


| Basic Information | |
|---|---|
| Family ID | F068552 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KGIELILGLISKTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWGEK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.23 % |
| % of genes near scaffold ends (potentially truncated) | 94.35 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.484 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.484 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.33% β-sheet: 0.00% Coil/Unstructured: 58.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02776 | TPP_enzyme_N | 33.87 |
| PF09084 | NMT1 | 16.13 |
| PF07883 | Cupin_2 | 5.65 |
| PF00557 | Peptidase_M24 | 1.61 |
| PF13379 | NMT1_2 | 1.61 |
| PF02775 | TPP_enzyme_C | 1.61 |
| PF01243 | Putative_PNPOx | 1.61 |
| PF13531 | SBP_bac_11 | 0.81 |
| PF14226 | DIOX_N | 0.81 |
| PF04392 | ABC_sub_bind | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF02371 | Transposase_20 | 0.81 |
| PF04909 | Amidohydro_2 | 0.81 |
| PF04545 | Sigma70_r4 | 0.81 |
| PF03308 | MeaB | 0.81 |
| PF06808 | DctM | 0.81 |
| PF13185 | GAF_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 16.13 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 16.13 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.39 % |
| Unclassified | root | N/A | 1.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459022|GZEQPF102H87ES | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 2209111006|2214798290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
| 2228664021|ICCgaii200_c0841349 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300001976|JGI24752J21851_1029848 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300002120|C687J26616_10054679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1374 | Open in IMG/M |
| 3300003892|Ga0063012_10087053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300004022|Ga0055432_10129183 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300004024|Ga0055436_10307323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300004463|Ga0063356_101411444 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300004463|Ga0063356_102320692 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005093|Ga0062594_101094202 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005218|Ga0068996_10124573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300005294|Ga0065705_10630253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300005330|Ga0070690_100722710 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005332|Ga0066388_100349266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2125 | Open in IMG/M |
| 3300005332|Ga0066388_105677481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300005353|Ga0070669_101097605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300005356|Ga0070674_100184552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1600 | Open in IMG/M |
| 3300005364|Ga0070673_101840853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300005446|Ga0066686_10103242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1839 | Open in IMG/M |
| 3300005446|Ga0066686_10812114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300005471|Ga0070698_100635624 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005518|Ga0070699_102056174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005543|Ga0070672_101919577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300005546|Ga0070696_100538341 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005552|Ga0066701_10005443 | All Organisms → cellular organisms → Bacteria | 5286 | Open in IMG/M |
| 3300005577|Ga0068857_102565894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300005875|Ga0075293_1015348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300005937|Ga0081455_10597040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300006049|Ga0075417_10107539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300006844|Ga0075428_100123706 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
| 3300006847|Ga0075431_101255260 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006853|Ga0075420_100830267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300006854|Ga0075425_101485541 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300006914|Ga0075436_100052067 | All Organisms → cellular organisms → Bacteria | 2825 | Open in IMG/M |
| 3300006914|Ga0075436_100152274 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300009100|Ga0075418_12543895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300009137|Ga0066709_103320225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300009147|Ga0114129_12267599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300009162|Ga0075423_11024318 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300009174|Ga0105241_12677471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300009177|Ga0105248_13099975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300009691|Ga0114944_1302941 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010029|Ga0105074_1041007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300010043|Ga0126380_11707114 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010047|Ga0126382_11626930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300010358|Ga0126370_10123715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1838 | Open in IMG/M |
| 3300010358|Ga0126370_12144745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300010362|Ga0126377_10143045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2239 | Open in IMG/M |
| 3300010362|Ga0126377_10663650 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300010362|Ga0126377_10946231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 926 | Open in IMG/M |
| 3300010362|Ga0126377_13417394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300010375|Ga0105239_10941200 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300010376|Ga0126381_102676216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300010398|Ga0126383_11432919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22 | 780 | Open in IMG/M |
| 3300010399|Ga0134127_10361957 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300010400|Ga0134122_10112742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2168 | Open in IMG/M |
| 3300012039|Ga0137421_1032244 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300012039|Ga0137421_1167299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300012039|Ga0137421_1236167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300012040|Ga0137461_1188190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300012202|Ga0137363_11208293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300012209|Ga0137379_11027647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300012401|Ga0134055_1359382 | Not Available | 1440 | Open in IMG/M |
| 3300012685|Ga0137397_10259288 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300012685|Ga0137397_10344583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1110 | Open in IMG/M |
| 3300012685|Ga0137397_10580447 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012882|Ga0157304_1071176 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012922|Ga0137394_10247021 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300012931|Ga0153915_10538011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1338 | Open in IMG/M |
| 3300012931|Ga0153915_11621542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17 | 757 | Open in IMG/M |
| 3300012948|Ga0126375_10002886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6079 | Open in IMG/M |
| 3300012971|Ga0126369_11343926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300012971|Ga0126369_12334654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300012977|Ga0134087_10644342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300014268|Ga0075309_1203042 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300014270|Ga0075325_1229365 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300014861|Ga0180061_1055424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300015053|Ga0137405_1403425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2368 | Open in IMG/M |
| 3300015245|Ga0137409_10118206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2444 | Open in IMG/M |
| 3300015373|Ga0132257_100893502 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300015373|Ga0132257_102086363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300015374|Ga0132255_100672752 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300015374|Ga0132255_102102635 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300016270|Ga0182036_10328192 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300016445|Ga0182038_10196031 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300018054|Ga0184621_10193558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300018064|Ga0187773_10709535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300018064|Ga0187773_11171662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300018066|Ga0184617_1047159 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300018075|Ga0184632_10330438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300018084|Ga0184629_10436586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300018084|Ga0184629_10683814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300019878|Ga0193715_1070775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300019889|Ga0193743_1256479 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300022534|Ga0224452_1283925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300025160|Ga0209109_10018362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3767 | Open in IMG/M |
| 3300025313|Ga0209431_10088316 | Not Available | 2433 | Open in IMG/M |
| 3300025319|Ga0209520_10556861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300025322|Ga0209641_10249032 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300025324|Ga0209640_10202095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1688 | Open in IMG/M |
| 3300025326|Ga0209342_10326755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1324 | Open in IMG/M |
| 3300025905|Ga0207685_10097699 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300025937|Ga0207669_10568648 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300025939|Ga0207665_10448870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300026066|Ga0208290_1028821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300026298|Ga0209236_1107444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300026323|Ga0209472_1239212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300026324|Ga0209470_1048227 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300026529|Ga0209806_1274224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300027378|Ga0209981_1009548 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300027840|Ga0209683_10216849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300027874|Ga0209465_10053417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1936 | Open in IMG/M |
| 3300028802|Ga0307503_10494065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300031719|Ga0306917_11206099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300031854|Ga0310904_11184802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300031941|Ga0310912_10526979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300031941|Ga0310912_10582042 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300031942|Ga0310916_10736357 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031949|Ga0214473_11238808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300032179|Ga0310889_10465323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300033813|Ga0364928_0008030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1904 | Open in IMG/M |
| 3300034148|Ga0364927_0092882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300034150|Ga0364933_066618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 897 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.06% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 4.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.81% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.81% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300003892 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - CP Core 2, 1cm | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA2_07868330 | 2170459022 | Grass Soil | FIGKTVPQAATTKPEDFYDPRFFNDLRESGFLKKLWGDKL |
| 2213826697 | 2209111006 | Arabidopsis Rhizosphere | TAMEKTLQVDPKGLELILEFIGKTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL |
| ICCgaii200_08413492 | 2228664021 | Soil | QKGLELILEFIAKTVPQAASAKVEDFYDPRFTNELRNSGFLKQLWGDKL |
| JGI24752J21851_10298482 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKTLQIDPKGLELILEFIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL* |
| C687J26616_100546791 | 3300002120 | Soil | SKTVPQAASARPEDFYDPRFFNELKDSEFLKRLWGN* |
| Ga0063012_100870531 | 3300003892 | Hot Spring Sediment | DRALVVDPEGISFVLGQIKKTVPQAASAKPEDFFDPRFFTELQKSGFLKSLWGEH* |
| Ga0055432_101291831 | 3300004022 | Natural And Restored Wetlands | VERTLQIDPKGIELILTLMSKSMPQATSAKNEEFYDSRFTNELRDSGFLKRLWVEK* |
| Ga0055436_103073232 | 3300004024 | Natural And Restored Wetlands | TLMSKSMPQGPSVKTEEFYDSRFTNELRDSGFLKKLWGDKL* |
| Ga0063356_1014114443 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LIAKSVPQAAAARPQDFFDSRFTADLRESGFLKRVWGETP* |
| Ga0063356_1023206921 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ILEFIAKTVPQAASAKVEDFYDPRFTNELRNSGFLKQLWGDKL* |
| Ga0062594_1010942021 | 3300005093 | Soil | LLLGFIAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS* |
| Ga0068996_101245731 | 3300005218 | Natural And Restored Wetlands | LMSKSMPQGPSVKTEEFYDPRFTNELRDSGFLKKLWGER* |
| Ga0065705_106302532 | 3300005294 | Switchgrass Rhizosphere | LALISKTVPQAASAKAEDFYDARFYTELRESGFLKKLWGEKP* |
| Ga0070690_1007227101 | 3300005330 | Switchgrass Rhizosphere | IGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL* |
| Ga0066388_1003492661 | 3300005332 | Tropical Forest Soil | KGIELILGLISKSVPQASSAKPADFYDPRFFNELRESGFLKRLWGDKL* |
| Ga0066388_1056774812 | 3300005332 | Tropical Forest Soil | VERTLQVAPKGIELILGLISKSVPQAASAKAQDFYDPHFFTELRDSGFLKKLWGEQ* |
| Ga0070669_1010976051 | 3300005353 | Switchgrass Rhizosphere | KTLRVDPKGVELLLGFIAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS* |
| Ga0070674_1001845521 | 3300005356 | Miscanthus Rhizosphere | EFVGKSMPQSPSAKVEEFYDPRFTNELRNSGFLKQLWGEKL* |
| Ga0070673_1018408532 | 3300005364 | Switchgrass Rhizosphere | PKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRESGFLKKLWGNKL* |
| Ga0066686_101032423 | 3300005446 | Soil | LWDPKGIELILGLIGKTVPQAASAKPEDFYVPRFFTELRDSGFLK |
| Ga0066686_108121141 | 3300005446 | Soil | KGIELILGLIGKTVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK* |
| Ga0070698_1006356241 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDPKGLELILGLIGKTVPQAASTKPEDFYDPRFTNDLRDSGFLKKLWGENL* |
| Ga0070699_1020561742 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KGIELVLGLISKTVPQAASAKPEDFYDARFFTELKDSGFLKRLWGEN* |
| Ga0070672_1019195771 | 3300005543 | Miscanthus Rhizosphere | MEKTLQVDPKGLELILEFIGKTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL* |
| Ga0070696_1005383412 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ILGFIGKTVPQAASAKPEDFYDPRFTNELRDSGFLKKLWGDK* |
| Ga0066701_100054431 | 3300005552 | Soil | QVEPKGIELILGLIGKTVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK* |
| Ga0068857_1025658941 | 3300005577 | Corn Rhizosphere | LQVDPKGIELILGLIGKSVSPGATARPQDFYDSRFSAELKDSGFLKRLWGETL* |
| Ga0075293_10153481 | 3300005875 | Rice Paddy Soil | LILGLISKAVPQAASAKAEDFYDPRFFSELRDSGFLKKLWGNKL* |
| Ga0081455_105970401 | 3300005937 | Tabebuia Heterophylla Rhizosphere | TPQATSAKAQDFYDPRFFNELRDSGFLKKLWAEK* |
| Ga0075417_101075391 | 3300006049 | Populus Rhizosphere | LELILSLIGKTVPQAAATKPEDFYDPRFTNELRDSGFLKKLWGEK* |
| Ga0075428_1001237064 | 3300006844 | Populus Rhizosphere | VPQAASAKAEDFYDARFYTELRESGFLKRLWGEKP* |
| Ga0075431_1012552603 | 3300006847 | Populus Rhizosphere | ELILALISKTVPQAASAKAEDFYDARFYNELRDSGFLKRLWGEKP* |
| Ga0075420_1008302671 | 3300006853 | Populus Rhizosphere | LISKTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWGEQ* |
| Ga0075425_1014855412 | 3300006854 | Populus Rhizosphere | LALISKTVPQAASAKAEDFYDARFYTELRESGFLKRLWGEKP* |
| Ga0075436_1000520674 | 3300006914 | Populus Rhizosphere | ELILGLISKSVPQAVSAKAQDFYDPRFFTELRDSGFLKRLWGDKA* |
| Ga0075436_1001522741 | 3300006914 | Populus Rhizosphere | AKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS* |
| Ga0075418_125438951 | 3300009100 | Populus Rhizosphere | TVPQAASAKAEDFYDARFYNELRDSGFLKRLWGEKP* |
| Ga0066709_1033202252 | 3300009137 | Grasslands Soil | VPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK* |
| Ga0114129_122675991 | 3300009147 | Populus Rhizosphere | TVPQAASAKAEDFYDPRFFNELRDSGFLKKLWAEK* |
| Ga0075423_110243181 | 3300009162 | Populus Rhizosphere | ELILGLISKAVPQATSAKPEEFYDPRFFTELKESGFLKKLWGEN* |
| Ga0105241_126774712 | 3300009174 | Corn Rhizosphere | LGLISKTVPQATSAKSEDFYDARFFSELKETGFLKTLWREN* |
| Ga0105248_130999751 | 3300009177 | Switchgrass Rhizosphere | KTLQVDPKGLELILEFVGKSMPQSPSAKVEEFYDPRFTNELRNSGFLKQLWGEKL* |
| Ga0114944_13029411 | 3300009691 | Thermal Springs | PKGIELILEVISKTVPQAASAKPEDFYDSRFFTELKESGLLKRLWGER* |
| Ga0105074_10410072 | 3300010029 | Groundwater Sand | VPQAASAKAEDFYDPRFFTELRDSGFLKKLWAEK* |
| Ga0126380_117071142 | 3300010043 | Tropical Forest Soil | ILTLISKTVPQAASAKAEDFYDARFYTELRDSGFLKRLWGDKP* |
| Ga0126382_116269301 | 3300010047 | Tropical Forest Soil | LQVDAKGLDLILGFISKTVPQAASAKPEDFYDPRFTNELRESGFLKKLWGEKL* |
| Ga0126370_101237151 | 3300010358 | Tropical Forest Soil | LILGLISKSVPQAASAKPEDFYDARFFTELKDSGFLKRVWAEN* |
| Ga0126370_121447452 | 3300010358 | Tropical Forest Soil | VERTLQVAPKGIELILGLISKSVPQAASAKAQDFYDPHFFTELRDSGFL |
| Ga0126377_101430455 | 3300010362 | Tropical Forest Soil | LISKTTPQAASAKAQDFYDPRFFTELRNSGFLKKLWAEK* |
| Ga0126377_106636503 | 3300010362 | Tropical Forest Soil | LISKTVPQAASAKAEDFYDARFYTELRDSGFLKRLWGEKP* |
| Ga0126377_109462311 | 3300010362 | Tropical Forest Soil | NRTAPQPFSAKPEDFYDARFTNDLRDSGFLKKLWGDK* |
| Ga0126377_134173941 | 3300010362 | Tropical Forest Soil | LISKSVPQAASAKAQDFYDPRFFNELRDSGFLKKLWGEQ* |
| Ga0105239_109412001 | 3300010375 | Corn Rhizosphere | KTVPQATSAKSEDFYDARFFSELKETGFLKTLWREN* |
| Ga0126381_1026762161 | 3300010376 | Tropical Forest Soil | AVQRSLEVDPKGVELILGLISKSVPQAASAKPEDFYDARFFTELKDSGFLKRVWAEN* |
| Ga0126383_114329191 | 3300010398 | Tropical Forest Soil | GIDLILGIIAKTVPQAASAKVEDFYDPRFSNELRESGFLKKLWGEK* |
| Ga0134127_103619572 | 3300010399 | Terrestrial Soil | DPKGVELLLGFIAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS* |
| Ga0134122_101127421 | 3300010400 | Terrestrial Soil | GLELILAFIAKTVPQAAIAKSEDFHDPRFTNEMKDSGYLKRLWGEN* |
| Ga0137421_10322441 | 3300012039 | Soil | VPQAASAKAEDFYDARFYTELRDSGFLKKLWGEKP* |
| Ga0137421_11672991 | 3300012039 | Soil | VDPKDIELILGLIANSLLQAPSARAQDFYDSRFSADLRDSGFLKRLWGES* |
| Ga0137421_12361672 | 3300012039 | Soil | LVWIKHGIELILGLIGKSVPQAATARPQDFYDSRFTTDLRDSGFLKRLWGEAL* |
| Ga0137461_11881901 | 3300012040 | Soil | DPKGIELILGLIAKSVPQAASARAQDFYDSRFSADLKDSGFLKRLWGES* |
| Ga0137363_112082932 | 3300012202 | Vadose Zone Soil | ILGLIAKTVPQAASAKPEDFYDPRFFAELRDSGFLKGLWGEK* |
| Ga0137379_110276472 | 3300012209 | Vadose Zone Soil | QVDPKGLELILSLIGKTVPQAAATKPEDFYDPRFTNELRDSGFLNKLWGEKL* |
| Ga0134055_13593823 | 3300012401 | Grasslands Soil | GKTVPQAASAKPEDFYVPRFFTELRDSGFLKRLWGES* |
| Ga0137397_102592881 | 3300012685 | Vadose Zone Soil | TVPQAASAKPEDFYDARFYTELRDSGFLKRLWGEKP* |
| Ga0137397_103445831 | 3300012685 | Vadose Zone Soil | DPKGIELILGLIGKTVPQAASAKAEDFYDLRFTTELRESGFLKRLWGEKL* |
| Ga0137397_105804471 | 3300012685 | Vadose Zone Soil | TVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL* |
| Ga0157304_10711761 | 3300012882 | Soil | DPKGLELILEFIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL* |
| Ga0137394_102470211 | 3300012922 | Vadose Zone Soil | PQAASAKAEDFYDARFYTELRDSGFLKRLWGEKP* |
| Ga0153915_105380111 | 3300012931 | Freshwater Wetlands | ILGLIGKTVPQAASAKPEEFYDSRFFTELKDSGFLKRLWGEH* |
| Ga0153915_116215422 | 3300012931 | Freshwater Wetlands | ELILGLIGKTVPQAASAKPEEFYDSRFFTELKDSGFLKRLWGEN* |
| Ga0126375_100028867 | 3300012948 | Tropical Forest Soil | MEKTLQIDPKGIDLILGIIAKTVPQAASAKVEDFYDPRFSNELRDSGFLKKLWGEN* |
| Ga0126369_113439263 | 3300012971 | Tropical Forest Soil | ILTLISKTVPQAASAKTEDFYDARFYTELRDSGFLKRLWGEKP* |
| Ga0126369_123346542 | 3300012971 | Tropical Forest Soil | KGLELILEFIAKTVPQAASAKPEDFYDSRFINDLRGSGFLKKLWGEKL* |
| Ga0134087_106443421 | 3300012977 | Grasslands Soil | GKTVPQAAATKPEDFYDPRFTNELRDSGFLKKLWGEKL* |
| Ga0075309_12030421 | 3300014268 | Natural And Restored Wetlands | KGIELILGLIRKTVPQAASAKAEDFYDARFFTELRESGFLKRLKGEKS* |
| Ga0075325_12293652 | 3300014270 | Natural And Restored Wetlands | LQVDPKGIELVLGLIRKTVPQAASAKADDFYDARFFTELRESGFLKRLKGEKS* |
| Ga0180061_10554241 | 3300014861 | Soil | LIAKSVPQAAAARPQDFYDSRFTADLRDSGFLKRLWGEAL* |
| Ga0137405_14034253 | 3300015053 | Vadose Zone Soil | LISKTVPQAASAKPEDFYDARFYTELRDSGFLKRLWGEKP* |
| Ga0137409_101182061 | 3300015245 | Vadose Zone Soil | MAVERTLQVDPKGIELILGLISKTVPQAASAKAEDFYDPRFFN |
| Ga0132257_1008935021 | 3300015373 | Arabidopsis Rhizosphere | TLRVDPKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRESGFLKKLWGNKL* |
| Ga0132257_1020863632 | 3300015373 | Arabidopsis Rhizosphere | TLRVDPKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRDSGFLKKLWG* |
| Ga0132255_1006727521 | 3300015374 | Arabidopsis Rhizosphere | LLGFIAKTVPQAGSAKPEEFYDPRFTNDLRDSGFLKKLWG* |
| Ga0132255_1021026352 | 3300015374 | Arabidopsis Rhizosphere | QVDPKGLELILEFIGKTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL* |
| Ga0182036_103281922 | 3300016270 | Soil | ELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL |
| Ga0182038_101960311 | 3300016445 | Soil | DPKGVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL |
| Ga0184621_101935581 | 3300018054 | Groundwater Sediment | RTLQVDPKWIELILALISKTVPQAASAKPEDFYDARFYTELRDSGFLKRLWGEKP |
| Ga0187773_107095351 | 3300018064 | Tropical Peatland | IGKTVPQAASAKPEDFYDPRFFNELRDSGFLKKLWGEK |
| Ga0187773_111716621 | 3300018064 | Tropical Peatland | NPKGLEQILAFIAKTVPQAASAKPEDFYDLRFTNELRDSGFLKRLWGES |
| Ga0184617_10471592 | 3300018066 | Groundwater Sediment | ILGLISKSLPQAASAKPQDFYDPRFAAELRDSGFLKRLWGAKL |
| Ga0184632_103304382 | 3300018075 | Groundwater Sediment | PKGIELILGLISKSVPQAASAKPEDFYDPRFFNELRDSGFLKKLWGEKY |
| Ga0184629_104365861 | 3300018084 | Groundwater Sediment | KDIELILGLIANSLLQAPSARAQDFYDSRFSADLRDSGFLKRLWGES |
| Ga0184629_106838141 | 3300018084 | Groundwater Sediment | TLQVDSKGVELILGFIGNTVPQAASAKPEDFYDPRFTNDLRDSGFLKRLWGEK |
| Ga0193715_10707752 | 3300019878 | Soil | PKGIELILALIGKTVPQAASAKAEDFYDARFTTELRDSGFLKKLWGDKL |
| Ga0193743_12564791 | 3300019889 | Soil | LILGLISKSLPQAASAKPQDFYDPRFAAELRDSGFLKRLWGDKL |
| Ga0224452_12839252 | 3300022534 | Groundwater Sediment | ILALINKSMPLAHSVKTEEFYDSRFTNELRDSGFLKRLWGEKL |
| Ga0209109_100183624 | 3300025160 | Soil | SKTVPQAASARPEDFYDPRFFNELKDSEFLKRLWGN |
| Ga0209431_100883163 | 3300025313 | Soil | MSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL |
| Ga0209520_105568611 | 3300025319 | Soil | LMSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL |
| Ga0209641_102490321 | 3300025322 | Soil | SKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL |
| Ga0209640_102020951 | 3300025324 | Soil | PKGIELILGLMSKSMPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGEK |
| Ga0209342_103267553 | 3300025326 | Soil | IKGKIPQAATAKAEEFYDPRFFTELRESGFLKSLWGEN |
| Ga0207685_100976992 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AMEKTLRVDPKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRESGFLKKLWGNKL |
| Ga0207669_105686483 | 3300025937 | Miscanthus Rhizosphere | EFIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL |
| Ga0207665_104488702 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ILALIGKTVPQAASAKAEDFYDARFTTELRDSGFLKKLWGDKL |
| Ga0208290_10288213 | 3300026066 | Natural And Restored Wetlands | LGLISKAVPQAASAKAEDFYDPRFFSELRDSGFLKKLWGNKP |
| Ga0209236_11074441 | 3300026298 | Grasslands Soil | TVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK |
| Ga0209472_12392121 | 3300026323 | Soil | LQVDPKGIDLILGLIGKTVPQAASAKPEDFFDARFTTELRDSGFLKRLWGDKL |
| Ga0209470_10482271 | 3300026324 | Soil | SLIGKTVPQAAATKPEDFYDRRFTNELRDSGFLKKLWGEKL |
| Ga0209806_12742241 | 3300026529 | Soil | GKTVPQAASAKPEDFFDARFTTELRDSGFLKRLWGDKL |
| Ga0209981_10095482 | 3300027378 | Arabidopsis Thaliana Rhizosphere | PKGIELILGLISKSVPQAASAKAEDFYDPRFFTELRDSGFLKKLWGDKL |
| Ga0209683_102168492 | 3300027840 | Wetland Sediment | KSMPQAISAKPEDFYDPRFSNDLRDSAFLKKLWGEK |
| Ga0209465_100534173 | 3300027874 | Tropical Forest Soil | VERTLQVAPKGIELILGLISKSVPQAASAKAQDFYDPHFFTELRDSG |
| Ga0307503_104940651 | 3300028802 | Soil | GKSVPQAASAKPEDFYDGRFTNELKDSGFLKRLWGEN |
| Ga0306917_112060991 | 3300031719 | Soil | KTLQVDPKGVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL |
| Ga0310904_111848022 | 3300031854 | Soil | KGIELILGLISKSVPQAGSAKAQDFYDPRFVNELRDSGFLKKLWADK |
| Ga0310912_105269791 | 3300031941 | Soil | VDPKGVELILGLISKTVPQAASAKPEDFYDARFFTELKDSGFLKRLWGEN |
| Ga0310912_105820421 | 3300031941 | Soil | TLQVDPKGVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL |
| Ga0310916_107363571 | 3300031942 | Soil | VELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL |
| Ga0214473_112388081 | 3300031949 | Soil | ILGLMSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL |
| Ga0310889_104653231 | 3300032179 | Soil | EVNPKGLELILAFIAKTVPQAATAKSEDFYDPRFTNEMRDSGFLKRLWGES |
| Ga0364928_0008030_1773_1889 | 3300033813 | Sediment | MSKSMPQAASAKPEDFYDPRFFTDLRDSGFLKKLWSEK |
| Ga0364927_0092882_711_830 | 3300034148 | Sediment | LISKTVPQAASAKAEDFYDPRFSNELRDSGFLKKLWGEK |
| Ga0364933_066618_753_896 | 3300034150 | Sediment | KGIELILGLISKTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWGEK |
| ⦗Top⦘ |