


| Basic Information | |
|---|---|
| Family ID | F068403 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAKDLNATGRWLKRLTQGLAEPQDREELLGVLREAGERGLV |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.35 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 91.13 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.194 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.194 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.613 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02130 | YbeY | 69.35 |
| PF02562 | PhoH | 27.42 |
| PF04055 | Radical_SAM | 2.42 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0319 | ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme | Translation, ribosomal structure and biogenesis [J] | 69.35 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 27.42 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 27.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.19 % |
| Unclassified | root | N/A | 0.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100401104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1250 | Open in IMG/M |
| 3300002914|JGI25617J43924_10205300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 656 | Open in IMG/M |
| 3300002916|JGI25389J43894_1002477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2763 | Open in IMG/M |
| 3300003911|JGI25405J52794_10168764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300004114|Ga0062593_102391150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 596 | Open in IMG/M |
| 3300005179|Ga0066684_10400576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 921 | Open in IMG/M |
| 3300005332|Ga0066388_100698604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1622 | Open in IMG/M |
| 3300005439|Ga0070711_100613471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 909 | Open in IMG/M |
| 3300005444|Ga0070694_101053209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 677 | Open in IMG/M |
| 3300005451|Ga0066681_10381524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 866 | Open in IMG/M |
| 3300005533|Ga0070734_10363611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 826 | Open in IMG/M |
| 3300005542|Ga0070732_10448671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 780 | Open in IMG/M |
| 3300005554|Ga0066661_10667284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300005587|Ga0066654_10461404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 695 | Open in IMG/M |
| 3300005764|Ga0066903_106154259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 628 | Open in IMG/M |
| 3300005843|Ga0068860_101502507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 695 | Open in IMG/M |
| 3300005949|Ga0066791_10083217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 639 | Open in IMG/M |
| 3300009011|Ga0105251_10458187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 592 | Open in IMG/M |
| 3300009093|Ga0105240_10569819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1250 | Open in IMG/M |
| 3300009177|Ga0105248_11312681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 818 | Open in IMG/M |
| 3300009553|Ga0105249_10635713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1124 | Open in IMG/M |
| 3300010043|Ga0126380_10259804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1208 | Open in IMG/M |
| 3300010046|Ga0126384_10353896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1225 | Open in IMG/M |
| 3300010362|Ga0126377_11315809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300010371|Ga0134125_10522591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300010371|Ga0134125_11297444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 794 | Open in IMG/M |
| 3300010371|Ga0134125_12346272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300010376|Ga0126381_101249306 | Not Available | 1073 | Open in IMG/M |
| 3300010376|Ga0126381_102253146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 783 | Open in IMG/M |
| 3300010376|Ga0126381_104716901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 525 | Open in IMG/M |
| 3300010399|Ga0134127_11594355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300010399|Ga0134127_11750675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300010867|Ga0126347_1064340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300013307|Ga0157372_12263209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300014325|Ga0163163_11170899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 831 | Open in IMG/M |
| 3300014658|Ga0181519_10667869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300014968|Ga0157379_11688604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300015052|Ga0137411_1369533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2189 | Open in IMG/M |
| 3300015054|Ga0137420_1112583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1174 | Open in IMG/M |
| 3300016319|Ga0182033_10361201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1217 | Open in IMG/M |
| 3300016341|Ga0182035_10922560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 771 | Open in IMG/M |
| 3300016371|Ga0182034_11138402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300016404|Ga0182037_10161112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1702 | Open in IMG/M |
| 3300017959|Ga0187779_10130626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1536 | Open in IMG/M |
| 3300017959|Ga0187779_11135772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300017970|Ga0187783_11141296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300017974|Ga0187777_10252549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1197 | Open in IMG/M |
| 3300017975|Ga0187782_10873671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 697 | Open in IMG/M |
| 3300018064|Ga0187773_10035465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2224 | Open in IMG/M |
| 3300018085|Ga0187772_10061617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2334 | Open in IMG/M |
| 3300018433|Ga0066667_11954354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300018482|Ga0066669_10576644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 983 | Open in IMG/M |
| 3300020579|Ga0210407_10371839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1118 | Open in IMG/M |
| 3300021168|Ga0210406_10562952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 894 | Open in IMG/M |
| 3300021180|Ga0210396_10492910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1073 | Open in IMG/M |
| 3300021180|Ga0210396_11587942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300021401|Ga0210393_10823222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 755 | Open in IMG/M |
| 3300021405|Ga0210387_10854642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 802 | Open in IMG/M |
| 3300021407|Ga0210383_10798987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 808 | Open in IMG/M |
| 3300021420|Ga0210394_10067129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 3109 | Open in IMG/M |
| 3300021433|Ga0210391_10779183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 748 | Open in IMG/M |
| 3300021474|Ga0210390_11068863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300022724|Ga0242665_10112887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300025912|Ga0207707_10169427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1908 | Open in IMG/M |
| 3300025913|Ga0207695_10811455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 816 | Open in IMG/M |
| 3300025914|Ga0207671_10058227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2864 | Open in IMG/M |
| 3300025919|Ga0207657_10588512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 869 | Open in IMG/M |
| 3300025934|Ga0207686_11725701 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 518 | Open in IMG/M |
| 3300026088|Ga0207641_11944031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300026313|Ga0209761_1190667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 916 | Open in IMG/M |
| 3300026328|Ga0209802_1323211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300026557|Ga0179587_10776592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300027565|Ga0209219_1164762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300027576|Ga0209003_1112812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300027591|Ga0209733_1102883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 719 | Open in IMG/M |
| 3300027648|Ga0209420_1177750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300027915|Ga0209069_10954500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300028379|Ga0268266_10326532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1437 | Open in IMG/M |
| 3300028792|Ga0307504_10394025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300029910|Ga0311369_10016989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8772 | Open in IMG/M |
| 3300029944|Ga0311352_10849223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 711 | Open in IMG/M |
| 3300029951|Ga0311371_10902604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 1068 | Open in IMG/M |
| 3300029951|Ga0311371_12332417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300030054|Ga0302182_10070974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1555 | Open in IMG/M |
| 3300030490|Ga0302184_10022177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3411 | Open in IMG/M |
| 3300030521|Ga0307511_10310358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300031022|Ga0138301_1608631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 854 | Open in IMG/M |
| 3300031047|Ga0073995_12223303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 851 | Open in IMG/M |
| 3300031234|Ga0302325_10766803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1371 | Open in IMG/M |
| 3300031525|Ga0302326_10500270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1842 | Open in IMG/M |
| 3300031525|Ga0302326_11552486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300031549|Ga0318571_10414147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300031640|Ga0318555_10079264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1708 | Open in IMG/M |
| 3300031713|Ga0318496_10091386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1625 | Open in IMG/M |
| 3300031715|Ga0307476_10027987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3724 | Open in IMG/M |
| 3300031719|Ga0306917_10864946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300031744|Ga0306918_11017592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300031747|Ga0318502_10260449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1014 | Open in IMG/M |
| 3300031753|Ga0307477_11062414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300031754|Ga0307475_10078956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 2533 | Open in IMG/M |
| 3300031754|Ga0307475_11528664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031765|Ga0318554_10664966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300031782|Ga0318552_10594918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300031794|Ga0318503_10286272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300031795|Ga0318557_10091178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 1339 | Open in IMG/M |
| 3300031795|Ga0318557_10127301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1142 | Open in IMG/M |
| 3300031860|Ga0318495_10467300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300031890|Ga0306925_11295651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 724 | Open in IMG/M |
| 3300031896|Ga0318551_10545553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300031897|Ga0318520_10558267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300031912|Ga0306921_12141450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300031941|Ga0310912_10647173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 821 | Open in IMG/M |
| 3300031941|Ga0310912_11044842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300031946|Ga0310910_10624512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 854 | Open in IMG/M |
| 3300031949|Ga0214473_10925926 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300032001|Ga0306922_10134560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2635 | Open in IMG/M |
| 3300032010|Ga0318569_10065986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1594 | Open in IMG/M |
| 3300032054|Ga0318570_10066498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1526 | Open in IMG/M |
| 3300032174|Ga0307470_11391324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300032515|Ga0348332_12724403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 960 | Open in IMG/M |
| 3300032805|Ga0335078_11640922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 709 | Open in IMG/M |
| 3300032898|Ga0335072_10630916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300033158|Ga0335077_11200161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 743 | Open in IMG/M |
| 3300033513|Ga0316628_101811079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1004011043 | 3300002245 | Forest Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLTVLRDAGERGLVD |
| JGI25617J43924_102053001 | 3300002914 | Grasslands Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREAGERGLVDSDALTMLEG |
| JGI25389J43894_10024774 | 3300002916 | Grasslands Soil | MPKDLNSTGRWLMKRLTQGLAPELQDRKDLLAVLREAGERGLVDGDALTMLE |
| JGI25405J52794_101687642 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MSNKDLNATGRWLKKITQSLGEPQDRDDLVVMLRAANERG |
| Ga0062593_1023911501 | 3300004114 | Soil | MSKDLNATGRWLRKITQSLAAEPQDRAELIEQLRDANQRGLVDGDALNMLE |
| Ga0066684_104005763 | 3300005179 | Soil | MPKDLNSTGRWLMKRLTQGLAPELQDRKDLLAVLREAGERGLVD |
| Ga0066388_1006986041 | 3300005332 | Tropical Forest Soil | MAKDLNTTGRWLKRLTRAPEPQDRDELARCMREAAERGLIDTDALTML |
| Ga0070711_1006134713 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREAGERGLVDSDALTML |
| Ga0070694_1010532091 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKDLNTTGRWLKRLTQGLASEPQDREELVALLREAGERGLVDSD |
| Ga0066681_103815243 | 3300005451 | Soil | MPKDLNSTGRWLMKRLTQGLAPELQDRKDLLAVLREAGERGLVDGD |
| Ga0070734_103636113 | 3300005533 | Surface Soil | MAKDLSSTGRWLKRITQSFAAEPQDRAELLAVLQEAGERGLVDTDA |
| Ga0070732_104486711 | 3300005542 | Surface Soil | MAKDLNTTGRWLRRLTQGLAAEPQDREALASVLHEAAERGVIDSDA |
| Ga0066661_106672841 | 3300005554 | Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREAGER |
| Ga0066654_104614042 | 3300005587 | Soil | MPKDLNSTGRWLMKRLTQGLAPELQDRKDLLAVLREAGERGLV |
| Ga0066903_1061542591 | 3300005764 | Tropical Forest Soil | MAKESPNSTGRWLKRLTQSFSQEPQDRQELLGILRVAGERGLL |
| Ga0068860_1015025072 | 3300005843 | Switchgrass Rhizosphere | MSKDLNTTGRWLKKITQSLGEPQDRADLVSILRAAGERGVIDDDA |
| Ga0066791_100832171 | 3300005949 | Soil | MSKDTSTTGRWLKRITQSLSGEPQDRAELIALLRETA |
| Ga0105251_104581872 | 3300009011 | Switchgrass Rhizosphere | MMAKDLNATGRWLKRITQSFSGEPQDREELLAVMREAGERGL |
| Ga0105240_105698191 | 3300009093 | Corn Rhizosphere | MMAKDLNATGRWLKRITQSFSGEPQDREELLAVLREA |
| Ga0105248_113126811 | 3300009177 | Switchgrass Rhizosphere | MAKDLNATGRWLKRLAQGFVGEPQDRQELLAMLREA |
| Ga0105249_106357132 | 3300009553 | Switchgrass Rhizosphere | MMAKDLNATGRWLKRITQSFSGEPQDREELLAVLRSR* |
| Ga0126380_102598041 | 3300010043 | Tropical Forest Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALTEVLREAADRSVIDSDALTM |
| Ga0126384_103538961 | 3300010046 | Tropical Forest Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALADLLREAA |
| Ga0126377_113158091 | 3300010362 | Tropical Forest Soil | MAKDKDLNTTGRWLKRLTQGLAEPQDRKELLVMLRESAERGLVDADALTMLE |
| Ga0134125_105225911 | 3300010371 | Terrestrial Soil | MAQNDGSATGRWLKRTLKSFSGEPQDREELMELLRDAHERGV |
| Ga0134125_112974443 | 3300010371 | Terrestrial Soil | MAKELNATGRWLKKIAQGFVGEPQNRKELVSVLREA |
| Ga0134125_123462722 | 3300010371 | Terrestrial Soil | MTQNDGSATGRWLKRTLKSFSGEPQDREELMELLRDAHERGV |
| Ga0126381_1012493061 | 3300010376 | Tropical Forest Soil | MADLNATGRWLKRLTRGSEPQDRQQLLGVLREAGERG |
| Ga0126381_1022531461 | 3300010376 | Tropical Forest Soil | MAMTKDLNATGRWLKRLTRGPAVEPQDRKELLGVLRETADRGLIDADALTM |
| Ga0126381_1047169011 | 3300010376 | Tropical Forest Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALSEVLREAADRSVIDSDALTMLEG |
| Ga0134127_115943551 | 3300010399 | Terrestrial Soil | MSKDLNATGRWLRKIGQTLGEPQDRDDLVAILRAAGERGVIDDD |
| Ga0134127_117506753 | 3300010399 | Terrestrial Soil | MAKESPNSTGRWLKRFTQSFSQEPQDREELLGILRVAGDRGLLDTD |
| Ga0126347_10643401 | 3300010867 | Boreal Forest Soil | MMAKDLNATGRWLKRITQSFSGEPQDRAELLAVLREAG |
| Ga0157372_122632091 | 3300013307 | Corn Rhizosphere | MAKDLNATGRWLKRIAQGFTGEPQDRKDLVATMREAAERGL |
| Ga0163163_111708991 | 3300014325 | Switchgrass Rhizosphere | MAKDLNATGRWLKRLTQGFAAEPQDRQELLAVLREAGERGLVDTEA |
| Ga0181519_106678691 | 3300014658 | Bog | MAKDLNTTGRWLKRLTQGLSAEPQDRAELLALLREA |
| Ga0157379_116886041 | 3300014968 | Switchgrass Rhizosphere | MTKDLNATGRWLKRITQSLSGEPHDRGELLELLREA |
| Ga0137411_13695335 | 3300015052 | Vadose Zone Soil | MSKDLNATGRWLRKITQSLGEPQDSDDLIVILRAA |
| Ga0137420_11125833 | 3300015054 | Vadose Zone Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREAGERGLVDSDALTMLE |
| Ga0182033_103612013 | 3300016319 | Soil | MGKDLNSTGRWLRRLTHGLAAEPQDRKALADLLREAAERSVIDSDALTML |
| Ga0182035_109225603 | 3300016341 | Soil | MAKDLNTTGRWLRRLKGLSAEPQDREALASVLREA |
| Ga0182034_111384021 | 3300016371 | Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALAEVLREAADRSVID |
| Ga0182037_101611124 | 3300016404 | Soil | MGKDLNTTGRWLRRLTHGLATEPQDRKALAEVLRE |
| Ga0187779_101306261 | 3300017959 | Tropical Peatland | MSKDLNATGRWLKRLTQGLASEPQDRQELLGVLRDAGER |
| Ga0187779_111357721 | 3300017959 | Tropical Peatland | MTKDLNSTGRWLRRLKQGLASEPQDRAELLTVLRDAGE |
| Ga0187783_111412961 | 3300017970 | Tropical Peatland | MAKDLNTTGRWLKRLTQSLAEPQDRKDLLAVLREASERGIVDSDALTMLE |
| Ga0187777_102525493 | 3300017974 | Tropical Peatland | MAKDLNSTGRWLKRLTRAPEPQDREELARYMREASERGLIDAD |
| Ga0187782_108736713 | 3300017975 | Tropical Peatland | MTKDLNSTGRWLKRLKQGLASEPQDREELLGVLRDAGERGLV |
| Ga0187773_100354654 | 3300018064 | Tropical Peatland | MTKDTSSTGRWLKRLTQGREPQDRQELLTVLREAGE |
| Ga0187772_100616174 | 3300018085 | Tropical Peatland | MTKDVNSTGRWLRRLTQGLANEPQDRQELLAVLRDAGERGL |
| Ga0066667_119543542 | 3300018433 | Grasslands Soil | MPKDLNSTGGWLMKRLGQGLAPELPDREHLLAVLREAGKRVV |
| Ga0066669_105766443 | 3300018482 | Grasslands Soil | MPKDLNSTGRWLMKRLAQGLAPELQDRKDLLAVLREAGERGLVDGD |
| Ga0210407_103718393 | 3300020579 | Soil | MAKDLNATGRWLKRLTQGLAEPQDREELLGVLREAGERGLV |
| Ga0210406_105629523 | 3300021168 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRNELLAVLREAGQ |
| Ga0210396_104929103 | 3300021180 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRTELVALLRQASQRGLVDADALS |
| Ga0210396_115879421 | 3300021180 | Soil | MAKDLNTTGRWLKRLTHGLAETQDRAHLLTMLREVSERGLID |
| Ga0210393_108232223 | 3300021401 | Soil | MTKDLNTTGRWLKRLTQGLSAEPQDRAELLAVLREASERGLIDAD |
| Ga0210387_108546421 | 3300021405 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRNELLAVLREAGQRG |
| Ga0210383_107989871 | 3300021407 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRTELVALLRQASQRGLVEADAL |
| Ga0210394_100671291 | 3300021420 | Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREAGERGLVDSDAL |
| Ga0210391_107791831 | 3300021433 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRTELVALLRQA |
| Ga0210390_110688631 | 3300021474 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRTELVALLRQASQ |
| Ga0242665_101128871 | 3300022724 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRNELLAVLREA |
| Ga0207707_101694274 | 3300025912 | Corn Rhizosphere | MAKDPNATGRWLKRLTRSFSQEPQDREKLLTVLRV |
| Ga0207695_108114551 | 3300025913 | Corn Rhizosphere | MPKDINTTGKWLKRLTQGFAAEPQDRQELLEILREARTRG |
| Ga0207671_100582271 | 3300025914 | Corn Rhizosphere | MAKDLNATGRWLKRLAQGFVGEPQDRQELLAMLREAAERGLVE |
| Ga0207657_105885121 | 3300025919 | Corn Rhizosphere | MSKESPNSTGRWLKRLTQSFSQEPQDREELLGILR |
| Ga0207686_117257011 | 3300025934 | Miscanthus Rhizosphere | MSKDLNATGRWLRKIGQTLGEPQDRDDLVAILRAAGQLEGALS |
| Ga0207641_119440312 | 3300026088 | Switchgrass Rhizosphere | MSKDLNATGRWLRKIGQTLGEPQDRDDLVAILRAAGERGVIDDDACT |
| Ga0209761_11906673 | 3300026313 | Grasslands Soil | MTKDLNSTGRWLKRLTQGFAAEPQDRQDLLALLREAGERGL |
| Ga0209802_13232111 | 3300026328 | Soil | MTKDLNSTGRWLKRLTQGFAAEPQDRQDLLALLREA |
| Ga0179587_107765921 | 3300026557 | Vadose Zone Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREA |
| Ga0209219_11647621 | 3300027565 | Forest Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLAVLREAGERGLVDSD |
| Ga0209003_11128121 | 3300027576 | Forest Soil | MTKDLNSTGRWLRRIKQGLASEPQDREELLTVLHDAGERGLVD |
| Ga0209733_11028833 | 3300027591 | Forest Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLTVLRE |
| Ga0209420_11777501 | 3300027648 | Forest Soil | MAKDLNTTGRWLKRLTQGLAIEPQDREQLLGVLREAG |
| Ga0209069_109545002 | 3300027915 | Watersheds | MTKDLNTTGRWLKRLTQGLAPEPQDRKQLLTVLRDAGERGLVDGDALTM |
| Ga0268266_103265323 | 3300028379 | Switchgrass Rhizosphere | MAKDLNATGRWLKRITQSFSGEPQDREELLAVLRE |
| Ga0307504_103940251 | 3300028792 | Soil | MTKDLNTTGRWLKRLTQGLAPEPQDRNQLLAVLREAG |
| Ga0311369_100169899 | 3300029910 | Palsa | MSKDTSTTGRWLKRLTQSLSGEPQDRAELLTLLRETAERGLVDA |
| Ga0311352_108492233 | 3300029944 | Palsa | MSKDTSTTGRWLKRLTQSLSGEPQDRAELLTLLRETAERGLVDADA |
| Ga0311371_109026043 | 3300029951 | Palsa | MTKDKDISSTGRWLKRLTLGQAEPQDRKELLAILRDSSERGLIDADALTMLE |
| Ga0311371_123324172 | 3300029951 | Palsa | MSKDTSTTGRWLKRLTQSLTSEPQDRGELLTLLRETA |
| Ga0302182_100709741 | 3300030054 | Palsa | MSKDTSTTGRWLKKLTQSLSGEPQDRAELLTLLRETAERG |
| Ga0302184_100221775 | 3300030490 | Palsa | MSKDTSTTGRWLKRLTQSLTSEPQDRGELLTLLRETAARGLVDADALEM |
| Ga0307511_103103583 | 3300030521 | Ectomycorrhiza | MAKDLNATGRWLKKIAQGFVGEPQDRNELLAVLREAGQRGLIESDA |
| Ga0138301_16086312 | 3300031022 | Soil | MAKDLNATGRWLKKIAQGFVGEPQDRNELLAVLREAGQRGRSSRTR |
| Ga0073995_122233033 | 3300031047 | Soil | MAKDLNATGRWLKRITQSFSGEPQDREELLGVLREAGERGLVD |
| Ga0302325_107668031 | 3300031234 | Palsa | MAKDLNTTGRWLRRLRQGPEPQDREELLVVLRDAAERGL |
| Ga0302326_105002701 | 3300031525 | Palsa | MSKDTSTTGRWLKRLTQSLTSEPQDRGELLTLLRETAARGLVDADAL |
| Ga0302326_115524861 | 3300031525 | Palsa | MSKDTSTTGRWLKRLTQSLSGEPQDRAELLTLLRETAQ |
| Ga0318571_104141471 | 3300031549 | Soil | MGKDLNTTGRWLRRLTHGLASEPQDRKALAEVLHEAAERGVIDS |
| Ga0318555_100792641 | 3300031640 | Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALAEVLREAADRSVIDSDALTML |
| Ga0318496_100913863 | 3300031713 | Soil | MAKDLNTTGRWLRRLKGLAAEPQDREALASVLREAAEREI |
| Ga0307476_100279875 | 3300031715 | Hardwood Forest Soil | MAKDLNATGRWLKKIAQGFVGEPQDRTELVALLRQAS |
| Ga0306917_108649461 | 3300031719 | Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALAEVLREAADRSVIDSDAL |
| Ga0306918_110175921 | 3300031744 | Soil | MGKDLNTTGRWLRRLTHGLAAEPQDRKALAEVLREAADRSVIDSDA |
| Ga0318502_102604491 | 3300031747 | Soil | MGKDLNTTGRWLRRLTHGLATEPQDRKALAEVLREAADRSV |
| Ga0307477_110624142 | 3300031753 | Hardwood Forest Soil | MAKDLNTTGRWLRRLTQGLAAEPQDREALASVLHEAAERGVIDSDALT |
| Ga0307475_100789564 | 3300031754 | Hardwood Forest Soil | MGKDLNTTGRWLRRLTHGLAVEPQDRKALAAVLHEAAERGVID |
| Ga0307475_115286641 | 3300031754 | Hardwood Forest Soil | MSKDPNTTGRWLRRLKQGLAAEPQDREELRAVLRDAGDRGLVDGD |
| Ga0318554_106649661 | 3300031765 | Soil | MGKDLNTTGRWLRRLTQGLAAEPQDRNALAAVLREA |
| Ga0318552_105949181 | 3300031782 | Soil | MGKDLNTTGRWLRRLTHGLATEPQDRKALAEVLREAADRSVI |
| Ga0318503_102862722 | 3300031794 | Soil | MGKDLNSTGRWLRRLTQGLAAEPQDRAALATGLREAA |
| Ga0318557_100911781 | 3300031795 | Soil | MRKDLNTTGRWLRRLTHGLATEPQDRKALAEVLREAADRSVID |
| Ga0318557_101273013 | 3300031795 | Soil | MGKDLNTTGRWLRRLTHGLATEPQDRKALAEVLREAADRSVID |
| Ga0318495_104673001 | 3300031860 | Soil | MAKDLNTTGRWLRRLKGLAAEPQDREALASVLREAAERDIIDSDALTM |
| Ga0306925_112956513 | 3300031890 | Soil | MGKDLNTTGRWLRRLTHGLASEPQDRKALAEVLHEAAERG |
| Ga0318551_105455532 | 3300031896 | Soil | MGKDLKSTGRWLRRLTHGLAAEPQDRAALAAGLREAAERGVIDTDALT |
| Ga0318520_105582671 | 3300031897 | Soil | MGKDLNSTGRWLRRLTHGLAAEPQDRAALAAGLREAAERGVIDTDALTM |
| Ga0306921_121414501 | 3300031912 | Soil | MGKDLNTTGRWLRRLTQGLAAEPQDRKALAEVLREAADRSV |
| Ga0310912_106471733 | 3300031941 | Soil | MAKDLNTTGRWLRRLKGLAAEPQDREALASVLREAAE |
| Ga0310912_110448422 | 3300031941 | Soil | MGKDLNTTGRWLRRLTHGLATEPQDRKALAEVLREAADR |
| Ga0310910_106245123 | 3300031946 | Soil | MGKDLNTTGRWLRRLTHGLAAGPQDRKALAEVLREAADRSVIDSDALTML |
| Ga0214473_109259263 | 3300031949 | Soil | MSKDLNATGRWLKKITQSLGEPQDRSDLVAILRAAGERGVIDDDAC |
| Ga0306922_101345601 | 3300032001 | Soil | MAKDLNSTGRWLRRLTHGLAAEPQDRKALADVLREAAERSVIDSDA |
| Ga0318569_100659863 | 3300032010 | Soil | MGKDLNSTGRWLRRLTHGLAAEPQDRAALAAGLREAAERGVID |
| Ga0318570_100664981 | 3300032054 | Soil | MGKDLNSTGRWLRRLTQGLAAEPQDRAALATGLREAAERGVI |
| Ga0307470_113913242 | 3300032174 | Hardwood Forest Soil | MAKDLNATGRWLKRLTQGLAEPQDREELLGVLREAAERGLVDADAL |
| Ga0348332_127244031 | 3300032515 | Plant Litter | MAKELNATGRWLKKIAQGFVGEPQDRKELVGVLRDAAANTEKKWGK |
| Ga0335078_116409223 | 3300032805 | Soil | MTKDLNATGRWLKRLTQGLAAEPQDRAELLTLLRDASERGL |
| Ga0335072_106309163 | 3300032898 | Soil | MSKDTSSTGRWLKRLTQGLAAEPQDRAELLAVLRDAGERGL |
| Ga0335077_112001613 | 3300033158 | Soil | MAKDLNATGRWLKRITQREPQDRAELVTVLREAAERGLLD |
| Ga0316628_1018110791 | 3300033513 | Soil | MAKDLNATGRWLKRIAQGFAAEPQDRQELLGVLREA |
| ⦗Top⦘ |