


| Basic Information | |
|---|---|
| Family ID | F068503 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.87 % |
| % of genes near scaffold ends (potentially truncated) | 89.52 % |
| % of genes from short scaffolds (< 2000 bps) | 95.97 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.548 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.419 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.613 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 16.67% Coil/Unstructured: 79.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07859 | Abhydrolase_3 | 8.87 |
| PF01068 | DNA_ligase_A_M | 7.26 |
| PF02668 | TauD | 5.65 |
| PF04909 | Amidohydro_2 | 2.42 |
| PF04392 | ABC_sub_bind | 0.81 |
| PF00682 | HMGL-like | 0.81 |
| PF05598 | DUF772 | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF09084 | NMT1 | 0.81 |
| PF13006 | Nterm_IS4 | 0.81 |
| PF13431 | TPR_17 | 0.81 |
| PF01565 | FAD_binding_4 | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF08402 | TOBE_2 | 0.81 |
| PF13738 | Pyr_redox_3 | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF05719 | GPP34 | 0.81 |
| PF04679 | DNA_ligase_A_C | 0.81 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF10009 | DUF2252 | 0.81 |
| PF00743 | FMO-like | 0.81 |
| PF10686 | YAcAr | 0.81 |
| PF00920 | ILVD_EDD | 0.81 |
| PF03466 | LysR_substrate | 0.81 |
| PF00536 | SAM_1 | 0.81 |
| PF13185 | GAF_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 8.87 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 8.06 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 7.26 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 5.65 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.61 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.55 % |
| Unclassified | root | N/A | 31.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10588200 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300001661|JGI12053J15887_10288590 | Not Available | 805 | Open in IMG/M |
| 3300001867|JGI12627J18819_10004790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5106 | Open in IMG/M |
| 3300001867|JGI12627J18819_10500303 | Not Available | 500 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101324629 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10092101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300004080|Ga0062385_10301141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiothrix → Thiothrix nivea → Thiothrix nivea DSM 5205 | 919 | Open in IMG/M |
| 3300004082|Ga0062384_101089574 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004091|Ga0062387_101215270 | Not Available | 591 | Open in IMG/M |
| 3300004091|Ga0062387_101276290 | Not Available | 579 | Open in IMG/M |
| 3300005166|Ga0066674_10303664 | Not Available | 750 | Open in IMG/M |
| 3300005367|Ga0070667_100919173 | Not Available | 815 | Open in IMG/M |
| 3300005531|Ga0070738_10398549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300005538|Ga0070731_11061423 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005607|Ga0070740_10154676 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300006954|Ga0079219_10223878 | Not Available | 1091 | Open in IMG/M |
| 3300009143|Ga0099792_11084594 | Not Available | 539 | Open in IMG/M |
| 3300009698|Ga0116216_10733315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300009698|Ga0116216_10911128 | Not Available | 526 | Open in IMG/M |
| 3300010039|Ga0126309_10633037 | Not Available | 678 | Open in IMG/M |
| 3300010045|Ga0126311_10558970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 902 | Open in IMG/M |
| 3300010341|Ga0074045_10845207 | Not Available | 578 | Open in IMG/M |
| 3300010360|Ga0126372_10959495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 863 | Open in IMG/M |
| 3300010360|Ga0126372_12659341 | Not Available | 552 | Open in IMG/M |
| 3300010366|Ga0126379_13197819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 548 | Open in IMG/M |
| 3300010376|Ga0126381_100912810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300010376|Ga0126381_102115993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300010376|Ga0126381_104557643 | Not Available | 534 | Open in IMG/M |
| 3300010379|Ga0136449_102254943 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300010396|Ga0134126_10790986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1073 | Open in IMG/M |
| 3300010400|Ga0134122_10761723 | Not Available | 918 | Open in IMG/M |
| 3300012203|Ga0137399_11101313 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012205|Ga0137362_11665759 | Not Available | 525 | Open in IMG/M |
| 3300012212|Ga0150985_101323127 | Not Available | 594 | Open in IMG/M |
| 3300012212|Ga0150985_104328451 | Not Available | 727 | Open in IMG/M |
| 3300012212|Ga0150985_116148858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300012212|Ga0150985_118980064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 32_A | 626 | Open in IMG/M |
| 3300012350|Ga0137372_10850165 | Not Available | 652 | Open in IMG/M |
| 3300012357|Ga0137384_11554282 | Not Available | 511 | Open in IMG/M |
| 3300012907|Ga0157283_10071255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis | 858 | Open in IMG/M |
| 3300012922|Ga0137394_10516049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300012957|Ga0164303_10496186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 780 | Open in IMG/M |
| 3300012961|Ga0164302_11352859 | Not Available | 578 | Open in IMG/M |
| 3300012989|Ga0164305_10471484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300014325|Ga0163163_11389350 | Not Available | 764 | Open in IMG/M |
| 3300015371|Ga0132258_11501112 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300016294|Ga0182041_10553425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300016294|Ga0182041_11117697 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300016341|Ga0182035_11836907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300016357|Ga0182032_10934688 | Not Available | 738 | Open in IMG/M |
| 3300016371|Ga0182034_10104359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2039 | Open in IMG/M |
| 3300016371|Ga0182034_10641736 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300016371|Ga0182034_11493731 | Not Available | 592 | Open in IMG/M |
| 3300016371|Ga0182034_11583174 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300016445|Ga0182038_10434035 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300017822|Ga0187802_10238322 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300017943|Ga0187819_10446485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300017973|Ga0187780_11345578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300017975|Ga0187782_10438054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 996 | Open in IMG/M |
| 3300017995|Ga0187816_10408738 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300018006|Ga0187804_10353585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300020581|Ga0210399_11144642 | Not Available | 620 | Open in IMG/M |
| 3300020582|Ga0210395_10122060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1935 | Open in IMG/M |
| 3300020583|Ga0210401_10619641 | Not Available | 943 | Open in IMG/M |
| 3300021168|Ga0210406_10680753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 794 | Open in IMG/M |
| 3300021171|Ga0210405_11404218 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021180|Ga0210396_11165324 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021404|Ga0210389_11485625 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021406|Ga0210386_10029849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4276 | Open in IMG/M |
| 3300021407|Ga0210383_10585285 | Not Available | 962 | Open in IMG/M |
| 3300021560|Ga0126371_10289952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1761 | Open in IMG/M |
| 3300021560|Ga0126371_10492478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1374 | Open in IMG/M |
| 3300021560|Ga0126371_12923146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 579 | Open in IMG/M |
| 3300022557|Ga0212123_10368981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300022720|Ga0242672_1044040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 729 | Open in IMG/M |
| 3300022726|Ga0242654_10137940 | Not Available | 803 | Open in IMG/M |
| 3300025917|Ga0207660_11439427 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300025929|Ga0207664_11451921 | Not Available | 607 | Open in IMG/M |
| 3300025930|Ga0207701_10488282 | Not Available | 1055 | Open in IMG/M |
| 3300025986|Ga0207658_10903939 | Not Available | 804 | Open in IMG/M |
| 3300026095|Ga0207676_11160020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 765 | Open in IMG/M |
| 3300026340|Ga0257162_1051266 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026360|Ga0257173_1032721 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300026482|Ga0257172_1070702 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300026555|Ga0179593_1112931 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300026880|Ga0209623_1011586 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300027173|Ga0208097_1002907 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300027376|Ga0209004_1007990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1513 | Open in IMG/M |
| 3300027521|Ga0209524_1090902 | Not Available | 641 | Open in IMG/M |
| 3300027706|Ga0209581_1258670 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027905|Ga0209415_10193305 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300028047|Ga0209526_10807838 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300030494|Ga0310037_10239601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300030741|Ga0265459_12777926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300031543|Ga0318516_10536388 | Not Available | 670 | Open in IMG/M |
| 3300031544|Ga0318534_10182534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1212 | Open in IMG/M |
| 3300031545|Ga0318541_10478673 | Not Available | 696 | Open in IMG/M |
| 3300031546|Ga0318538_10007038 | All Organisms → cellular organisms → Bacteria | 4428 | Open in IMG/M |
| 3300031546|Ga0318538_10126079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1340 | Open in IMG/M |
| 3300031561|Ga0318528_10012332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cenepequi | 3918 | Open in IMG/M |
| 3300031572|Ga0318515_10369080 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300031744|Ga0306918_10149689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300031744|Ga0306918_10995237 | Not Available | 651 | Open in IMG/M |
| 3300031771|Ga0318546_11086889 | Not Available | 562 | Open in IMG/M |
| 3300031792|Ga0318529_10246330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300031792|Ga0318529_10396817 | Not Available | 642 | Open in IMG/M |
| 3300031796|Ga0318576_10618047 | Not Available | 510 | Open in IMG/M |
| 3300031835|Ga0318517_10362084 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031859|Ga0318527_10329603 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031879|Ga0306919_11347743 | Not Available | 539 | Open in IMG/M |
| 3300031890|Ga0306925_11633193 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031897|Ga0318520_10536601 | Not Available | 724 | Open in IMG/M |
| 3300031912|Ga0306921_10413508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1574 | Open in IMG/M |
| 3300031962|Ga0307479_11368022 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031981|Ga0318531_10200763 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300032090|Ga0318518_10680507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300032174|Ga0307470_11633200 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032180|Ga0307471_100524683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1335 | Open in IMG/M |
| 3300032205|Ga0307472_102146239 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300032783|Ga0335079_11992191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300032892|Ga0335081_11357931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300033289|Ga0310914_11779229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300033290|Ga0318519_10091972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
| 3300033290|Ga0318519_10958492 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105882001 | 3300001593 | Forest Soil | VDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| JGI12053J15887_102885902 | 3300001661 | Forest Soil | PLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| JGI12627J18819_100047905 | 3300001867 | Forest Soil | ANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| JGI12627J18819_105003031 | 3300001867 | Forest Soil | DGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| JGIcombinedJ26739_1013246292 | 3300002245 | Forest Soil | AVDGGDPLLANSCIFVGPEEPAFAGALGPVGAELLCLQFRRRARD* |
| JGIcombinedJ51221_100921012 | 3300003505 | Forest Soil | GEPLSANSCIFVGSKEPAFAGASGPVGAELLCLQFRRARD* |
| Ga0062385_103011411 | 3300004080 | Bog Forest Soil | VDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRHRARD* |
| Ga0062384_1010895742 | 3300004082 | Bog Forest Soil | GGDPLPANSCSFIGPEEPAFAGASGTVGAELLCLQFRRRAGD* |
| Ga0062387_1012152702 | 3300004091 | Bog Forest Soil | PLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRHRARD* |
| Ga0062387_1012762901 | 3300004091 | Bog Forest Soil | AVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0066674_103036641 | 3300005166 | Soil | WLVLAGDAAVDGGDPSPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0070667_1009191732 | 3300005367 | Switchgrass Rhizosphere | AAVDGGDPLPANSCIFVGPEEPAFAGASGRVGAELLCLQFRRRARD* |
| Ga0070738_103985492 | 3300005531 | Surface Soil | PANSCIFVSPQEPAIAGAAGRDGAELLCLQFRHRAHD* |
| Ga0070731_110614232 | 3300005538 | Surface Soil | ASSCVFIGPEEPAFAGASGRAGAELLCLQFRRRVRD* |
| Ga0070740_101546762 | 3300005607 | Surface Soil | GDIVIDGGDPLPANSCIFVGPQEPAFNAHSGRVGAELLCLQFRRRAPR* |
| Ga0079219_102238781 | 3300006954 | Agricultural Soil | AAVDGGDPLPANSCIFAGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0099792_110845941 | 3300009143 | Vadose Zone Soil | AGDAAVGGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0116216_107333152 | 3300009698 | Peatlands Soil | VLAGDAAVDGGDPLPANSCIFVGPEEPAFAGASGRVGAELLCLQFRRRARD* |
| Ga0116216_109111282 | 3300009698 | Peatlands Soil | AVDGGNPLPANSCIFVGPEEPAFAGASGRVGVELLCLQFRRRARG* |
| Ga0126309_106330371 | 3300010039 | Serpentine Soil | VDGGDPLPANSCIFVNPADPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0126311_105589702 | 3300010045 | Serpentine Soil | VLAGDAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARG* |
| Ga0074045_108452071 | 3300010341 | Bog Forest Soil | IRFRIFVGPEDPAFAGASGPVGAELLCLQFRRCARD* |
| Ga0126372_109594952 | 3300010360 | Tropical Forest Soil | SCIFVGPEDPAFAGASGPVGADLLCLQFRRRTRD* |
| Ga0126372_126593411 | 3300010360 | Tropical Forest Soil | VLAGDAAVDGSHPLPANSCIFVGPEDLAFAGASGPVGAGLLCLQFRRRARD* |
| Ga0126379_131978191 | 3300010366 | Tropical Forest Soil | VLAGDAAVDGGGPLPANSCIFVAPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0126381_1009128101 | 3300010376 | Tropical Forest Soil | VLAGDAAVDGGDPLPANSCIFVGREDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0126381_1021159932 | 3300010376 | Tropical Forest Soil | DPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRCARD* |
| Ga0126381_1045576432 | 3300010376 | Tropical Forest Soil | DGGDPLPANSCIFVGPEEPAFIGASGPVGAELLCLQFHRRAAA* |
| Ga0136449_1022549432 | 3300010379 | Peatlands Soil | VLAGDAAVDGGDPLPANSCIFVGPEDPTFAGTSGRVGVELLCLQFRRRARD* |
| Ga0134126_107909863 | 3300010396 | Terrestrial Soil | AGEAAIDGGDPLPANSCIFVGPQDPALAGASGPVGAELLCLQFRRRARD* |
| Ga0134122_107617232 | 3300010400 | Terrestrial Soil | SCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0137399_111013132 | 3300012203 | Vadose Zone Soil | AGDAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0137362_116657591 | 3300012205 | Vadose Zone Soil | DAAVDDGDRLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0150985_1013231272 | 3300012212 | Avena Fatua Rhizosphere | VDGGDPLPANSCIFVGPEDPAFTGASGPVGAELLCLQFRRRARD* |
| Ga0150985_1043284513 | 3300012212 | Avena Fatua Rhizosphere | LPANSCIFVGPEDPAFDGASGPVGAELLCLQFRRRARD* |
| Ga0150985_1161488582 | 3300012212 | Avena Fatua Rhizosphere | VEGDDPLPANSCIFVGPEDPAFAGASGPVGTELLCLRFRRRARG* |
| Ga0150985_1189800641 | 3300012212 | Avena Fatua Rhizosphere | LAGDAAVDGGDPLPANSCIFVGPQDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0137372_108501651 | 3300012350 | Vadose Zone Soil | LVLTGDAAVNGGDPLPADSCIFVGPEDPAFAGTSGPVGAELLCLQFRRRARD* |
| Ga0137384_115542821 | 3300012357 | Vadose Zone Soil | AVDGGDPLPANSCIFVSPEDPAFAGASGPVGAELLCLQFRRRTRD* |
| Ga0157283_100712552 | 3300012907 | Soil | GGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0137394_105160492 | 3300012922 | Vadose Zone Soil | GGGQFLLVLAGNAAVDGGDPLPANSCIFIGPEDPAFAGASGPVGAELLCLQFRRRTRD* |
| Ga0164303_104961862 | 3300012957 | Soil | MLAGDAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0164302_113528593 | 3300012961 | Soil | GDAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD* |
| Ga0164305_104714842 | 3300012989 | Soil | GDPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRRARA* |
| Ga0163163_113893501 | 3300014325 | Switchgrass Rhizosphere | LHRDCRGAPSAGGDPLPANSCIFVGPQDPAFAGASGPVGAELLGLQFRRCARD* |
| Ga0132258_115011121 | 3300015371 | Arabidopsis Rhizosphere | NALPANSCIFVGPEDPAFAGASGPAGAELLCLQFRRARA* |
| Ga0182041_105534252 | 3300016294 | Soil | GDAAVDGGDPLPANSCIFVGSKEPAFAGASGPVGAELLCLQFRLHAGLNPAR |
| Ga0182041_111176972 | 3300016294 | Soil | EGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0182035_118369072 | 3300016341 | Soil | LPANSCIFVGPEEPALAGASGRVGVELVCLQFRRGARD |
| Ga0182032_109346881 | 3300016357 | Soil | GDAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGGELLCLQFRRRAPD |
| Ga0182034_101043592 | 3300016371 | Soil | VLAGDAAVDGGDPLPANSCIFVVPEDSAFAGASGPVGGELLCLQFRRRAPD |
| Ga0182034_106417363 | 3300016371 | Soil | LPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRAQE |
| Ga0182034_114937312 | 3300016371 | Soil | GDTAVNGGGPLPANSCIFVGPEDPTFAGTSGPVGAELLCLQFRRCARD |
| Ga0182034_115831741 | 3300016371 | Soil | GDAAVDGGDLLPANSCILIGPEELAFAGASGRVGAELVCLQFRRRARD |
| Ga0182038_104340352 | 3300016445 | Soil | GGDPLPANSCIFVGPEDPAFAGASGPVGGELLCLQFRRRAPD |
| Ga0187802_102383222 | 3300017822 | Freshwater Sediment | VLAGDAVVDGGDLLPANSCIFVDPEDPAFAGTSGRVGAELLCLQFRRRARD |
| Ga0187819_104464851 | 3300017943 | Freshwater Sediment | AAVDGGDPLPANSCIFVGSKEPAFAGASGPVGAELLCLQFRRARD |
| Ga0187780_113455781 | 3300017973 | Tropical Peatland | LVLAGDAAVDGGDPLPANSCIFVGPEDSAFAGASGPAGAELLCLQFRRRARD |
| Ga0187782_104380542 | 3300017975 | Tropical Peatland | VLAGDAAVDGGDPLPANSCIFVGSKEPAFAGASGPVGAELLCLQFRRRARD |
| Ga0187816_104087382 | 3300017995 | Freshwater Sediment | PANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0187804_103535851 | 3300018006 | Freshwater Sediment | DPLPANSCIFVGPEDPAFAGTSGRVGVELLCLQFRRRAWD |
| Ga0210399_111446421 | 3300020581 | Soil | RTHARFVGPEEPAFAGALGPVGAELLCLQFRRRARD |
| Ga0210395_101220601 | 3300020582 | Soil | PLPANSCIFVGSTEPAFAGASGPVGAELLCLQFRRAGLNPAR |
| Ga0210401_106196411 | 3300020583 | Soil | DTAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRHRARD |
| Ga0210406_106807531 | 3300021168 | Soil | AAVDGGDPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRRARD |
| Ga0210405_114042182 | 3300021171 | Soil | ANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0210396_111653241 | 3300021180 | Soil | AVDGGDPLPANSCIFVGSTEPAFAGASGPVGAELLCLQFRRAGLNPAR |
| Ga0210389_114856252 | 3300021404 | Soil | PLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0210386_100298491 | 3300021406 | Soil | DGDDPLPANSCIFVGPEEPAFAGTSGRAGAELLCLQLRCRARD |
| Ga0210383_105852853 | 3300021407 | Soil | VLAGDTAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRHRARD |
| Ga0126371_102899521 | 3300021560 | Tropical Forest Soil | DGGDRLPANSCIFVCPEEPAFAGASGRVGAELLCLQFRRRARD |
| Ga0126371_104924783 | 3300021560 | Tropical Forest Soil | VLAGGAAVDGGDPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRRARD |
| Ga0126371_129231462 | 3300021560 | Tropical Forest Soil | DGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRARD |
| Ga0212123_103689812 | 3300022557 | Iron-Sulfur Acid Spring | AVDGGDPLPANSCIFVGPEDPAFAGASGPAGAELLCLQFRRRSRD |
| Ga0242672_10440401 | 3300022720 | Soil | VLAGDAAVDGGDPLPANSCIFVGPEDPAFAGVSGPVGAELLCLQFRRRARD |
| Ga0242654_101379401 | 3300022726 | Soil | AAVDGGDPLPANSCIFVGPEDPAFVGASGPVGAELLCLQFRRRARD |
| Ga0207660_114394271 | 3300025917 | Corn Rhizosphere | GDLLPANSCIFVGPEEPPFAGASGPVGAELLCLQFRRRARD |
| Ga0207664_114519211 | 3300025929 | Agricultural Soil | AGDTAVDGGDPLLTNSCIFVGPEDPAFAGASGPVGAELLCLQFRHRARD |
| Ga0207701_104882821 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PLPANSCIFVGPEEPAFTGASGPVGAELLCLQFRRGPRD |
| Ga0207658_109039392 | 3300025986 | Switchgrass Rhizosphere | GGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0207676_111600201 | 3300026095 | Switchgrass Rhizosphere | VAVDGGNPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRRARD |
| Ga0257162_10512661 | 3300026340 | Soil | AAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0257173_10327211 | 3300026360 | Soil | NSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0257172_10707021 | 3300026482 | Soil | LPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0179593_11129311 | 3300026555 | Vadose Zone Soil | GDPLPANSCIFVGPEDPAIAGASGPVGAELLCLQFRRRARD |
| Ga0209623_10115861 | 3300026880 | Forest Soil | LVLAGDAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRTRD |
| Ga0208097_10029071 | 3300027173 | Forest Soil | TRPRSETRVSAAVDGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0209004_10079901 | 3300027376 | Forest Soil | GDAAVDGGDPLLANFCIFVGPEEPAFAGALGPVGAELLCLQFRRRARD |
| Ga0209524_10909022 | 3300027521 | Forest Soil | ANSCIFVGPEEPAFAGALGPVGAELLCLQFRRRARD |
| Ga0209581_12586702 | 3300027706 | Surface Soil | GDIVIDGGDPLPANSCIFVGPQEPAFNAHSGRVGAELLCLQFRRRAPR |
| Ga0209415_101933051 | 3300027905 | Peatlands Soil | LAGDAAVDGGDPLPANSCIFVGPEEPAFAGVSGRFGAELLCLQFRRRAHGDGAGRAPNQ |
| Ga0209526_108078381 | 3300028047 | Forest Soil | DGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0310037_102396011 | 3300030494 | Peatlands Soil | VLAGDAAVDGGDPLPANSCIFVGPEEPAFAGASGRVGAELLCLQFRRRARD |
| Ga0265459_127779262 | 3300030741 | Soil | LVLAGDAALDGGDPLPANSRIFVGPEEPAFAVASGRVGAELLCLQFRRRARD |
| Ga0318516_105363881 | 3300031543 | Soil | DGGDPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRCARD |
| Ga0318534_101825341 | 3300031544 | Soil | GDAAVDGGDPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRCARD |
| Ga0318541_104786731 | 3300031545 | Soil | LPANSCIFVGPEEPAFAGASGLVGAELLCLQFRRRARD |
| Ga0318538_100070385 | 3300031546 | Soil | VEGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRAQE |
| Ga0318538_101260793 | 3300031546 | Soil | VLAGDAAVDSGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRS |
| Ga0318528_100123321 | 3300031561 | Soil | GDAAVEGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRAQE |
| Ga0318515_103690801 | 3300031572 | Soil | VLTGDAAVEGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0306918_101496891 | 3300031744 | Soil | AAVDGDDPLPANSCIFVGSKEPAFAGASGPVGAELLCLQFRLHAGLNPAR |
| Ga0306918_109952371 | 3300031744 | Soil | GDAAVDGGDPLPANSCIFVVPEDSAFAGASGPVGAELLCLQFRRRARG |
| Ga0318546_110868891 | 3300031771 | Soil | DGGNPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0318529_102463301 | 3300031792 | Soil | DPLPANSCIFVGSKEPAFAGASGPVGAELLCLQFRLHAGLNPAR |
| Ga0318529_103968171 | 3300031792 | Soil | VDGGNPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0318576_106180472 | 3300031796 | Soil | VDGGDPLPANSCIFVGPEEPAFAGASGPVGAELLCLQFRRCARD |
| Ga0318517_103620841 | 3300031835 | Soil | AAVDGRDPLPDNSCIFVGSKEPAFAGASGPVGAELLCLQFRLHAGLNPAR |
| Ga0318527_103296031 | 3300031859 | Soil | VEGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRVRD |
| Ga0306919_113477431 | 3300031879 | Soil | AVDGGDPLPANSCIFVGPEDPAFAGASGPVGGELLCLQFRRRAPD |
| Ga0306925_116331931 | 3300031890 | Soil | GQLPANSCIFVGPEEPAFAGASGRVGAELLCLQFRRRARD |
| Ga0318520_105366011 | 3300031897 | Soil | LVLAGDAAVDGGDPLPANSCIFVGPEEPAFAGASGLVGAELLCLQFRRRARD |
| Ga0306921_104135084 | 3300031912 | Soil | DPLPANSCIFVGPEEPAFAGASGLVGAELLCLQFRRRARD |
| Ga0307479_113680222 | 3300031962 | Hardwood Forest Soil | AAVNGGDPLPANSCIFVGPDEPAFAGASGPVGAELLCLQFRRRRTREERATDASA |
| Ga0318531_102007631 | 3300031981 | Soil | LTGDAAVEGGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRAQE |
| Ga0318518_106805071 | 3300032090 | Soil | AVDAAVGGGAPLPANSCIFVGPEEPALAGASGRVGVELVCLQFRRGARD |
| Ga0307470_116332002 | 3300032174 | Hardwood Forest Soil | RSVAANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0307471_1005246833 | 3300032180 | Hardwood Forest Soil | DPLPANSCIFAGPEDPAFAGASGPVGAELLCLQFRHRARD |
| Ga0307472_1021462392 | 3300032205 | Hardwood Forest Soil | DAAVGCGDPLPANSCIFVGPEDPAFAGASGPVGAELLCLQFRRRARD |
| Ga0335079_119921911 | 3300032783 | Soil | GDPLPANSCIFVGPQDAAFAGAAGPFGAELLCLQFRRRARD |
| Ga0335081_113579312 | 3300032892 | Soil | PLPANSCIFVGPQDPAFAGASGPLGAELLCLQFRRGARD |
| Ga0310914_117792292 | 3300033289 | Soil | NSCIFVGPEEPALAGASGRVGVELVCLQFRRGARD |
| Ga0318519_100919724 | 3300033290 | Soil | ANSCIFVGPEEPAFAGASGLVGAELLCLQFRRRARD |
| Ga0318519_109584921 | 3300033290 | Soil | QLPANSCIFVGPEEPAFAGASGRVGAELLCLQFRRRARD |
| ⦗Top⦘ |