


| Basic Information | |
|---|---|
| Family ID | F068064 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VRKNYQRKVRKSNHKFEVVGGQELLVRVPLPMAEVWAEMQA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.00 % |
| % of genes near scaffold ends (potentially truncated) | 82.40 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.600 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.400 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.400 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF07676 | PD40 | 3.20 |
| PF13620 | CarboxypepD_reg | 2.40 |
| PF00872 | Transposase_mut | 2.40 |
| PF01695 | IstB_IS21 | 2.40 |
| PF00072 | Response_reg | 1.60 |
| PF17131 | LolA_like | 1.60 |
| PF13936 | HTH_38 | 1.60 |
| PF02927 | CelD_N | 0.80 |
| PF01475 | FUR | 0.80 |
| PF12680 | SnoaL_2 | 0.80 |
| PF05598 | DUF772 | 0.80 |
| PF13545 | HTH_Crp_2 | 0.80 |
| PF07992 | Pyr_redox_2 | 0.80 |
| PF01609 | DDE_Tnp_1 | 0.80 |
| PF08818 | DUF1801 | 0.80 |
| PF00665 | rve | 0.80 |
| PF04191 | PEMT | 0.80 |
| PF11154 | DUF2934 | 0.80 |
| PF14559 | TPR_19 | 0.80 |
| PF04972 | BON | 0.80 |
| PF12146 | Hydrolase_4 | 0.80 |
| PF03992 | ABM | 0.80 |
| PF00180 | Iso_dh | 0.80 |
| PF01833 | TIG | 0.80 |
| PF13560 | HTH_31 | 0.80 |
| PF00893 | Multi_Drug_Res | 0.80 |
| PF14534 | DUF4440 | 0.80 |
| PF08592 | Anthrone_oxy | 0.80 |
| PF05985 | EutC | 0.80 |
| PF00691 | OmpA | 0.80 |
| PF13649 | Methyltransf_25 | 0.80 |
| PF00069 | Pkinase | 0.80 |
| PF12704 | MacB_PCD | 0.80 |
| PF01699 | Na_Ca_ex | 0.80 |
| PF12697 | Abhydrolase_6 | 0.80 |
| PF04366 | Ysc84 | 0.80 |
| PF00882 | Zn_dep_PLPC | 0.80 |
| PF13378 | MR_MLE_C | 0.80 |
| PF00326 | Peptidase_S9 | 0.80 |
| PF13365 | Trypsin_2 | 0.80 |
| PF13590 | DUF4136 | 0.80 |
| PF13506 | Glyco_transf_21 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.20 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 2.40 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 2.40 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.80 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.80 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.80 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.80 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.80 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.80 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.80 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.80 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.80 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.80 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.80 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.80 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.80 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.80 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.60 % |
| Unclassified | root | N/A | 10.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01B2H5L | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 2088090014|GPIPI_17268428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3798 | Open in IMG/M |
| 2170459024|GZRSKLJ01CBN2H | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300001593|JGI12635J15846_10359955 | Not Available | 889 | Open in IMG/M |
| 3300005367|Ga0070667_100308997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300005445|Ga0070708_100019392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5714 | Open in IMG/M |
| 3300005445|Ga0070708_100250851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
| 3300005610|Ga0070763_10035336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2309 | Open in IMG/M |
| 3300005764|Ga0066903_101271422 | Not Available | 1372 | Open in IMG/M |
| 3300005841|Ga0068863_101743336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300006052|Ga0075029_100075334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1991 | Open in IMG/M |
| 3300006173|Ga0070716_100331242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300006854|Ga0075425_100182517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2410 | Open in IMG/M |
| 3300006854|Ga0075425_100568583 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300006871|Ga0075434_101681677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006893|Ga0073928_10094238 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300006914|Ga0075436_100868657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300009038|Ga0099829_11249243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300009792|Ga0126374_10254658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300010046|Ga0126384_12253728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300010048|Ga0126373_10175116 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300010048|Ga0126373_10218599 | Not Available | 1857 | Open in IMG/M |
| 3300010048|Ga0126373_10220017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1851 | Open in IMG/M |
| 3300010159|Ga0099796_10402871 | Not Available | 600 | Open in IMG/M |
| 3300010339|Ga0074046_10235207 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300010358|Ga0126370_11526136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300010360|Ga0126372_12613070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300010376|Ga0126381_101900996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300010376|Ga0126381_102150678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300010376|Ga0126381_102847661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300010376|Ga0126381_102966104 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300011120|Ga0150983_10995189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300011271|Ga0137393_10289728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300012361|Ga0137360_10734560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300012363|Ga0137390_10510642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1175 | Open in IMG/M |
| 3300012984|Ga0164309_10305450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300012984|Ga0164309_11538727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300012987|Ga0164307_10866422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300014158|Ga0181521_10372239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300014164|Ga0181532_10005285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11017 | Open in IMG/M |
| 3300015371|Ga0132258_10694936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2560 | Open in IMG/M |
| 3300016319|Ga0182033_10004522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Meiothermus | 7340 | Open in IMG/M |
| 3300016341|Ga0182035_10308127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300016371|Ga0182034_11258028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300016371|Ga0182034_11530201 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300016422|Ga0182039_10026697 | All Organisms → cellular organisms → Bacteria | 3648 | Open in IMG/M |
| 3300016422|Ga0182039_10090446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2229 | Open in IMG/M |
| 3300017822|Ga0187802_10218040 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300017822|Ga0187802_10254044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300017929|Ga0187849_1025058 | All Organisms → cellular organisms → Bacteria | 3222 | Open in IMG/M |
| 3300017931|Ga0187877_1023882 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
| 3300017933|Ga0187801_10029540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1916 | Open in IMG/M |
| 3300017933|Ga0187801_10171398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300017940|Ga0187853_10025699 | All Organisms → cellular organisms → Bacteria | 3203 | Open in IMG/M |
| 3300017955|Ga0187817_10593745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300017955|Ga0187817_10899156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300018004|Ga0187865_1319593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300018029|Ga0187787_10449283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300019786|Ga0182025_1328179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2598 | Open in IMG/M |
| 3300019890|Ga0193728_1115770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300020004|Ga0193755_1166544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300020582|Ga0210395_11107762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300021168|Ga0210406_10443178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300021170|Ga0210400_11255616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300021171|Ga0210405_10029928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4366 | Open in IMG/M |
| 3300021180|Ga0210396_10048441 | All Organisms → cellular organisms → Bacteria | 3897 | Open in IMG/M |
| 3300021181|Ga0210388_10020660 | All Organisms → cellular organisms → Bacteria | 5328 | Open in IMG/M |
| 3300021401|Ga0210393_10618501 | Not Available | 884 | Open in IMG/M |
| 3300021404|Ga0210389_10096580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2273 | Open in IMG/M |
| 3300021406|Ga0210386_10154089 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300021420|Ga0210394_11469502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300021432|Ga0210384_10012229 | All Organisms → cellular organisms → Bacteria | 8617 | Open in IMG/M |
| 3300021432|Ga0210384_11905376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300021479|Ga0210410_10018024 | All Organisms → cellular organisms → Bacteria | 6099 | Open in IMG/M |
| 3300021559|Ga0210409_10177392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1946 | Open in IMG/M |
| 3300021560|Ga0126371_10458065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300022529|Ga0242668_1111198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300022557|Ga0212123_10091927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2511 | Open in IMG/M |
| 3300024227|Ga0228598_1114753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300024245|Ga0247677_1038390 | Not Available | 694 | Open in IMG/M |
| 3300025910|Ga0207684_10169175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1884 | Open in IMG/M |
| 3300025933|Ga0207706_10359838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
| 3300026310|Ga0209239_1053720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1808 | Open in IMG/M |
| 3300026316|Ga0209155_1200833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300026557|Ga0179587_10131829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1544 | Open in IMG/M |
| 3300027174|Ga0207948_1007756 | Not Available | 1225 | Open in IMG/M |
| 3300027587|Ga0209220_1178810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300027698|Ga0209446_1100854 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027853|Ga0209274_10328470 | Not Available | 787 | Open in IMG/M |
| 3300027889|Ga0209380_10088978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1777 | Open in IMG/M |
| 3300027889|Ga0209380_10302408 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300028047|Ga0209526_10754019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300028906|Ga0308309_11385711 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300030843|Ga0075392_11184738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031057|Ga0170834_112089534 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300031128|Ga0170823_14885218 | Not Available | 569 | Open in IMG/M |
| 3300031128|Ga0170823_15782432 | Not Available | 530 | Open in IMG/M |
| 3300031231|Ga0170824_127020710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300031446|Ga0170820_14967580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300031573|Ga0310915_10405271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300031573|Ga0310915_10606888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300031668|Ga0318542_10442883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300031708|Ga0310686_108413421 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300031708|Ga0310686_117538713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300031720|Ga0307469_10649189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300031720|Ga0307469_10731792 | Not Available | 900 | Open in IMG/M |
| 3300031720|Ga0307469_11327240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300031740|Ga0307468_101058538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300031753|Ga0307477_10826581 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031765|Ga0318554_10490184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300031770|Ga0318521_10376217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031771|Ga0318546_10197214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
| 3300031782|Ga0318552_10563150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031796|Ga0318576_10635426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300031823|Ga0307478_11429021 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031833|Ga0310917_10100625 | Not Available | 1860 | Open in IMG/M |
| 3300031962|Ga0307479_10009352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9086 | Open in IMG/M |
| 3300031962|Ga0307479_10135801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2407 | Open in IMG/M |
| 3300032001|Ga0306922_11893725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300032090|Ga0318518_10630893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300032174|Ga0307470_10735536 | Not Available | 756 | Open in IMG/M |
| 3300032782|Ga0335082_10416413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300033134|Ga0335073_10541703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1317 | Open in IMG/M |
| 3300033290|Ga0318519_10021022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2920 | Open in IMG/M |
| 3300033977|Ga0314861_0177203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.20% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.80% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.80% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030843 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_4467340 | 2032320005 | Soil | VKHKYQRQERKSNHKFEVVRGQELLVRVPLPMAEVWAEIQAQVEQLTGKP |
| GPIPI_03181620 | 2088090014 | Soil | VKKNYQRKERKSNHKFEVVRGQELLVRVPLPMAEVWAEMQ |
| FD1_08659240 | 2170459024 | Grass Soil | VGNKYQRKERKSNHKFEVVGGQELMVRMPLPMAEVWAEMQAQVAELTGQAG |
| JGI12635J15846_103599552 | 3300001593 | Forest Soil | VXKKYQRKQRKSNRKFEIVRGQELMVQVPLPIAEVWSELQTQVEEL |
| Ga0070667_1003089971 | 3300005367 | Switchgrass Rhizosphere | VRNKYQRKEHKSNHKFEVVGGQELLVRVPLPMAEVWRRCKRR* |
| Ga0070708_1000193926 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRNYRRKAHKSNHKFEAVGEQELLVRVPLPMAEVRAVN* |
| Ga0070708_1002508512 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRNYQRKAHKSNHKFEAVGEQELLVRVPLPMAEVRAAN* |
| Ga0070763_100353361 | 3300005610 | Soil | VRNKYQSKDHKSNPKFEVVRGQELLVQVPLPIAEVWSELQAQV |
| Ga0066903_1012714223 | 3300005764 | Tropical Forest Soil | VKKNYQRKDRKSNHKFEIVGGQELLVRVPLPMAEVW |
| Ga0068863_1017433361 | 3300005841 | Switchgrass Rhizosphere | VRHKYQRQERKSNHKLEIVRGQELLVRVPLPMAEVW |
| Ga0075029_1000753342 | 3300006052 | Watersheds | VRGNYQKKDRKSNHNFEVVRGQKLMVRLLLPMVEVWPRRKRR* |
| Ga0070716_1003312422 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FLKERAAVKKNYQRKERKSNHKFEIVRGQELLMRVPLPMAEVWA* |
| Ga0075425_1001825171 | 3300006854 | Populus Rhizosphere | VRQKYQRQERKSNHKLEMVRGQELLVRVPLPMAELWVEMQAQVEQLTGQAGL |
| Ga0075425_1005685831 | 3300006854 | Populus Rhizosphere | VRKKYQSKERKSNHKFEVVRGQELMVRVPLPMAEV* |
| Ga0075434_1016816771 | 3300006871 | Populus Rhizosphere | VKKNYQRKERKSNHKLEIVRGQELLVRVPLPMAEVW |
| Ga0073928_100942381 | 3300006893 | Iron-Sulfur Acid Spring | VRKERKSNHKFEVVGGQELMVRVPLPLAEVWAEMQAQVEEL |
| Ga0075436_1008686572 | 3300006914 | Populus Rhizosphere | VKKKYQSREHKSNPKFEIVRGQKLLVQVPLPMAEVWAEMQARVEELTGQA |
| Ga0099829_112492432 | 3300009038 | Vadose Zone Soil | VRNNYQTKDRKSNHKFEVVRGQELLVRVPLPMAEVWAEMQAQVEELTG |
| Ga0126374_102546582 | 3300009792 | Tropical Forest Soil | VKKNYQRKGRKSNHKFEVVRGQELLVQVPLPMAEMWAEM |
| Ga0126384_122537282 | 3300010046 | Tropical Forest Soil | VKNKYQRKERKSNHKFEVVGEQELLVRVPLPMAEVWAEMQAQV |
| Ga0126373_101751164 | 3300010048 | Tropical Forest Soil | VRKNYQRKARKSNHKFEVVGGQELLVRVPLPMAEVWA |
| Ga0126373_102185993 | 3300010048 | Tropical Forest Soil | VRQKYQREVRKSNHKFEIVRGQELLVRVPLPMAEVWA |
| Ga0126373_102200172 | 3300010048 | Tropical Forest Soil | VRKKYQRQVRKSNHKFEVVRGQELMVRVPLPLAEVWAEMQTQLG* |
| Ga0099796_104028711 | 3300010159 | Vadose Zone Soil | VKRNYQRKERKSNHKFEVVRGQELLVRVPLPMAEV |
| Ga0074046_102352073 | 3300010339 | Bog Forest Soil | VRNNYQRKERKSNHKFEVVQGQELMVRVPLPMAEVWAEMQAQVEELT |
| Ga0126370_115261363 | 3300010358 | Tropical Forest Soil | VRKNYQRKARKSNHKFEVVGEQELLVPLPMAEVWAEMQAQVE* |
| Ga0126372_126130701 | 3300010360 | Tropical Forest Soil | VRKNYQRQTRKSNHKFEVVGGQELLVRVPLPMAEVWAEMQA |
| Ga0126381_1019009961 | 3300010376 | Tropical Forest Soil | VRNKYQRQDRKSNHKFEVVRGQVLSVRVPLPMAEVWAEMQAQVEQL |
| Ga0126381_1021506782 | 3300010376 | Tropical Forest Soil | VRKKYQRQVRKSNHKFEIVQGQDLLVRVPLPMAEVWAEMQARVEE |
| Ga0126381_1028476611 | 3300010376 | Tropical Forest Soil | VKKKYQRKVCKSNHKFEIVQGRELLVRVPLPMAEVWAEMQARVEE |
| Ga0126381_1029661041 | 3300010376 | Tropical Forest Soil | VRKNYQRKARKSNHKFEVVGGQELLVRVPLPMAEVWAEMQAH |
| Ga0150983_109951892 | 3300011120 | Forest Soil | VRNNYQREVRKSNHKLEVVRGQELLVRVPLPMAEVWAEMQAQVEALAG* |
| Ga0137393_102897282 | 3300011271 | Vadose Zone Soil | VRNKYQTKDRKSNHKFEVVRGQELLVRVPLPMAEVWAEMQAQV |
| Ga0137360_107345601 | 3300012361 | Vadose Zone Soil | VRNKYQRKDRKSNHKFEIVGGQELLVRVPLPIAEVWAEMQAQVEELTG |
| Ga0137390_105106422 | 3300012363 | Vadose Zone Soil | VRKNYQTKDRKSNHKFEVVRGKELLVRVPLPIAEVWAEMQAQVEELTGQAGL |
| Ga0164309_103054501 | 3300012984 | Soil | VRNKYQRKERKSNPKLEVVGGQELLVRVPLPIAEVWAEMQA |
| Ga0164309_115387272 | 3300012984 | Soil | VEKNYQRKEHKSNHKFEVAREQELMVRVPLPMAEVWAEMQTQV |
| Ga0164307_108664222 | 3300012987 | Soil | VRNNYQREVRKSNHKLEVVRGQELLVRVPLPMAEVWAEMQAQVE |
| Ga0181521_103722392 | 3300014158 | Bog | VRNKYQRKDRKSNHKFEIVQGQEMMVQVPLPMAEVGRDA |
| Ga0181532_100052851 | 3300014164 | Bog | VRNKYQRKERKSNHKFEVVGEQELLVRVPLPIAEVWAEM |
| Ga0132258_106949363 | 3300015371 | Arabidopsis Rhizosphere | VRKKYQRQEHKSNHKFEVLRGQGLLVGVPLPMAEVWAEMQAQVEELTARAFISY* |
| Ga0182033_100045221 | 3300016319 | Soil | VKKNYQSKAHKSNHKFEVVGGQELLVRLPLPMAEVWA |
| Ga0182035_103081272 | 3300016341 | Soil | VRKKYQSRKHKSNHKFEIVRGQELLVRVPLPMAEVWAEMQA |
| Ga0182034_112580281 | 3300016371 | Soil | VRKNYQRKARKSNHKFEVVGGQELLVRVSLPMAEV |
| Ga0182034_115302011 | 3300016371 | Soil | VRKNYQRKARKSNHKFEVVGEQELLVRVSLPMAEVW |
| Ga0182039_100266971 | 3300016422 | Soil | KKNYQSKAHKSNHKFEVVGGQELLVRLPLPMAEVWAEMQA |
| Ga0182039_100904464 | 3300016422 | Soil | VRKNYQRKDRKSNHKFEMVGRQELLVRVPLPMAEVWAEM |
| Ga0187802_102180402 | 3300017822 | Freshwater Sediment | VRKNYQRKERKSNYKFEVVGGQELLVQVPLPMAEVWAEMQAKVEELADYQAFVNERSSH |
| Ga0187802_102540441 | 3300017822 | Freshwater Sediment | VRNKYQRKDRKSNHKFEVVGGQELLVRVPLPIAEVWAEMQ |
| Ga0187849_10250581 | 3300017929 | Peatland | VRNNYQRKERKFNHKFEVVGGQELLVQVPLPMAEVWAEMQAKVEELAGQAGL |
| Ga0187877_10238825 | 3300017931 | Peatland | VRNNYQRKERKFNHKFEVVGGQELLVQVPLPMAEVWAEMQAKVEELAGQ |
| Ga0187801_100295403 | 3300017933 | Freshwater Sediment | VRKNYQRKERKSNHKFEVIGGQELLVQVPLPCDAEIMK |
| Ga0187801_101713981 | 3300017933 | Freshwater Sediment | VGKKYQSKERKSIHKFEIVRGQELLVQVPLPMAEVWAEMQA |
| Ga0187853_100256991 | 3300017940 | Peatland | VRNNYQRKERKFNHKFEVVGGQELLVQVPLPMAEVWAEMQAKVEEL |
| Ga0187817_105937451 | 3300017955 | Freshwater Sediment | VRNKYQRKERKSNRKFEVVGGQELLVRVPLPIAEVWAEMQAQVEE |
| Ga0187817_108991562 | 3300017955 | Freshwater Sediment | VRKNYQRKERKSNYKFEVVGGQELLVQVPLPMAEVWAEMQAKVEELADYQAL |
| Ga0187865_13195931 | 3300018004 | Peatland | VRNNYQRKERKSNHKFEVVGGQELLVQVPLPMAEVWAEMQAKVE |
| Ga0187787_104492831 | 3300018029 | Tropical Peatland | VRKNYQRKAHKSNHKFEVVGGRELMVRVPLPMAEVWAEMQAKVEELAGRAGLQ |
| Ga0182025_13281796 | 3300019786 | Permafrost | VRKKYQRKERKSNHKFEVVGGQELLVRVPLPLAQVWAEMQAQVEELTGMTDCRS |
| Ga0193728_11157702 | 3300019890 | Soil | VKKNYQRKERKSNHKFEVVQGQELLVRVPLPMAEVW |
| Ga0193755_11665441 | 3300020004 | Soil | VRNKYQRKDRKSNHKFEVVGGQELLVRVPLPIAEVWAE |
| Ga0210395_111077621 | 3300020582 | Soil | VRNKYQRKERKSNPKLEVVGGQELLVRVPLPIVEVWAEM |
| Ga0210406_104431783 | 3300021168 | Soil | VRNKYQRKERKSNPKLEVVGGQELLVRVPLPIAEVWAEMQAQ |
| Ga0210400_112556162 | 3300021170 | Soil | VKKNYQRKERKSNHKFEARRALESLVRVPLPMAAVWVEMQAQKN |
| Ga0210405_100299284 | 3300021171 | Soil | VRNKYQRKERKSNDKFEVVGGPELMVRVPLPMAEVWAEMQAQVEELTGHAG |
| Ga0210396_100484411 | 3300021180 | Soil | VRKNYERKERKSNHTFEVVRGQELLVRVPLPMAEVWAEMQAKVEELT |
| Ga0210388_100206607 | 3300021181 | Soil | VRNKYQRKQRKSNQKFEIVRGQELMVQVPLPIAEV |
| Ga0210393_106185012 | 3300021401 | Soil | VRKKYQRKERKSNHKFEVVGGRELLVRVPLPLAEVWA |
| Ga0210389_100965801 | 3300021404 | Soil | VRKNYQRKERKSNHKFEVVGGQELMVRVPLPIAEVW |
| Ga0210386_101540893 | 3300021406 | Soil | VRKKYQRKERKSNHKFEVVGGRELLVRVPLPLAEVWAEM |
| Ga0210394_114695022 | 3300021420 | Soil | VRKNYQRKERKSNRKFEVVRGQELLVRVPLPMAEVWAEMQAQVEE |
| Ga0210384_100122299 | 3300021432 | Soil | VRKKYQRKDRKSNHEFEVVGGQELMVRVPLPIAEV |
| Ga0210384_119053761 | 3300021432 | Soil | VKKNYQRKERKSNHKFEVRRALESRVRVPLPMAAVWVEMQAQKN |
| Ga0210410_100180247 | 3300021479 | Soil | VRKNYQRKERKSNRKFEVVRGQELLVRVPLPMAEVWAEMQAQVVIDVEGNCNC |
| Ga0210409_101773921 | 3300021559 | Soil | VRKNYQRKERKSNHKFEVVGGEELMVRVPLPMAEVWAEMQAQVEELTE |
| Ga0126371_104580653 | 3300021560 | Tropical Forest Soil | VRKNYQRKARKSNHKFEVVGGQELLVRVPLPMAEVWAEMQAHVEELAGQAGL |
| Ga0242668_11111981 | 3300022529 | Soil | VRNKYQRKQRKSNPKFQIVCGQELMVQVPLPIAEVWSELQA |
| Ga0212123_100919271 | 3300022557 | Iron-Sulfur Acid Spring | VRKERKSNHKFEVVGGQELMVRVPLPLAEVWAEMQAQ |
| Ga0228598_11147532 | 3300024227 | Rhizosphere | CESLLKERAAVRNKYQRKQRKSNHKFEIVRGQELLVRVPLPIAEVWAEMQTQVEELTG |
| Ga0247677_10383902 | 3300024245 | Soil | VRKKYQRQVRKSNHKLEIVRGQELLVRVPLPMAEV |
| Ga0207684_101691752 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRNYWRKAHKSNHKFEAVGEQELLVRVPLPMAEVRAVN |
| Ga0207706_103598382 | 3300025933 | Corn Rhizosphere | VRNKYQRKEHKSNHKFEVVGGQELLVRVPLPMAEVWRRCKRR |
| Ga0209239_10537203 | 3300026310 | Grasslands Soil | VRNKYQRKDRKSNHKFEIVRGQELLVPLPMAEVWAEMQAQVEEL |
| Ga0209155_12008332 | 3300026316 | Soil | VKKNYQRKERKSNHKFEVVRGQELLVRVPLPMAEV |
| Ga0179587_101318293 | 3300026557 | Vadose Zone Soil | VRNKYQRKDRKSNHKFEVVGGPELLVRVPLPIAEVWAEMQAQ |
| Ga0207948_10077562 | 3300027174 | Forest Soil | VRNKYQRKERKSNHKFEVVGGQELLVRVPLPIAEVWAEMQAQVEQLTGQ |
| Ga0209220_11788101 | 3300027587 | Forest Soil | VRKKYQRKERKSNRKFEVVGGQELLVRVPLPIAEVWAEM |
| Ga0209446_11008541 | 3300027698 | Bog Forest Soil | VRNNYQTKEQKSNHKFDVLGGQELMVQVPLPIAEVWAEMQ |
| Ga0209274_103284701 | 3300027853 | Soil | VRKKYQRKDRKSNHKFEVVGGQELLVRVPLPIAEVW |
| Ga0209380_100889781 | 3300027889 | Soil | VRNKYQRKERKSNHKFEVVGGPELMVRVPLPLAEVWAEMQAQVEELTGHAGL |
| Ga0209380_103024082 | 3300027889 | Soil | VRNNYQRKEQKSNHKFDVLGGQELMVRVPLPIAEVWAEMQ |
| Ga0209526_107540191 | 3300028047 | Forest Soil | VRNKYQTKDRKSNHKFEVVGGQELMVRVPLPLAEVWAEMQAQVEEL |
| Ga0308309_113857111 | 3300028906 | Soil | VRNKYQRKEHKSNHKFEVVGGQELLVRVPLPLAEVWAEMQAQVEELTGHA |
| Ga0075392_111847382 | 3300030843 | Soil | VKKNYQRKERKSNHKFEVVGGQELLVRVPLPIAEVWAEMQAQVEELT |
| Ga0170834_1120895341 | 3300031057 | Forest Soil | VRNKYQRKERKSNHKFEVVRGQELLVRVPLPMAEVWAEMQAQVEELT |
| Ga0170823_148852181 | 3300031128 | Forest Soil | VRKKYQRKERKSNDKFEVVGGRELLVRVPLPLAEVWAEMQAQ |
| Ga0170823_157824321 | 3300031128 | Forest Soil | VSKKYQRKERKSNDKFEVVGGRELLVRVPLPLAEVWAEMQAQ |
| Ga0170824_1270207102 | 3300031231 | Forest Soil | VRNKYQRKQRKSNQKFQIVRGQELMVQVPLPIAEVWRELQAQVEEL |
| Ga0170820_149675802 | 3300031446 | Forest Soil | VRHKYQRQERKSNHKLEIVRGQELLVRVPLPMAEVWAEMQ |
| Ga0310915_104052712 | 3300031573 | Soil | VKKNYQSKAHKSNHKFEVVGGQELLVRLPLPMAEVWAEMQA |
| Ga0310915_106068881 | 3300031573 | Soil | VRKNYQRKARKSNHKFEVVGGQELLVRVPLPMAEV |
| Ga0318542_104428832 | 3300031668 | Soil | VRKNYQRKERKSNHKFEVVRGQELLVRVPLPMAEVW |
| Ga0310686_1084134212 | 3300031708 | Soil | VRNKYQRKQRKSNHKFEIVRGQELLVRVPLPIAEVWAEMQTQVEELTG |
| Ga0310686_1175387131 | 3300031708 | Soil | VRKKYQRKERKSNWKFEIVRGQELMVQVPLPIAEVWSELQTQVEELT |
| Ga0307469_106491892 | 3300031720 | Hardwood Forest Soil | VRNKYQRQERKSNHKFEIVRGQEMLVRVPLPIAEVWAEMQ |
| Ga0307469_107317921 | 3300031720 | Hardwood Forest Soil | VEKNYQRKEHKSNHKFEVAREQELMVRVPLPMAEVWAE |
| Ga0307469_113272401 | 3300031720 | Hardwood Forest Soil | VRKNYQRKERKSNHKFEVVRGQGLLVRVPLPMAEVWAESGY |
| Ga0307468_1010585382 | 3300031740 | Hardwood Forest Soil | RNNYQREVRKSNHKLEVVRGQELLVRVPLPMAEVWAEMQAQVEALAG |
| Ga0307477_108265811 | 3300031753 | Hardwood Forest Soil | VRNKYQRKERKSIHKLEEVQGQQLLVRVPLPMAEV |
| Ga0318554_104901841 | 3300031765 | Soil | VRKNYQRKDRKSNHKLEMVGRQELLVRVPLPMAEVWAEMQARVEEL |
| Ga0318521_103762171 | 3300031770 | Soil | VRKNYQRKVRKSNHKFEVVGGQELLVRVPLPMAEVWAEMQA |
| Ga0318546_101972142 | 3300031771 | Soil | VRKNYQRKDRKSTHKFEMVGRQELLVRVPLPMAEVW |
| Ga0318552_105631501 | 3300031782 | Soil | VRKNYQTIDRKSNHKFDIVGGQELPMRVPLPMAEVCAEMHARVE |
| Ga0318576_106354262 | 3300031796 | Soil | VRKNYQRKARKSNHKFEVVGGQELLVRVPLPMAEVWAEMQ |
| Ga0307478_114290212 | 3300031823 | Hardwood Forest Soil | VRKKYQRKDRKSNHKFEVVGGQELMVQVPLPIAEVWAEMQAQVEKLT |
| Ga0310917_101006254 | 3300031833 | Soil | VRKNYQRKDRKSNHKFEVVGEQELLVRVPLPIAEVWAEMQAQVQELT |
| Ga0307479_100093521 | 3300031962 | Hardwood Forest Soil | VRNKYQRKERKSNHKFEVVEGQELLVQVPLPMAEVWAEMQ |
| Ga0307479_101358013 | 3300031962 | Hardwood Forest Soil | VRKKYQRKERKSNHKFEVVGGQELMMRIPLPLAEVWAEMQG |
| Ga0306922_118937252 | 3300032001 | Soil | VRKNYQSKKHKSNHKFEVVGGQELQVRVPLPMAEVWAEMQAK |
| Ga0318518_106308931 | 3300032090 | Soil | VRKNYQTIDRKSNHKFDIVGGQELPMRVPLPMAEVCAEMHARV |
| Ga0307470_107355362 | 3300032174 | Hardwood Forest Soil | VRNKYQRKDRKSNHKFEVVGGQELLVRVPLPMAEVWAEM |
| Ga0335082_104164131 | 3300032782 | Soil | VRKNYQKKERKSNHKFEVVGGQELLVRVPLPIAEVWAEMQAQ |
| Ga0335073_105417031 | 3300033134 | Soil | VRKNYQRKARKSNRKFEVVGGQELQLRVPLPMAEVWAEMQTKVEELAG |
| Ga0318519_100210221 | 3300033290 | Soil | VRKNYQRRDRKSNHKFEMVGRQELLVRVPLPMAEVWAERCKLGSR |
| Ga0314861_0177203_918_1022 | 3300033977 | Peatland | MRSRYQKKDRKSNHEFEVVGGQELFVRVPLPMAEV |
| ⦗Top⦘ |