


| Basic Information | |
|---|---|
| Family ID | F068178 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKLPPELEFHEDIHLLIYRPHGVIDEAAVKKVVSVLEDLEARL |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.400 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.400 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.94% β-sheet: 11.27% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 12.80 |
| PF13557 | Phenol_MetA_deg | 3.20 |
| PF00232 | Glyco_hydro_1 | 3.20 |
| PF04367 | DUF502 | 2.40 |
| PF02518 | HATPase_c | 2.40 |
| PF01180 | DHO_dh | 1.60 |
| PF09699 | Paired_CXXCH_1 | 0.80 |
| PF00072 | Response_reg | 0.80 |
| PF00106 | adh_short | 0.80 |
| PF13505 | OMP_b-brl | 0.80 |
| PF04226 | Transgly_assoc | 0.80 |
| PF02887 | PK_C | 0.80 |
| PF00005 | ABC_tran | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 3.20 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 2.40 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.60 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.60 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 1.60 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.60 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.60 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.80 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.20 % |
| Unclassified | root | N/A | 0.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16867798 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 2170459019|G14TP7Y01AS4RL | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 2209111022|2221219282 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c017735 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300000550|F24TB_10313867 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1012413 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300000890|JGI11643J12802_10313190 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300000955|JGI1027J12803_100109348 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300002568|C688J35102_119760090 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300004114|Ga0062593_101666962 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300004479|Ga0062595_100502976 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005174|Ga0066680_10413397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 856 | Open in IMG/M |
| 3300005177|Ga0066690_10649309 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 703 | Open in IMG/M |
| 3300005178|Ga0066688_10333183 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005332|Ga0066388_104596843 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005332|Ga0066388_105286878 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005337|Ga0070682_100646701 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005344|Ga0070661_101213144 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005354|Ga0070675_100993260 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005366|Ga0070659_100461554 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300005451|Ga0066681_10174577 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300005466|Ga0070685_11070534 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005518|Ga0070699_101315788 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005548|Ga0070665_100145221 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300005555|Ga0066692_10682516 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005560|Ga0066670_11032301 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006163|Ga0070715_10454488 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006175|Ga0070712_100690450 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300006175|Ga0070712_101366833 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006791|Ga0066653_10450315 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006844|Ga0075428_101393746 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006852|Ga0075433_10526979 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300006871|Ga0075434_102597574 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006904|Ga0075424_100591895 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300006904|Ga0075424_102165301 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300007255|Ga0099791_10246335 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300007258|Ga0099793_10589253 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009011|Ga0105251_10342558 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009012|Ga0066710_104642582 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009137|Ga0066709_103655453 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009137|Ga0066709_103976423 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009137|Ga0066709_104258923 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009148|Ga0105243_11017689 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300009174|Ga0105241_10155579 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300009174|Ga0105241_10351550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1280 | Open in IMG/M |
| 3300009551|Ga0105238_11243833 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300010044|Ga0126310_10340221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1048 | Open in IMG/M |
| 3300010048|Ga0126373_12749777 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010359|Ga0126376_11188555 | Not Available | 777 | Open in IMG/M |
| 3300010373|Ga0134128_10876876 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300010398|Ga0126383_12024507 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010398|Ga0126383_13596756 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300011119|Ga0105246_10293633 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1309 | Open in IMG/M |
| 3300012198|Ga0137364_10492188 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012198|Ga0137364_10900617 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012202|Ga0137363_10975591 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012203|Ga0137399_10125758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2021 | Open in IMG/M |
| 3300012206|Ga0137380_11176681 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012209|Ga0137379_10236076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1742 | Open in IMG/M |
| 3300012285|Ga0137370_10530767 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012351|Ga0137386_10041138 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
| 3300012351|Ga0137386_10701615 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012354|Ga0137366_11127612 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012357|Ga0137384_10568845 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300012359|Ga0137385_10071747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3081 | Open in IMG/M |
| 3300012469|Ga0150984_106075552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1401 | Open in IMG/M |
| 3300012685|Ga0137397_10579003 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012918|Ga0137396_10066491 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300012918|Ga0137396_10971594 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012923|Ga0137359_11435220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 578 | Open in IMG/M |
| 3300012923|Ga0137359_11658327 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012929|Ga0137404_10873876 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300012930|Ga0137407_10858141 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012971|Ga0126369_12922079 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012984|Ga0164309_10788401 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300013105|Ga0157369_10063707 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3972 | Open in IMG/M |
| 3300013306|Ga0163162_12481820 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300013308|Ga0157375_11038233 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300014166|Ga0134079_10276931 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300014968|Ga0157379_10458482 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300015374|Ga0132255_101618967 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300015374|Ga0132255_101993548 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300015374|Ga0132255_103438514 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300016270|Ga0182036_11913415 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300016341|Ga0182035_10995336 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300018081|Ga0184625_10666832 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018433|Ga0066667_10012096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4217 | Open in IMG/M |
| 3300018482|Ga0066669_11605450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 594 | Open in IMG/M |
| 3300019361|Ga0173482_10072566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1182 | Open in IMG/M |
| 3300019789|Ga0137408_1488683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1628 | Open in IMG/M |
| 3300019868|Ga0193720_1024337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 861 | Open in IMG/M |
| 3300019886|Ga0193727_1171707 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300020004|Ga0193755_1236202 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300020006|Ga0193735_1104813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 784 | Open in IMG/M |
| 3300020140|Ga0179590_1153908 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021344|Ga0193719_10232784 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300021405|Ga0210387_10829326 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300021411|Ga0193709_1005853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3140 | Open in IMG/M |
| 3300021510|Ga0222621_1106653 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300022756|Ga0222622_11433726 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300025315|Ga0207697_10345173 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025911|Ga0207654_10090883 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300025916|Ga0207663_11095109 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300025916|Ga0207663_11600986 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025922|Ga0207646_10167800 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300025930|Ga0207701_10269740 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300025931|Ga0207644_11467030 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025932|Ga0207690_10347390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1172 | Open in IMG/M |
| 3300026095|Ga0207676_11874519 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026300|Ga0209027_1173596 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300026324|Ga0209470_1169546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 950 | Open in IMG/M |
| 3300026332|Ga0209803_1278455 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026540|Ga0209376_1419093 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300028379|Ga0268266_10538183 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300028714|Ga0307309_10147995 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300028799|Ga0307284_10003734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 4143 | Open in IMG/M |
| 3300030854|Ga0075385_11477032 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031057|Ga0170834_105286061 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031170|Ga0307498_10122145 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031231|Ga0170824_114224514 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031446|Ga0170820_15598861 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300031469|Ga0170819_14225894 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031941|Ga0310912_10480557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 969 | Open in IMG/M |
| 3300032012|Ga0310902_10038598 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300032075|Ga0310890_11350132 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.80% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03756750 | 2088090014 | Soil | MKLPPELEFHEDIHLLIYRPQGVIDEAAVKKVASVLEDLETRLEKPFNR |
| 4MG_02649650 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MRLAPDVEFHEDIRLFIYRPHGVINEQAIKKVISVLEDLEARLQEPFNRFADTV |
| 2222066136 | 2209111022 | Grass Soil | MKLPPELEFHDDLRLLIYRPHGVIDETAVKKVVDVLEDLEAKL |
| ARSoilOldRDRAFT_0177352 | 3300000044 | Arabidopsis Rhizosphere | MKLPPEIEFHEDLRLLVYRPQGVIDEPAVKKIVSVLEELEARLQKPFDRFSDTLQADEV |
| F24TB_103138673 | 3300000550 | Soil | MKVXXXXXFHEDIRLLIYRPHGVIDEAAVKRVVSVLEDLEAKLQEPF |
| KanNP_Total_F14TBDRAFT_10124131 | 3300000709 | Soil | MKVPPDIEFHEDIRLLIYRPHGVIDEAAVKRVVSVLEDLEAKLQEPFN |
| JGI11643J12802_103131901 | 3300000890 | Soil | MMKLPPELEFHDDLHLLIYRPHGVIDEAAVKKVVD |
| JGI1027J12803_1001093483 | 3300000955 | Soil | MKLPPELEFHDDLHLLIYQPHGVIDEAAVKKIVDVLEDLETKLQKPFNRFF |
| C688J35102_1197600901 | 3300002568 | Soil | MKLAPEIEFHEDIRLFVYRPRGVIDEAALKKAISVLEDLEAKSQEPFN |
| Ga0062593_1016669622 | 3300004114 | Soil | MKLPPELEFHDDLHLLIYRPHGVIDEAVVKKVVDVVEDLEAKLQKPFDRFFD |
| Ga0062595_1005029761 | 3300004479 | Soil | MKLPPEIEFHDDIRLLIYRPHGVIDEEAVKKIVSVLEDLEA |
| Ga0066680_104133972 | 3300005174 | Soil | VKAMKLPPDVEFHEDIRLLIYRPRGVIDEAAIKEIVSVLEDLE |
| Ga0066690_106493092 | 3300005177 | Soil | VKLPPDVEFHEDIRLLVYRPRGVIDEAAVKKLVSVIEDLEARLQRP |
| Ga0066688_103331831 | 3300005178 | Soil | MKLAPDVEFHEDIRLLIYRPHGVIDEQAIKKVISVLEDLEARL |
| Ga0066388_1045968431 | 3300005332 | Tropical Forest Soil | MNLPPEIEFHEDLRLLVYRPHGMIDEEAVKKIVSVLEDLEAKLQK |
| Ga0066388_1052868782 | 3300005332 | Tropical Forest Soil | MKLPPELEFQEDIDLLIYRPHGVIDDAAVKKVVSVLEDLEATLEKP |
| Ga0070682_1006467011 | 3300005337 | Corn Rhizosphere | MKLPPEIEFHEDLHLLVYRPHGVIDEAAVKKIVSVVEDLEARLQKPFDRFSDT |
| Ga0070661_1012131441 | 3300005344 | Corn Rhizosphere | MKLPPEIEFHDDIRLLIYRPHGVIDEAAVKKVVDVLEDLEARLQKPF |
| Ga0070675_1009932601 | 3300005354 | Miscanthus Rhizosphere | MKLPPELEFHDDLHLLIYRPHGVIDEEVVKKVVDVLENLEAKLQKPFNRFFDTL |
| Ga0070659_1004615541 | 3300005366 | Corn Rhizosphere | MKLPPELEFHDDLHLLVYRPHGVIDEEAVKKVVEVLENLEAKLQKPF |
| Ga0066681_101745771 | 3300005451 | Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRLVAVLEELEEKL |
| Ga0070685_110705341 | 3300005466 | Switchgrass Rhizosphere | MKLPPEIEFHEDLHLLVYRPHGVIDEAAVKKIVSVVEDLEARLQKPFNRFC |
| Ga0070699_1013157881 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLAPDVEFHEDIRLLIYRPHGVINEEAIKKVISVLEDLEARLREPFN |
| Ga0070665_1001452215 | 3300005548 | Switchgrass Rhizosphere | MKLPPEIEFHEDLHLLVYRPHGVIDEAAVKKIVSVVEDLEATLQKPFNRFCD |
| Ga0066692_106825161 | 3300005555 | Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVAVLEELEEKLHRP |
| Ga0066670_110323011 | 3300005560 | Soil | MKLPPDIEFHDDIRLLIYRPRGVIDEAAVQKVVDVLED |
| Ga0070715_104544881 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLPPEIEFHDDIRLLIYRPHGVIDEAAVKKVVDVLEDLEA |
| Ga0070712_1006904503 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLPPQLEFHEDIHLFIYRPRGVIDEAAVKMVVSVLEDLE |
| Ga0070712_1013668332 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLSPELEFHDDLHLLIYRPQGVIDEAAVKKVVDVLE |
| Ga0066653_104503151 | 3300006791 | Soil | MKLTPDVEFHEDIRLLIYRPRGVINEQAVKKVISILDDLEAR |
| Ga0075428_1013937461 | 3300006844 | Populus Rhizosphere | MKLPPELEFHDDIRLLIYRPHGVIDEAAVKRIVDVLEDLEEKLQKPFNRFFDTLAA |
| Ga0075433_105269791 | 3300006852 | Populus Rhizosphere | MKLPPDIEFHDDIRLLIYRPRGVIDEAAVKKIISVLEDL |
| Ga0075434_1025975742 | 3300006871 | Populus Rhizosphere | MKLAPEIEFHDDIRLLIYRPRSVIDEAAVKRVVDVLEDLEAKLQKPFN |
| Ga0075424_1005918953 | 3300006904 | Populus Rhizosphere | MKLPPELEFHDDIRLLIYRPHGVIDEAAVKRIVDVLEDLEEKL |
| Ga0075424_1021653012 | 3300006904 | Populus Rhizosphere | MKLPPELEFHDDIRLLIYRPHGVIDEAAVKRIVDVLEDLEE |
| Ga0099791_102463352 | 3300007255 | Vadose Zone Soil | MKLAPDVEFHEDIRLLIYRPHGVIDEQAIKKVISVLEDLE |
| Ga0099793_105892531 | 3300007258 | Vadose Zone Soil | MKLAPDVEFHEDIRLLIYRPHGVIDEQAIKKVISVLEDL |
| Ga0105251_103425582 | 3300009011 | Switchgrass Rhizosphere | MKLPPEIEFHDDIRLLIYRPHGVIDEAAVKKVVDVLED |
| Ga0066710_1046425822 | 3300009012 | Grasslands Soil | MKLAPDVEFHDDIRLLIYRPRGVIDEAAVQKVVDVLE |
| Ga0066709_1036554531 | 3300009137 | Grasslands Soil | MKLAPDVEFHDDIRLLIYRPRGVIDEAAVQKVVDVLEDLEARLQAPFNRF |
| Ga0066709_1039764232 | 3300009137 | Grasslands Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVAVLEELEEKL |
| Ga0066709_1042589232 | 3300009137 | Grasslands Soil | MKLPPDIEFHDDIRLLIYRPRGVVDEAAVQKAVDVLED |
| Ga0105243_110176893 | 3300009148 | Miscanthus Rhizosphere | MKLPPELEFHDDLHLLIYQPHGVIDEAAVKKIVDVLEDLEAKLQKPFN |
| Ga0105241_101555796 | 3300009174 | Corn Rhizosphere | MNLPPELEFHEDIHLLIYQPHGVIDDAAVEKVISVLEDLEARLEKPFNRFT |
| Ga0105241_103515501 | 3300009174 | Corn Rhizosphere | MKLPPELEFHDDLHLLIYRPHGVIDEEVVKKVVDV |
| Ga0105238_112438332 | 3300009551 | Corn Rhizosphere | MKLPPELEFHDDLHLLVYRPHGVIDEEVVKKVVDVLEDLEAKLQKPFNRFFDTLGADE |
| Ga0126310_103402213 | 3300010044 | Serpentine Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVSILEDLEAKLQKPFN |
| Ga0126373_127497772 | 3300010048 | Tropical Forest Soil | MKLPPDIEFHEDIRLLIYRPHGVIDEAAIKEIVSVVEDLEAKLQEPFNR |
| Ga0126376_111885552 | 3300010359 | Tropical Forest Soil | MKLPPELEFQEDIDLLIYRPHGVIDDAAVKKVVSVLEDLEATLEKPF |
| Ga0134128_108768761 | 3300010373 | Terrestrial Soil | MKLPPELEFYEDIHLLIYRPHGVIDEAAVKKIVSVLED |
| Ga0126383_120245071 | 3300010398 | Tropical Forest Soil | MKLPPELEFQEDIDLLIYRPHGVIDDAAVKKVVSVLED |
| Ga0126383_135967561 | 3300010398 | Tropical Forest Soil | MKFPADIEFHEEIRLLIYRPHGAIDEAAIKRVVSVLED |
| Ga0105246_102936333 | 3300011119 | Miscanthus Rhizosphere | MKLPPELEFHDDLHLLIYRPHGVIDETAVKKVVDVLEDLEAKLQKPFN |
| Ga0137364_104921881 | 3300012198 | Vadose Zone Soil | MKLLPEIEFHDDIRLLIYRPRGVLNEAAINKVLSA |
| Ga0137364_109006172 | 3300012198 | Vadose Zone Soil | MKLPPDIEFHDDIRLLIYRPVGVIDEAAVKRIVSVLEDLE |
| Ga0137363_109755911 | 3300012202 | Vadose Zone Soil | MKLPPDVEFHEDIRLLIYRPRGVIDEAAVKKVVDVLEDLE |
| Ga0137399_101257583 | 3300012203 | Vadose Zone Soil | MKLPPELEFHDDLHLLIYRPHGVIDEAAVKKVVDVLEDLE |
| Ga0137380_111766811 | 3300012206 | Vadose Zone Soil | MKLPPELEFHEDIHLLIYRPHGVIDEAAVKKVVSVLEDLEARL |
| Ga0137379_102360761 | 3300012209 | Vadose Zone Soil | MRVAPDVEFHEDIRLLIYRPHGVINEQALKKVISVLEDL |
| Ga0137370_105307673 | 3300012285 | Vadose Zone Soil | MKLLPDIEFDEDIRLLTYRPHGVIDEAAVKKVVSVLEDLEAKLQQPFNRFLDGLAAD |
| Ga0137386_100411386 | 3300012351 | Vadose Zone Soil | MKMPPDIEFHDDIRLLIYRPRGVIDEAAVQKVVDVLEDLEARLQAPF |
| Ga0137386_107016151 | 3300012351 | Vadose Zone Soil | MKLPPELEFHEDIHLLIYRPHGVIDEAAVKKMVSVLEDLE |
| Ga0137366_111276122 | 3300012354 | Vadose Zone Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVAVLE |
| Ga0137384_105688453 | 3300012357 | Vadose Zone Soil | MKLAPDVEFHEDIRLFIYRPHGVIDEQAIKKVISILEDLE |
| Ga0137385_100717474 | 3300012359 | Vadose Zone Soil | MKLAPDVEFHEDIRLLIYRPHGVIDEQAIKQVISVLEDLEARLREPF |
| Ga0150984_1060755521 | 3300012469 | Avena Fatua Rhizosphere | MKLPPELEFHDDLHLLVYRPHGVIDEAVVKKVVDVLEDLEAKLQKP |
| Ga0137397_105790031 | 3300012685 | Vadose Zone Soil | MKLAPDIEFHEDIRLLIYRPQGVIDEAAVKRVVDVVEDLEAR |
| Ga0137396_100664915 | 3300012918 | Vadose Zone Soil | MKLAPDIEFHDDIRLLIYRPCGVIDEAAVQKVIDVLEDLEARLQKPFN |
| Ga0137396_109715942 | 3300012918 | Vadose Zone Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVSVLEELEEKLLR |
| Ga0137359_114352202 | 3300012923 | Vadose Zone Soil | MKLLPDVEFHEDIRLLIYRPRGLIDETAVKKVISVLEDLEAKLQ |
| Ga0137359_116583271 | 3300012923 | Vadose Zone Soil | MKLAPDVEFHDDIRLLIYRPRGVIDEAAVQKVVDVLEDLEAR |
| Ga0137404_108738761 | 3300012929 | Vadose Zone Soil | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVSVLEELEEKLHRPFNRF |
| Ga0137407_108581413 | 3300012930 | Vadose Zone Soil | MKLPPDIEFHDDIRLLIYRPRGVIDEAAVQKVVDVLE |
| Ga0126369_129220791 | 3300012971 | Tropical Forest Soil | MKLPPDIEFHEDIRLFVYRPRGVIDEVAVKNAMSVLEDL |
| Ga0164309_107884012 | 3300012984 | Soil | MKLPAELEFHDDLHLLIYRPHGVIDEAAVKKVVDVLEDLEAKHQKPFNRFFD |
| Ga0157369_100637076 | 3300013105 | Corn Rhizosphere | MKLPPELEFHDDLHLLIYQPHGVIDEAAVKKIVDVL |
| Ga0163162_124818201 | 3300013306 | Switchgrass Rhizosphere | MKLPPELEFHDDIRLLIYRPHGVIDEAAVKRIVDVLEDLEEKLQKPFNRFFDTL |
| Ga0157375_110382333 | 3300013308 | Miscanthus Rhizosphere | MKLPPELEFHDDLHLLVYRPHGVIDEEVVKKVVDVLENLEAKLQ |
| Ga0134079_102769312 | 3300014166 | Grasslands Soil | MKLPPELEFHDDLHLLIYRPHGVIDEAVVKKVVDVLEDLEAKLQKPFD |
| Ga0157379_104584823 | 3300014968 | Switchgrass Rhizosphere | MKLPPEIEFHDDIRLLIYRPHGVIDEAAVKKVVDVLEDLEARLQKPFDRFSDTL |
| Ga0132255_1016189671 | 3300015374 | Arabidopsis Rhizosphere | MNLPPELEFHDDIQLLIYRPHGVIDEAAVKKVVSVLED |
| Ga0132255_1019935481 | 3300015374 | Arabidopsis Rhizosphere | MKLPPELEFHDDIRLLIYRPHGVIDEAAVKRIVDVLEDLEEELQKP |
| Ga0132255_1034385141 | 3300015374 | Arabidopsis Rhizosphere | MKLSPELEFHDDLHLLIYRPHGVIDEAAVKKIVDVLEDLEAK |
| Ga0182036_119134152 | 3300016270 | Soil | MKLPPDIEFHEDIRLFVYRPRGVIDEVAVKNAMSVLEDLEAKLQEPFNRF |
| Ga0182035_109953362 | 3300016341 | Soil | MNLPPELEFHEDIRLLIYRPRGVVDEAALNKTLSALE |
| Ga0184625_106668322 | 3300018081 | Groundwater Sediment | MNFPPDVEFHEDIRLLIYRPRGVIDEAAVKRIVSVLEELE |
| Ga0066667_100120965 | 3300018433 | Grasslands Soil | MKLAPDVEFHEDIRLFIYRAHGVIDEQAIKQVISVLHDLEARLQE |
| Ga0066669_116054501 | 3300018482 | Grasslands Soil | MKLPPDVEFHEDIRLLIYRPRGVIDEAAVKKVVDILEDLEARLQKP |
| Ga0173482_100725661 | 3300019361 | Soil | MKLPPELEFHDDIRLLIYRPHGVIDEAAVKRIVDVLEDLEEELQKPFNRFFDTLA |
| Ga0137408_14886835 | 3300019789 | Vadose Zone Soil | MKLPPDIEFHDDIRLLIYRPRGVIDEAAVKKIISV |
| Ga0193720_10243372 | 3300019868 | Soil | MKLPPDVEFHEDIHLLIYRPHGVIDEAAVKKVVDVLEDLEAKLQRPFNRF |
| Ga0193727_11717071 | 3300019886 | Soil | MKLPPELEFHDDLHLLIYRPHGVIDEAAVKKVVDVLEDLEAK |
| Ga0193755_12362022 | 3300020004 | Soil | MKLPPELEFHDDLHLLIYRPRGVIDEAAVKKVVDVLEDLEAKLQKPFDRFSDTL |
| Ga0193735_11048131 | 3300020006 | Soil | MKLASDVEFHEDIRLLIYRPRGLIDEPAIKKVVSVLEDL |
| Ga0179590_11539081 | 3300020140 | Vadose Zone Soil | MKLPPELEFHDDLHLLIYRPHGVIDEAAVKKVVDVLEDLEAKLQKPFDRFSDT |
| Ga0193719_102327842 | 3300021344 | Soil | MNFPPDIEFHEDIRLLIYRPRGVIDEAAVKRIVSVLEELEEKLHRPFNRF |
| Ga0210387_108293261 | 3300021405 | Soil | MKLPPELEFHEDIHLLIYRPQGVIDDAAVKKVVSVLEDLETR |
| Ga0193709_10058531 | 3300021411 | Soil | MKLPPELEFHDDLHLLIYRPHGVIDEAAVKKVVDVLEDLEAKLQKPFDRFYD |
| Ga0222621_11066531 | 3300021510 | Groundwater Sediment | MKLPPDVEFHDDIRLLIYRPRGVIDEAAVKRVVDVLEDLEAKLQKPF |
| Ga0222622_114337261 | 3300022756 | Groundwater Sediment | MKLPPDVEFHEDIRLLIYRPRGVIDEAAVKKVVDVL |
| Ga0207697_103451731 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLPPELEFHDDLHLLIYQPHGVIDEAAVKKIVDVLEDLEAKLQKPFNRFFDTLGAD |
| Ga0207654_100908836 | 3300025911 | Corn Rhizosphere | MNLPPELEFHEDIHLLIYQPHGVIDDAAVEKVISVLEDLEARLEKPF |
| Ga0207663_110951091 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLPPELEFHDDLHLLIYRPHGVIDETAVKKVVDVLEDLEAKLQK |
| Ga0207663_116009862 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLPPQLEFHEDIHLFIYRPRGVIDEAAVKMVVSVLEDLETRLEKPFN |
| Ga0207646_101678001 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLAPDVEFHEDIRLLIYRPHGVINEEAIKKVISVLEDLEAR |
| Ga0207701_102697401 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLPPEIEFHDDIRLLIYRPRGVIDEAAVKKVVDV |
| Ga0207644_114670301 | 3300025931 | Switchgrass Rhizosphere | MKLPPDVEFHEDIRLLVYRPRGVIDEAAVKRIVSVLED |
| Ga0207690_103473904 | 3300025932 | Corn Rhizosphere | MKLPPDVEFHDDIRLLIFRPRGVIDEAAVQRVVDVLEDLE |
| Ga0207676_118745191 | 3300026095 | Switchgrass Rhizosphere | MKLPPELEFHDDLHLLVYRPHGVIDEEAVKKVVDVLENLEAKLQKPFN |
| Ga0209027_11735961 | 3300026300 | Grasslands Soil | MKLPPDLEFHDDIRLLIYRPVGVIDEAAVKRIVDVLEDL |
| Ga0209470_11695461 | 3300026324 | Soil | MKLPPEIQFHQDIGLLVYRPRGVIDEAAIKEIVSVVEDLEAK |
| Ga0209803_12784551 | 3300026332 | Soil | MKLAPDVEFHEDIRLLVYRPRGVINEQAVKKVISILEDLEARL |
| Ga0209376_14190932 | 3300026540 | Soil | MKLAPDVEFHDDIRLLIYRPRGVVDEAAVQKAVDVLEDLEARLQAPFN |
| Ga0268266_105381831 | 3300028379 | Switchgrass Rhizosphere | MKLPPEIEFHEDLHLLVYRPHGVIDEAAVKKIVSVVEDLEARLQKPFDRFSDTVQA |
| Ga0307309_101479952 | 3300028714 | Soil | MKLPPELEFHDDIHLLIYRPRGVIDEAAVKKLVDVLEDLEAKLQKPFDRFSDTL |
| Ga0307284_100037348 | 3300028799 | Soil | MKLPPELEFHDDIHLLIYRPRGVIDEAAVKKLVDVLE |
| Ga0075385_114770323 | 3300030854 | Soil | MKLPPELEFHDDLNLLIYRPHGVIDEEAVKKVVNILEDFE |
| Ga0170834_1052860613 | 3300031057 | Forest Soil | MKLPPELEFHDDLHLLIYRPHGVIDEEAVKKVVNVLEDLEAKLQKP |
| Ga0307498_101221451 | 3300031170 | Soil | MKLSPELEFHDDLHLLIYRPQGVIDEAAVKKVVDVLEDLEAKLQKPFNRFF |
| Ga0170824_1142245142 | 3300031231 | Forest Soil | MKLPSELEFHDDLHLLTYQPHGVIDEAAVKKIVDVLDDLEAKLQKPFNRFFDTLGADE |
| Ga0170820_155988611 | 3300031446 | Forest Soil | MKLPSELEFHDDLHLLTYQPHGVIDEAAVKKIVDVLEDLEAKLQKPFNRFFDT |
| Ga0170819_142258941 | 3300031469 | Forest Soil | MKLPPELEFHDDLRLLIYRPHGVIDEEAVKKVVNIL |
| Ga0310912_104805573 | 3300031941 | Soil | MKFPPDIAFDEDIRLLVYRPHGVIDEAAVKRVVSVVEDFEAKLQEP |
| Ga0310902_100385986 | 3300032012 | Soil | MKLPPEIEFHEDLHLLVYRPHGVIDEAAVKKIVSVVEDLEARLQKPFNRFCDTVQADE |
| Ga0310890_113501321 | 3300032075 | Soil | MMKLPTELEFHDDLHLLIYRPQGVIDEAAVKKVVSVLE |
| ⦗Top⦘ |