLIDNLYVEPKSTGSEELVFHF* |
| Ga0066661_106623141 | 3300005554 | Soil | VVRVRKPCYVLLAVFIGKARLIDNLFVEPKSSDSEELVFHF* |
| Ga0066692_103347442 | 3300005555 | Soil | RITRACYVLLAAFIGKMRLIDNMYVETKSPGFDELMFHL* |
| Ga0066707_100352114 | 3300005556 | Soil | CYVLLAVFIGKTRLIDNLFVEPKSSNSEELVFHF* |
| Ga0066699_106814503 | 3300005561 | Soil | EPVTRISRPCYVLLAAFLGKTRLIDNLYIEPAVPAAELHAQF* |
| Ga0066694_100092637 | 3300005574 | Soil | PVVRVRKPCYVLLAVFIGKARLIDNLFVEPKSSDSEELVFHF* |
| Ga0066696_105357271 | 3300006032 | Soil | EPVIRVSKPCYVLLAVFIGKTRLIDNLFVEPKSSNSEELVFHF* |
| Ga0075019_107853171 | 3300006086 | Watersheds | VSKPCYVLLAVFIGKTRLIDNLYIEPKPAGSEDLEIHC* |
| Ga0075030_1005351424 | 3300006162 | Watersheds | DARTFEPVMHVRRSCYVLLAVFIGKTRLIDNLLVEPRETDSDEFLIHL* |
| Ga0079220_100094361 | 3300006806 | Agricultural Soil | EPVVRVAQPCYAVLAVFIGKTRLIDNSLIEPATDGSEEFLFHF* |
| Ga0079220_102788553 | 3300006806 | Agricultural Soil | EPVVRINKACYALLAVFIGKTRLIDNLYVEPASPNPDDLVFHL* |
| Ga0099791_103700612 | 3300007255 | Vadose Zone Soil | PSYILLAVFIGKTRLIDNLYIEAKSPGSEELVFHF* |
| Ga0099791_103898282 | 3300007255 | Vadose Zone Soil | EPVVRVSKSSYIVLAVFIGKTRLIDNLFIEPKAPGSDELLFHF* |
| Ga0099791_106913961 | 3300007255 | Vadose Zone Soil | KSCYVLLAVFIGKTRLIDNLYVEPGSSGSEELVFHF* |
| Ga0099793_103673391 | 3300007258 | Vadose Zone Soil | SYILLAVFIGKTRLIDNLYIEPKSQVSEELVFHF* |
| Ga0099794_102566172 | 3300007265 | Vadose Zone Soil | VDAEAFEPVVRVNKPCFVLLAVFIGKTRLIDNLYVEPKLSDSEELVFHF* |
| Ga0099794_105672091 | 3300007265 | Vadose Zone Soil | SFEPVVRVSKPSYIVLAVFIGKTRLIDNLFIEPKALGSDELLFHF* |
| Ga0099829_109252381 | 3300009038 | Vadose Zone Soil | KVNKPCYVLLAVFIGKTRLIDNLYVEPKSKGSEELVFHF* |
| Ga0099829_116789122 | 3300009038 | Vadose Zone Soil | VDAEPFEPVARVSKPSYILLAVFIGKTRLIDNLYIEPKSPGSEELVFHF* |
| Ga0099830_104562141 | 3300009088 | Vadose Zone Soil | PCYVLLAVFIGKTRLIDNLYVEPKSPGSGDLVFHF* |
| Ga0099827_117038651 | 3300009090 | Vadose Zone Soil | AERFEPVLKVNKPCYVLLAVFIGKTRLIDNLYVEPKSTGSEELVFHF* |
| Ga0066709_1029564462 | 3300009137 | Grasslands Soil | RVSKPCFVLLAVFIGKTRLIDNLYIEPKSSGSEELVFHF* |
| Ga0126373_100441905 | 3300010048 | Tropical Forest Soil | DAESFEPAPRVNRACYVLLAVFVGKTRLIDNLYVERKSPGSDRLVFHL* |
| Ga0134084_100996263 | 3300010322 | Grasslands Soil | VVRMNKACYVLLAVFFGKTRLIDNLYVEPASPNSDGLLFHL* |
| Ga0134064_100976502 | 3300010325 | Grasslands Soil | VRVRKPCYVLLAVFIGKARLIDNLFVEPKSSDSEELVFHF* |
| Ga0126376_124817891 | 3300010359 | Tropical Forest Soil | RVSRACYVLLAVFIGKTRLLDNLFVEPSAPGSDELVFHL* |
| Ga0126379_100140037 | 3300010366 | Tropical Forest Soil | ACYMLLAVFIGKTRLIDNLFIEPESSGSDELVFHL* |
| Ga0126379_132356921 | 3300010366 | Tropical Forest Soil | ACYMLLAVFIGKTRLIDNLFIEPESSSSDELVFHL* |
| Ga0137393_106121302 | 3300011271 | Vadose Zone Soil | VQVRWSCYALLGVFIGKTRLIDNLLIESASADSEELLFHF* |
| Ga0137389_109108571 | 3300012096 | Vadose Zone Soil | PVMRVSKPCYVLLAVFIGKTRLIDNLYIEPKSPGSEDLVFHY* |
| Ga0137389_113026231 | 3300012096 | Vadose Zone Soil | PVIRVNKPCYVLLAVFIGKTRLIDNLYVEPKSSGSEELVFHF* |
| Ga0137388_100333496 | 3300012189 | Vadose Zone Soil | EVVDAERFEPVLKVNKPCYVLLAVFIGKTRLIDNLYVEPKSTGSEELVFHF* |
| Ga0137388_101294444 | 3300012189 | Vadose Zone Soil | VSKPCYVLLAVFIGKTRLIDNLYVEPKSPDSEDLVFQF* |
| Ga0137388_105313101 | 3300012189 | Vadose Zone Soil | VTRVRRPCYALLAVFLGRTRLIDNLYVEPAAENAEELVFYL* |
| Ga0137388_106032772 | 3300012189 | Vadose Zone Soil | DAESFEPVVRVSKPSYILLAVFIGKTRLIDNLYLEPKSPGSEELVFHF* |
| Ga0137388_119545012 | 3300012189 | Vadose Zone Soil | VDAHTFEPVARVRPNCYLLLAVRIGKTRLIDNLFVEAVGHDSEELLFHL* |
| Ga0137399_101270291 | 3300012203 | Vadose Zone Soil | SKPCFVLLAVFIGKTRLIDNLYIESKSSGSEELVFHF* |
| Ga0137399_102387223 | 3300012203 | Vadose Zone Soil | QTFDPIIRVSKPCYVLLAVFVGKTRLIDNLYIEPKSFDSDELVFHF* |
| Ga0137399_105094882 | 3300012203 | Vadose Zone Soil | EVVDAESFEPVVRVSKPSYILLAVFIGKTRLIDNLYIEPKSQVSEELVFHF* |
| Ga0137381_103494021 | 3300012207 | Vadose Zone Soil | PVLKVNKPCYVLLAVFIGKTRLIDNLYVEPKSTGSEELVFHF* |
| Ga0137376_115655531 | 3300012208 | Vadose Zone Soil | CFVLLAVFIGKTRLIDNLYIEPKSSGSEELVFHF* |
| Ga0137379_110197931 | 3300012209 | Vadose Zone Soil | SKPSYILLAVFIGKTRLIDNLYIELKSLDSEELVFHF* |
| Ga0137378_102478421 | 3300012210 | Vadose Zone Soil | RACYLLLAVFIGKTRLIDNLYVEPKSPGSDELLFHL* |
| Ga0137385_110528862 | 3300012359 | Vadose Zone Soil | TFEPIVRVRRACYLLLAVFIGKTRLIDNLYVEPKSPGSDELLFHL* |
| Ga0137361_117367011 | 3300012362 | Vadose Zone Soil | FEPVLKVNKPCYVLLAVFIGKTRLIDNLYVEPKSTGSEELVFHF* |
| Ga0137390_106346901 | 3300012363 | Vadose Zone Soil | VRVNKPCYVLLAVFIGKTRLIDNLYVEPKSSDSEELVFHF* |
| Ga0137358_104226231 | 3300012582 | Vadose Zone Soil | IVDAEGFEPVVRVSRPSYVLLAVFIGKTRLIDNLFIEPKSSGSEELVFHF* |
| Ga0137397_104005241 | 3300012685 | Vadose Zone Soil | KSSYIALAVFIGKTRLIDNLYIEPKEPGSDELLFHF* |
| Ga0137416_122090552 | 3300012927 | Vadose Zone Soil | EVVDAESFEPVVRVSKPSYILLAVFIGKTRLIDNLYVEPKSPVSEELVFHF* |
| Ga0137404_102343761 | 3300012929 | Vadose Zone Soil | VVRVRKPCYALLAVFIGKTRLIDNLYIEPKSSDSEELVFHF* |
| Ga0134077_104215012 | 3300012972 | Grasslands Soil | RVNKPCYMVLAVFIGKTRLIDNLYIEPKSPDSEELVFHF* |
| Ga0134079_107658981 | 3300014166 | Grasslands Soil | KPCYVLLAVFIGKTRLIDNLFVEPKSSNSEELVFHF* |
| Ga0137414_10974932 | 3300015051 | Vadose Zone Soil | QTFDPVIRVSKPCYVLLAVFVGKTRLIDNLYIEPKSFDSDELVFHF* |
| Ga0134112_105065592 | 3300017656 | Grasslands Soil | EPVVRVNKPCYMVLAVFIGKTRLIDNLYIEPKSPDSEELVFHF |
| Ga0187821_104744582 | 3300017936 | Freshwater Sediment | PCYAVLAVFIGKTRLIDNLLIEPSTAGPEEFMFQL |
| Ga0187819_104146011 | 3300017943 | Freshwater Sediment | TFEPVVRVARPSYAVLAVFIGKTRLIDNLLIEPTSPGSEEFAFHL |
| Ga0187776_110214081 | 3300017966 | Tropical Peatland | EPVVRISRACFVMLAVFIGKTRLIDNLYAEPKETDSDEFVFHL |
| Ga0187767_103356702 | 3300017999 | Tropical Peatland | VSKACYVLLAVFIGKTRLIDNLYVEPKSPGSDELVFHL |
| Ga0187800_18264601 | 3300019278 | Peatland | VDAESFEPVTRVSRACYVLLAVFIGKTRLIDNLYVAPKEPGSDELVFQL |
| Ga0179592_100178141 | 3300020199 | Vadose Zone Soil | SCYVLLAVFIGKTRLIDNLYVEPKSPGSEDLVFHF |
| Ga0179592_100669143 | 3300020199 | Vadose Zone Soil | VSKPCYVLLAVFVGKTRLIDNLYIEPKSFDSDELVFHF |
| Ga0210407_103019473 | 3300020579 | Soil | TEIVDAQSFEPVMRVSKPCYVLLAVFIGKTRLIDNLYIEPKSADTDELVFHF |
| Ga0210399_109892151 | 3300020581 | Soil | PCYAVLAVFLGKTRLIDNLFIEPAADGAEELRFHL |
| Ga0210401_103690761 | 3300020583 | Soil | RVARPCYAVLAVFLGKTRLIDNLFIEPAADGAEELRFHL |
| Ga0210401_112903482 | 3300020583 | Soil | VVRVSKPSYILLAVFVGKTRLIDNLYIEPKSPDSEELVFHF |
| Ga0210404_102950471 | 3300021088 | Soil | FEPVARVGKPSYILLAVFIGKTRLIDNLYIEPKSPGSEELVFHF |
| Ga0210400_101624351 | 3300021170 | Soil | VARVSKPCYVLLAVFIGKTRLIDNLYVEPKSSDSEELVFHF |
| Ga0210408_109570281 | 3300021178 | Soil | PCFVLLAVFIGKTRLIDNLYVEPKSPDLEELVFHF |
| Ga0210408_112044581 | 3300021178 | Soil | VVRVARPCFAVLAVFLGNTRLIDNLFIEPVPGESEELVFQL |
| Ga0210388_105781754 | 3300021181 | Soil | VARPSYAVLAVFIGKTRLIDNLLIEPVAQGSEEFVFHL |
| Ga0210388_109118503 | 3300021181 | Soil | TFEPVVRVARPCYVVLAVFLGKTRLIDNLYIEPAATASDDLIFHT |
| Ga0210397_111347251 | 3300021403 | Soil | AETFETVMRISKPCYVVLAVFIGKTRLIDNLYIEPKVPGSEELAIQI |
| Ga0210386_107926291 | 3300021406 | Soil | EAVVRVARPCYAVLAVFLGKTRLIDNLYIEPGATASDDLIFHL |
| Ga0210384_100413481 | 3300021432 | Soil | QSFEQVARVRPNSYLLLAVRIGKTRLIDNLLVEAAGPDSEELLFQL |
| Ga0187846_104843722 | 3300021476 | Biofilm | RRSCFALLAVFIGKTRLIDNLLVERSGTDSEELLFHL |
| Ga0210398_101357701 | 3300021477 | Soil | VVRVARPSYAVLAVFIGKTRLIDNLLIEPVAQGSEEFVFHL |
| Ga0210402_106729392 | 3300021478 | Soil | EAIARVGKPCYIVLAVFVGKTRLIDNLYIEPKAPGSDELAIQI |
| Ga0210402_113990221 | 3300021478 | Soil | FEPVVRVSRSSYALLAVYIGNTRLIDNLFIEPASEGSDELRLEL |
| Ga0242654_103332291 | 3300022726 | Soil | PVVRVNKSCYVLLAVFIGKTRLIDNLYVETRSPGSEELVFHF |
| Ga0247666_10126164 | 3300024323 | Soil | RVVRSCYAVLAVFVGKTRLIDNLLIEPASGRSEELNFHL |
| Ga0137417_10276352 | 3300024330 | Vadose Zone Soil | KPSYILLAVFIGKTRLIDNLYIEPKSPGSEELVFHF |
| Ga0209268_10018651 | 3300026314 | Soil | VVRVRKPCYVLLAVFIGKARLIDNLFVEPKSSDSEELVFHF |
| Ga0209268_10131341 | 3300026314 | Soil | PCYALLAVFIGKTRLIDNLYMEPKSSDSEELVFHF |
| Ga0209131_11665403 | 3300026320 | Grasslands Soil | VVRVSKPSYILLAVFIGKTRLIDNLYMEPKSQVSEELVFHF |
| Ga0209802_12185412 | 3300026328 | Soil | FEPVVRVNKPCYVVLAVFIGKTRLIDNLNVEPKSSDSDELVFHF |
| Ga0209377_10221704 | 3300026334 | Soil | RLSEPSYIVLAVFIGKTRLIDNLYIEPKAPGSDELLFHF |
| Ga0257163_10263331 | 3300026359 | Soil | PSYILLAVFIGKTRLIDNLYIEPKSPGSEELVFHF |
| Ga0257181_10355821 | 3300026499 | Soil | AEVVDAESFEPAARVSKPAYLLLAVFIGKTRLIDNLYIEPKSPGSEELVFHF |
| Ga0209806_12900351 | 3300026529 | Soil | AEIVDAESFEPAIRVSKPCYVLLAVFIGTTRLIDNLFVEPKSSNSEELVFHF |
| Ga0209056_103404482 | 3300026538 | Soil | AESFEPVVRVSKPTYILLAVFIGKTRLIDNLYVEPKSSDSEELVFHF |
| Ga0209805_11337811 | 3300026542 | Soil | RVRKPCYVLLAVFVGKTRLIDNLYIEPKLSDSEELVFHF |
| Ga0209805_14167091 | 3300026542 | Soil | NKACYVLLAVFFGKTRLIDNLYVEPASPNSDDLLFHL |
| Ga0209648_102098423 | 3300026551 | Grasslands Soil | YKPCYVLLAVFIGKTRLIDNLYVEPKSPDLEELVFHF |
| Ga0209648_105348541 | 3300026551 | Grasslands Soil | FEPVLRVNKPCYVLLAVFIGKTRLIDNLYVEPKSPDSEELVFQF |
| Ga0209648_105670252 | 3300026551 | Grasslands Soil | RVNKPSYILLAVFFGKTRLIDNLYIEPKSPGSEELVFHF |
| Ga0209733_10411593 | 3300027591 | Forest Soil | MSTNNTFLAVFIGKTRLIDNLYVEPKLSDSEELVFHF |
| Ga0209117_11793682 | 3300027645 | Forest Soil | PSYILLAVFIGKTRLIDNLYIEPKSSDSEELVFHF |
| Ga0209117_11977141 | 3300027645 | Forest Soil | VVRVSKPCYVLLAVFIGKTRLIDNLYIEPKSPGSEELVFHF |
| Ga0209388_11012552 | 3300027655 | Vadose Zone Soil | SKPCYVLLAVFIGKTRLIDNLYIEPKSPGSEDLVFHF |
| Ga0209689_100045425 | 3300027748 | Soil | ESFEPVIRVSKPCYVLLAVFIGKTRLIDNLFVEPKSSNSEELVFHF |
| Ga0209040_103990823 | 3300027824 | Bog Forest Soil | FEPVVRVARPSYAVLAVHIGKTRLIDNLLIEPVPQGSEEFVFHL |
| Ga0209067_106254871 | 3300027898 | Watersheds | VSKPCYVLLAVFIGKTRLIDNLYIEPKPAGSEDLEIHC |
| Ga0209488_108777482 | 3300027903 | Vadose Zone Soil | VSKPCFVLLAVFIGKTRLIDNLYVEPKSSDSEELVFHF |
| Ga0209488_112048221 | 3300027903 | Vadose Zone Soil | VRVNKPCYVLLAVFIGKTRLIDNLYVEPKSSDSEELVFHF |
| Ga0209698_103364944 | 3300027911 | Watersheds | SCYVLLAVFIGKTRLIDNLLVEPRETDSDEFLIHL |
| Ga0247663_10991841 | 3300028145 | Soil | RPSYAVLAVFIGKTRLIDNLFIEPVERGSEESVFHL |
| Ga0307469_118380291 | 3300031720 | Hardwood Forest Soil | AFEPVVRVSKSSYIVLAVFIGKTRLIDNLFIEPKAPGSDELLFHF |
| Ga0318565_100697251 | 3300031799 | Soil | FEPVVRVSRACYVLLAVFIGKTRLLDNLFVEPSAPGSDELVFHL |
| Ga0310913_100258881 | 3300031945 | Soil | VDAESFEPAPRVNRACYVLLAVFVGKTRLIDNLYVERKSPGSDRLVFHL |
| Ga0307479_109797612 | 3300031962 | Hardwood Forest Soil | VRVSKPCYVLLAVFIGKTRLIDNLYIEPKSPDSEELLFHF |
| Ga0318533_107263701 | 3300032059 | Soil | AEVVDAESFEPAPRVNRACYVLLAVFVGKTRLIDNLYVERKSPGSDRLVFHL |
| Ga0307472_1011344401 | 3300032205 | Hardwood Forest Soil | KSSYIVLAVFIGKTRLIDNLYMEPKAPGSDELVFHF |
| Ga0334854_113571_2_148 | 3300033829 | Soil | AESFEPVVRVSRACYVLLAVYLGKTRLIDNMLIEPRENGSEDDFDFQL |
| ⦗Top⦘ |