


| Basic Information | |
|---|---|
| Family ID | F068021 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRCPACGVGINIDTNRLASAAEEMQKAIEKVPPEITIKFFR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.20 % |
| % of genes near scaffold ends (potentially truncated) | 64.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.60 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.800 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 2.90% Coil/Unstructured: 73.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00487 | FA_desaturase | 6.40 |
| PF00313 | CSD | 4.80 |
| PF13763 | DUF4167 | 3.20 |
| PF13193 | AMP-binding_C | 3.20 |
| PF01436 | NHL | 2.40 |
| PF00294 | PfkB | 1.60 |
| PF00011 | HSP20 | 1.60 |
| PF07045 | DUF1330 | 1.60 |
| PF13683 | rve_3 | 1.60 |
| PF01841 | Transglut_core | 0.80 |
| PF12833 | HTH_18 | 0.80 |
| PF01145 | Band_7 | 0.80 |
| PF07369 | DUF1488 | 0.80 |
| PF04055 | Radical_SAM | 0.80 |
| PF00571 | CBS | 0.80 |
| PF01402 | RHH_1 | 0.80 |
| PF09586 | YfhO | 0.80 |
| PF13701 | DDE_Tnp_1_4 | 0.80 |
| PF13333 | rve_2 | 0.80 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.80 |
| PF00239 | Resolvase | 0.80 |
| PF02738 | MoCoBD_1 | 0.80 |
| PF07690 | MFS_1 | 0.80 |
| PF03006 | HlyIII | 0.80 |
| PF02913 | FAD-oxidase_C | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 6.40 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 6.40 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.60 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.60 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.80 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.80 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.80 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.80 % |
| Unclassified | root | N/A | 39.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02JAFO4 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300000729|JGI12371J11900_1011923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300000858|JGI10213J12805_10071900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer → unclassified Ensifer → Ensifer sp. IC3342 | 1281 | Open in IMG/M |
| 3300000955|JGI1027J12803_103729640 | Not Available | 554 | Open in IMG/M |
| 3300002917|JGI25616J43925_10199706 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300003368|JGI26340J50214_10062840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1000 | Open in IMG/M |
| 3300004152|Ga0062386_101080122 | Not Available | 666 | Open in IMG/M |
| 3300005434|Ga0070709_11422505 | Not Available | 562 | Open in IMG/M |
| 3300005435|Ga0070714_101079344 | Not Available | 782 | Open in IMG/M |
| 3300005435|Ga0070714_102494491 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005538|Ga0070731_10710242 | Not Available | 668 | Open in IMG/M |
| 3300005552|Ga0066701_10223363 | Not Available | 1160 | Open in IMG/M |
| 3300005610|Ga0070763_10207650 | Not Available | 1047 | Open in IMG/M |
| 3300005719|Ga0068861_101636462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 635 | Open in IMG/M |
| 3300005764|Ga0066903_106530469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 608 | Open in IMG/M |
| 3300005843|Ga0068860_101896053 | Not Available | 618 | Open in IMG/M |
| 3300005921|Ga0070766_10427990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 871 | Open in IMG/M |
| 3300005994|Ga0066789_10338567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300006057|Ga0075026_100274539 | Not Available | 912 | Open in IMG/M |
| 3300006059|Ga0075017_100715588 | Not Available | 770 | Open in IMG/M |
| 3300006102|Ga0075015_100603915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 642 | Open in IMG/M |
| 3300006174|Ga0075014_100473287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300006175|Ga0070712_101717888 | Not Available | 549 | Open in IMG/M |
| 3300006177|Ga0075362_10529360 | Not Available | 605 | Open in IMG/M |
| 3300006195|Ga0075366_10518687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300006577|Ga0074050_11128986 | Not Available | 614 | Open in IMG/M |
| 3300006845|Ga0075421_102603666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300006853|Ga0075420_101463539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 586 | Open in IMG/M |
| 3300006854|Ga0075425_102632512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300006871|Ga0075434_100231409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1867 | Open in IMG/M |
| 3300006893|Ga0073928_10178507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1683 | Open in IMG/M |
| 3300007076|Ga0075435_101523557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300007265|Ga0099794_10062362 | Not Available | 1813 | Open in IMG/M |
| 3300007788|Ga0099795_10007822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3010 | Open in IMG/M |
| 3300007788|Ga0099795_10607711 | Not Available | 521 | Open in IMG/M |
| 3300009088|Ga0099830_10022109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4159 | Open in IMG/M |
| 3300009100|Ga0075418_11431566 | Not Available | 750 | Open in IMG/M |
| 3300009137|Ga0066709_103038731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 615 | Open in IMG/M |
| 3300009143|Ga0099792_10407439 | Not Available | 833 | Open in IMG/M |
| 3300009162|Ga0075423_10571905 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300009672|Ga0116215_1459408 | Not Available | 551 | Open in IMG/M |
| 3300009839|Ga0116223_10638796 | Not Available | 613 | Open in IMG/M |
| 3300010358|Ga0126370_11758717 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010371|Ga0134125_11157276 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010379|Ga0136449_102219625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300010379|Ga0136449_104678457 | Not Available | 500 | Open in IMG/M |
| 3300010401|Ga0134121_11609569 | Not Available | 669 | Open in IMG/M |
| 3300011120|Ga0150983_16018257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 677 | Open in IMG/M |
| 3300011270|Ga0137391_11211538 | Not Available | 602 | Open in IMG/M |
| 3300012189|Ga0137388_10137036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2151 | Open in IMG/M |
| 3300012200|Ga0137382_11273871 | Not Available | 520 | Open in IMG/M |
| 3300012203|Ga0137399_10338248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1249 | Open in IMG/M |
| 3300012203|Ga0137399_10626012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300012207|Ga0137381_10207466 | Not Available | 1699 | Open in IMG/M |
| 3300012361|Ga0137360_10173670 | Not Available | 1727 | Open in IMG/M |
| 3300012362|Ga0137361_10119588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2319 | Open in IMG/M |
| 3300012944|Ga0137410_10936621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 734 | Open in IMG/M |
| 3300012987|Ga0164307_11126036 | Not Available | 646 | Open in IMG/M |
| 3300013770|Ga0120123_1038509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1007 | Open in IMG/M |
| 3300014158|Ga0181521_10181553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis heyeri | 1172 | Open in IMG/M |
| 3300014162|Ga0181538_10574439 | Not Available | 589 | Open in IMG/M |
| 3300015241|Ga0137418_11245273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 521 | Open in IMG/M |
| 3300015242|Ga0137412_10083203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2605 | Open in IMG/M |
| 3300015374|Ga0132255_103789602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 642 | Open in IMG/M |
| 3300016270|Ga0182036_10250699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1325 | Open in IMG/M |
| 3300016445|Ga0182038_11991584 | Not Available | 526 | Open in IMG/M |
| 3300017648|Ga0180216_1185698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300017943|Ga0187819_10288028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 956 | Open in IMG/M |
| 3300018003|Ga0187876_1235926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis heyeri | 601 | Open in IMG/M |
| 3300018037|Ga0187883_10467810 | Not Available | 648 | Open in IMG/M |
| 3300018060|Ga0187765_10582906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 720 | Open in IMG/M |
| 3300018073|Ga0184624_10472209 | Not Available | 548 | Open in IMG/M |
| 3300018076|Ga0184609_10076184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1477 | Open in IMG/M |
| 3300018086|Ga0187769_10090076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2192 | Open in IMG/M |
| 3300018086|Ga0187769_10515652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 902 | Open in IMG/M |
| 3300019257|Ga0180115_1314367 | Not Available | 502 | Open in IMG/M |
| 3300020580|Ga0210403_10651930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 847 | Open in IMG/M |
| 3300021078|Ga0210381_10205867 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300021086|Ga0179596_10019520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2427 | Open in IMG/M |
| 3300021086|Ga0179596_10529314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300021090|Ga0210377_10283358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Kaistia → Kaistia granuli | 1021 | Open in IMG/M |
| 3300021178|Ga0210408_10475571 | Not Available | 994 | Open in IMG/M |
| 3300021420|Ga0210394_10701841 | Not Available | 887 | Open in IMG/M |
| 3300021420|Ga0210394_11779391 | Not Available | 514 | Open in IMG/M |
| 3300021445|Ga0182009_10039656 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300022557|Ga0212123_10364122 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300022557|Ga0212123_10840784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 547 | Open in IMG/M |
| 3300025915|Ga0207693_11265908 | Not Available | 553 | Open in IMG/M |
| 3300025915|Ga0207693_11414709 | Not Available | 516 | Open in IMG/M |
| 3300026446|Ga0257178_1045848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300026469|Ga0257169_1016474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangxiense | 1010 | Open in IMG/M |
| 3300026489|Ga0257160_1068582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 625 | Open in IMG/M |
| 3300026498|Ga0257156_1051299 | Not Available | 848 | Open in IMG/M |
| 3300026824|Ga0207723_101579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1996 | Open in IMG/M |
| 3300026947|Ga0207853_1052179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 508 | Open in IMG/M |
| 3300027671|Ga0209588_1196513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300027680|Ga0207826_1207885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 527 | Open in IMG/M |
| 3300027825|Ga0209039_10104687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1210 | Open in IMG/M |
| 3300027889|Ga0209380_10101121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1666 | Open in IMG/M |
| 3300027903|Ga0209488_10026137 | Not Available | 4243 | Open in IMG/M |
| 3300027909|Ga0209382_10597123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1202 | Open in IMG/M |
| 3300028047|Ga0209526_10206942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1357 | Open in IMG/M |
| 3300028807|Ga0307305_10269213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 777 | Open in IMG/M |
| 3300028878|Ga0307278_10419099 | Not Available | 588 | Open in IMG/M |
| 3300028884|Ga0307308_10318626 | Not Available | 745 | Open in IMG/M |
| 3300030885|Ga0265743_101245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1229 | Open in IMG/M |
| 3300030978|Ga0265757_105135 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031184|Ga0307499_10031226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1211 | Open in IMG/M |
| 3300031231|Ga0170824_105583114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300031231|Ga0170824_128749088 | Not Available | 908 | Open in IMG/M |
| 3300031576|Ga0247727_11179023 | Not Available | 515 | Open in IMG/M |
| 3300031890|Ga0306925_10288759 | Not Available | 1765 | Open in IMG/M |
| 3300031890|Ga0306925_10644872 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300032001|Ga0306922_11090885 | Not Available | 819 | Open in IMG/M |
| 3300032063|Ga0318504_10406667 | Not Available | 649 | Open in IMG/M |
| 3300032076|Ga0306924_12355762 | Not Available | 538 | Open in IMG/M |
| 3300032119|Ga0316051_1001878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1339 | Open in IMG/M |
| 3300032160|Ga0311301_10579492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1627 | Open in IMG/M |
| 3300032160|Ga0311301_10826176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1266 | Open in IMG/M |
| 3300032180|Ga0307471_103336277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 569 | Open in IMG/M |
| 3300032205|Ga0307472_101440400 | Not Available | 670 | Open in IMG/M |
| 3300032261|Ga0306920_101610512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 923 | Open in IMG/M |
| 3300032892|Ga0335081_10374250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
| 3300032892|Ga0335081_12601421 | Not Available | 519 | Open in IMG/M |
| 3300032896|Ga0335075_11704362 | Not Available | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.80% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.80% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.80% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000729 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017648 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C BE-Lig MG (version 2) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026947 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030978 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_02029100 | 2170459003 | Grass Soil | MQCPGCGIGINVDTDRLANAAEEMHKALGKVPPEITIKFYR |
| JGI12371J11900_10119231 | 3300000729 | Tropical Forest Soil | MQCPSCGIRINIDTDRLANAADEIRKAIGKVPPEVTIKFFR* |
| JGI10213J12805_100719002 | 3300000858 | Soil | QTVGSLKASEPMRCSRCGIGINIDTNRLAHAAEEIQRAIEKVPPEITIKFFR* |
| JGI1027J12803_1037296402 | 3300000955 | Soil | IKANKHMTCPGCGVGINIDTNRMAMASEEIRKSIEMIPPEITIKFFR* |
| JGI25616J43925_101997061 | 3300002917 | Grasslands Soil | TIGNLKLGKHMQCPECGIGINIDTRRLANAAEEIRRAIDKVPPEITIKFFR* |
| JGI26340J50214_100628401 | 3300003368 | Bog Forest Soil | MICPGCGIGINIDTDKLANAAEEMQKAIDKTPSEITIKFFR* |
| Ga0062386_1010801221 | 3300004152 | Bog Forest Soil | MICPDCRIGINIDTDKLANSADEMQKAIDKTPPEITIKFFR* |
| Ga0070709_114225051 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EHMRCPACGVGINIDTNRLASATEEMRKAIEKVPPEITIKFFR* |
| Ga0070714_1010793442 | 3300005435 | Agricultural Soil | SGIHMRCPGCGIGINIDTDRLASAAEEIHKALDKVPPEITIKFYR* |
| Ga0070714_1024944912 | 3300005435 | Agricultural Soil | GRLKAAERMICPGCDIGINIDTDRLSRAAEEIEKAVAKTPSEITIKFFR* |
| Ga0070731_107102422 | 3300005538 | Surface Soil | LKSGEHMLCSGCGIGINIDTDRLANAADEIGKAIGRAPPEITIKFFR* |
| Ga0066701_102233635 | 3300005552 | Soil | HCPECGVGINIDANRLSRAADEIQKAIDKVPPEITIKFYR* |
| Ga0070763_102076502 | 3300005610 | Soil | CGIGINVDTDRLANAAEEMHKALGKVPPEITIKFYR* |
| Ga0068861_1016364622 | 3300005719 | Switchgrass Rhizosphere | MKCTGCGIGINIDTNRLANAAEEVRQALEKAPPEITIKFYR* |
| Ga0066903_1065304692 | 3300005764 | Tropical Forest Soil | MTCPDCGIGISIDNNRLAKAAEEIRKAIEKTPPEISIKFFR* |
| Ga0068860_1018960531 | 3300005843 | Switchgrass Rhizosphere | IKANEHMTCPGCGIGINIDTDRLAKATDEIQKAMDKIPPEITIKFFR* |
| Ga0070766_104279902 | 3300005921 | Soil | MRCPACGVGINIDTNRLASAAEEMQKAIEKVPPEITIKFFR* |
| Ga0066789_103385672 | 3300005994 | Soil | MIFPDCGIAINIDTDRSANAVKEMQIAVEKSPPEITI |
| Ga0075026_1002745393 | 3300006057 | Watersheds | QIGINIDTNRLTNAADEIHGAIEKTPAEITIRFFR* |
| Ga0075017_1007155881 | 3300006059 | Watersheds | HELKQTVAGLKAERHMICPGCGIGINIDTDKLANAAEEMQKAIDKTPSEITIKFFR* |
| Ga0075015_1006039152 | 3300006102 | Watersheds | MTCPGCGIGITIDANRLSNVIEEIHKAIEKVPPEIRIKFYR* |
| Ga0075014_1004732871 | 3300006174 | Watersheds | CPGGVGINIDMNRLSNAADEIRKTVDKVPPEITIKFF* |
| Ga0070712_1017178881 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KQTIARLKGNEHMTCSGCGIGINIDTNRLAKATEEIQKAIEKIPPEISIKFYR* |
| Ga0075362_105293601 | 3300006177 | Populus Endosphere | MTCSGCKIGINIDTDRLAVASDEIQKALDMVPPEITVKFFQ* |
| Ga0075366_105186872 | 3300006195 | Populus Endosphere | HCTGCGVGINIDTNRLANAAEEIRNAIEKVPPEITIKFYR* |
| Ga0074050_111289862 | 3300006577 | Soil | LKAAERMICPGCDIGINIDTDRLSKAAEEIERAVAKTPSEITIKFFR* |
| Ga0075421_1026036662 | 3300006845 | Populus Rhizosphere | NQHMTCSGCGIGINIDTDRLAKAVDEIQKAMDKIPPEITIKFFRSDLP* |
| Ga0075420_1014635391 | 3300006853 | Populus Rhizosphere | GIGINIDTNRLAHAAEEMQRAIEKVPPEITIKFFR* |
| Ga0075425_1026325121 | 3300006854 | Populus Rhizosphere | GIGINIDTDRLAKAVDEIQKAMDKIPPEITIKFFRSDLP* |
| Ga0075434_1002314092 | 3300006871 | Populus Rhizosphere | MSCSGCGIGINVDTNRLAKATEEIQKAIEKIPPEITIKFFR* |
| Ga0073928_101785072 | 3300006893 | Iron-Sulfur Acid Spring | MVCTGCEVGINIDAAKLSNAAEEMLRAMEKVPPEITIKFFR* |
| Ga0075435_1015235572 | 3300007076 | Populus Rhizosphere | DLHQTIGRLKANEHMSCSGCGIGINVDTNRLAKATEEIQKAIEKIPPEITIKFFR* |
| Ga0099794_100623625 | 3300007265 | Vadose Zone Soil | PECGIGINIDANRLSRAADEIQKAIDKVPPEITIKFYR* |
| Ga0099795_100078222 | 3300007788 | Vadose Zone Soil | MQCPECGIGINIDTRRLANAAEEIRRAIDKVPPEITIKFFR* |
| Ga0099795_106077111 | 3300007788 | Vadose Zone Soil | CGVGINIDADRLSDAADEIQRAIDKVPTEITIKFYR* |
| Ga0099830_100221093 | 3300009088 | Vadose Zone Soil | MRCSGCGVGINIDADRLSNAAIEIQKAIEKVPSEITIKFYR* |
| Ga0075418_114315663 | 3300009100 | Populus Rhizosphere | KAQAHMICSDCGVGINIDTNRLAKSAEEIQNAIEKNPPEISIKFFR* |
| Ga0066709_1030387313 | 3300009137 | Grasslands Soil | KQTIDRLKANEHMTCSGCGIGINIDTDRLAKATDEIQKAIEKSPPEITINFFR* |
| Ga0099792_104074391 | 3300009143 | Vadose Zone Soil | MSCPGRGVGISIDADRLSNAADEIQKAIEKVPSEITIKFYR* |
| Ga0075423_105719051 | 3300009162 | Populus Rhizosphere | TVGSLKANKPMRCSGCGIGINIDTNRLAHAAEEIQNALEKIPPEITIKFFR* |
| Ga0116215_14594082 | 3300009672 | Peatlands Soil | MYIRLGKLKAEKHMICPGCGIGINIDTDRLTNAVEKIQRAIEKSPLEITIKFFR* |
| Ga0116223_106387962 | 3300009839 | Peatlands Soil | RKMICPGCGIGINIDTDKLANATEEMQKAIDKTPSEITIKFFR* |
| Ga0126370_117587171 | 3300010358 | Tropical Forest Soil | MRFTGCGVGIDIDANRLSSAADEIQKAIEKVPPEITIKFYR* |
| Ga0134125_111572763 | 3300010371 | Terrestrial Soil | CSGCGIGINIDTNRLAKATEEIQKAIEKIPPEISIKFYR* |
| Ga0136449_1022196252 | 3300010379 | Peatlands Soil | MYIRLGKLKAEKHMICPGCGIGINIDTDRLTNAVEEKQRAIEKSPPEITIKFFR* |
| Ga0136449_1046784572 | 3300010379 | Peatlands Soil | HMICPGCSIGINIDTDRIANAAEEIQKATEKSPPEITIKFFR* |
| Ga0134121_116095692 | 3300010401 | Terrestrial Soil | CSACGVGINIDTNRLASAAEEIQKAIEKVPPEITIKFFR* |
| Ga0150983_160182572 | 3300011120 | Forest Soil | LKSGERMQCPGCGIGINVDTDRLANAAEEMHKALGKVPPEITIKFYR* |
| Ga0137391_112115381 | 3300011270 | Vadose Zone Soil | MRCPGCGVGINIDANRLASAADEIQKAIEKVPPEITIKFYR* |
| Ga0137388_101370362 | 3300012189 | Vadose Zone Soil | MHCAECGIGINIDATRLANAAEEIRRAIEKVPPEITIKFFR* |
| Ga0137382_112738711 | 3300012200 | Vadose Zone Soil | IRQIKSSEHMNCAGCGIGINIDANRLSSAAAEIQKAIDKMPPEITIKFYR* |
| Ga0137399_103382483 | 3300012203 | Vadose Zone Soil | MQCPECGIGINIDTRRLANAAEEMRRAIDKVPPEITIKFFR* |
| Ga0137399_106260122 | 3300012203 | Vadose Zone Soil | PECGIGINIDTRRLANAAEEIRRAIDKVPPEITIKFFR* |
| Ga0137381_102074661 | 3300012207 | Vadose Zone Soil | MNCAGCGVGINIDANRLSSAADEIQKAIDKVPPEITIKFYR* |
| Ga0137360_101736704 | 3300012361 | Vadose Zone Soil | CPGCGVGINIDTNRLANAAEEIQRAIDNVPPEITIKFFR* |
| Ga0137361_101195883 | 3300012362 | Vadose Zone Soil | MRCPGCGVGINIDANRLSNAADEIQKAIEKVPPEITIKFYR* |
| Ga0137410_109366211 | 3300012944 | Vadose Zone Soil | MRCSGCGVGINIDADRLSNAAIEIQKAIEKVPSEITI |
| Ga0164307_111260361 | 3300012987 | Soil | IGRIKANEHMTCPGCGIGINIDTDRLAKATDEIQKAMDKIPPEITIKFFR* |
| Ga0120123_10385091 | 3300013770 | Permafrost | VGINIDTNRLANAAEEIHNAIEKAPPEITIKFFR* |
| Ga0181521_101815531 | 3300014158 | Bog | STMSINIDTSKLSNAVEEIRKAIEHAPPEITIKFFR* |
| Ga0181538_105744391 | 3300014162 | Bog | AQSKLDRHMNCPGCSIGINIDADRMANAAEEIQKTTEKSPPEITIKFFR* |
| Ga0137418_112452731 | 3300015241 | Vadose Zone Soil | MQCPECGIGINIDTRRLANAAEEIRKAIDKVPPEITIKFF |
| Ga0137412_100832034 | 3300015242 | Vadose Zone Soil | MQCPECGIGINIDSRRLANAAEEIRRAIDKVPPEITIKFFR* |
| Ga0132255_1037896021 | 3300015374 | Arabidopsis Rhizosphere | MTCSGCGVGINIDTDRLAKATEEIQKAIEKIPPEISIKFYR* |
| Ga0182036_102506993 | 3300016270 | Soil | NAHMTCSGCGIGINIDTDRLAKATEEIQKAIEKVPPEITIKFFR |
| Ga0182038_119915841 | 3300016445 | Soil | TIGRLKAQEHMTSSACGIGINIDTNRLAKATDEIQKAIEKDPPEISIKFFR |
| Ga0180216_11856981 | 3300017648 | Compost | MICSGCGIGINIDTNRLANLADELQKATAKVPPEITVKFYR |
| Ga0187819_102880281 | 3300017943 | Freshwater Sediment | IGDLKASEHMRCPGCGVGINIDTNRLASAVEEMQKATEKVPPEITIKFFR |
| Ga0187876_12359262 | 3300018003 | Peatland | GCGISVNIDTSKLSNAVEEIRKAIEHAPPEITIKFFR |
| Ga0187883_104678101 | 3300018037 | Peatland | VAGLKAERHMICPGCGIGINIDTDKLANATEEMQKAIGKTPSEITIKFFR |
| Ga0187765_105829061 | 3300018060 | Tropical Peatland | MQCPSCGVGINIDTNRLANAGEEVHKAIEKVPPETTIEFFR |
| Ga0184624_104722091 | 3300018073 | Groundwater Sediment | MTCPGCGIGINIDTDRLAKATDEIQKAMDKIPPEITIKFFR |
| Ga0184609_100761843 | 3300018076 | Groundwater Sediment | TCPGCRVGINIDTDRLAKAAEEIQKAIKKIPPEITIKFFR |
| Ga0187769_100900762 | 3300018086 | Tropical Peatland | MQCLSCGVGINIDMNRFANAADEIHKAIGKVPPEITIKFFR |
| Ga0187769_105156522 | 3300018086 | Tropical Peatland | MQCSSCGVGINVDTKRLANAADEIYKAIGKVPPEIAIKFFR |
| Ga0180115_13143672 | 3300019257 | Groundwater Sediment | MRCSRCGIGINIDTNRLAHAAEEIQRAIEKVPPEITIKFFR |
| Ga0210403_106519301 | 3300020580 | Soil | EHMVCSSCGIGINIDTNRLAKAAEEIQKALGKTPPEITIKFFR |
| Ga0210381_102058671 | 3300021078 | Groundwater Sediment | MTCPGCHVGINIDTNRLANAAEEIHKAIEKSPPEITIKFFAKSEFG |
| Ga0179596_100195203 | 3300021086 | Vadose Zone Soil | MQCPECGIGINIDTRRLANAAEEIRRAIDKVPPEITIKFFR |
| Ga0179596_105293141 | 3300021086 | Vadose Zone Soil | MHCAECGIGINIDATRLANAAEEIRRAIEKVPPEITIKFFR |
| Ga0210377_102833583 | 3300021090 | Groundwater Sediment | PGCGIGINIDTSRLAKAAEEIQKAIDKVPPEITIKFFR |
| Ga0210408_104755712 | 3300021178 | Soil | SSCGIGINIDTDRLAKAAEEIQKALDKTPPEITIKFFR |
| Ga0210394_107018412 | 3300021420 | Soil | MRCPSCGVGINIDTNRLADAAEEMHKALEKAPSEITIKFYR |
| Ga0210394_117793911 | 3300021420 | Soil | ICPGCGIGINIDTDKLANAAEEMQKAIDKTPSEITIKFVR |
| Ga0182009_100396562 | 3300021445 | Soil | MRCGGCGVGINIDTNRLANAADEMRSAMEKVPPEITIKFFH |
| Ga0212123_103641222 | 3300022557 | Iron-Sulfur Acid Spring | MVCTGCEVGINIDAAKLSNAAEEMLRAMEKVPPEITIKFFR |
| Ga0212123_108407841 | 3300022557 | Iron-Sulfur Acid Spring | LKSGEHMQCPGCGIGINVDTDRLANAAEELHKALGKVPPEITIKFYR |
| Ga0207693_112659082 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | HSGHWQNEHMRCPGCDVGINIDTNRLANAAEEIHKAIEKVPPEITIKFFR |
| Ga0207693_114147091 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | CGQELKQTIARLKGNEHMTCSGCGIGINIDTNRLAKATEEIQKAIEKIPPEISIKFYR |
| Ga0257178_10458481 | 3300026446 | Soil | HMQCPECGIGINIDSRRLANAAEEIRRAIDKVPPEITIKFFR |
| Ga0257169_10164742 | 3300026469 | Soil | GQIKSSEHMGCSGCGVGINIDADRLSNAAIEIQKAIEKVPSEITIKFYR |
| Ga0257160_10685822 | 3300026489 | Soil | MQCPECGIGINIDTRRLANAAEEMRRAIDKVPPEITIKFFR |
| Ga0257156_10512991 | 3300026498 | Soil | EHMRCSGCGVGINIDADRLSNAAIEIQKAIEKVPSEITIKFYR |
| Ga0207723_1015793 | 3300026824 | Tropical Forest Soil | MQCPSCGIRINIDTDRLANAADEIRKAIGKVPPEVTIKFFR |
| Ga0207853_10521791 | 3300026947 | Tropical Forest Soil | EQSIGRLKSGEHMQCPSCGIRINIDTDRLANAADEIRKAIGKVPPEVTIKFFR |
| Ga0209588_11965131 | 3300027671 | Vadose Zone Soil | KSSEHMRCPACGVGINIDTNRLASAAEEMQKAIEKVPPEITIKFFR |
| Ga0207826_12078852 | 3300027680 | Tropical Forest Soil | SIGRLKLGEHMQCPSCGVGINIDTNRFVNAADEIHKAIGKVPPEITIKFFR |
| Ga0209039_101046872 | 3300027825 | Bog Forest Soil | MICPGCGIGINIDTDKLANATEEMQKAIDKTPSEITIKFFR |
| Ga0209380_101011212 | 3300027889 | Soil | MRCPACGVGINIDTNRLASAAEEMQKAIEKVPPEITIKFFR |
| Ga0209488_100261375 | 3300027903 | Vadose Zone Soil | MSCPGRGVGISIDADRLSNAADEIQKAIEKVPSEITIKFYR |
| Ga0209382_105971233 | 3300027909 | Populus Rhizosphere | MSCSGCGIGINVDTNRLAKATEEIQKAIEKIPPEITIKFFR |
| Ga0209526_102069424 | 3300028047 | Forest Soil | MVCTGCGVGINIDAAKLSNAAEEMLRAMEKVPPEIT |
| Ga0307305_102692131 | 3300028807 | Soil | MTCPGCHVGINIDTNRLANAAEEIHKAIEKSPPEITIKFFAK |
| Ga0307278_104190991 | 3300028878 | Soil | GRLRTAEHMTCPGCHVGINIDTNRLANAAEEIHKAIEKSPPEITIKFFAK |
| Ga0307308_103186261 | 3300028884 | Soil | RLKAAERMICPGCDIGINIDTDRLSKAAEEIERAVAKTPSEITIKFFR |
| Ga0265743_1012452 | 3300030885 | Soil | MCCRGCGVGINIDMNRLANAAEEIRRALEKVPPEITIKFFR |
| Ga0265757_1051351 | 3300030978 | Soil | STHMRCRGCDVGINIDTNRLANAAEEIRRALEKVPPEITIKFHSA |
| Ga0307499_100312261 | 3300031184 | Soil | NEHMTCPGCGVGINIDTDRLAKATDEIQKAMDKIPPEITIKFFR |
| Ga0170824_1055831142 | 3300031231 | Forest Soil | LKSNEHMTCPGCGIGINIDTDRLAKATEEIQKAIGKFPPEITIKFFR |
| Ga0170824_1287490881 | 3300031231 | Forest Soil | LKAAERMICPGCDIGINIDTDRLSKAAEEIERAVAKTPSEITIKFFR |
| Ga0247727_111790232 | 3300031576 | Biofilm | PGCGIGINIDTNRLAKAAEEIQKAIEKIPPEITIKFFR |
| Ga0306925_102887591 | 3300031890 | Soil | PGCGIGINIDTNRLANAAEEMPKKVPPEITIKFYR |
| Ga0306925_106448724 | 3300031890 | Soil | GCDVGINIDADRLANAAEEIRRALEKAPPEITIRFFQER |
| Ga0306922_110908852 | 3300032001 | Soil | MLTLVTFPGCGIGIDIDTNRLANAAEEMPKKVPPEITIKFYR |
| Ga0318504_104066672 | 3300032063 | Soil | LRLSKSMRCRGCDVGINIDTDRLANAAEELCRALEKVPPEITIKFFQ |
| Ga0306924_123557622 | 3300032076 | Soil | EKHMTCPRCGIGINIDTDRLANAAQEIRKAIEKSPPEITIKFYR |
| Ga0316051_10018783 | 3300032119 | Soil | MRCRGCGVGINIDTNRLANAADEMQSAMEKVPPEITVKFFH |
| Ga0311301_105794922 | 3300032160 | Peatlands Soil | MYIRLGKLKAEKHMICPGCGIGINIDTDRLTNAVEEKQRAIEKSPPEITIKFFR |
| Ga0311301_108261761 | 3300032160 | Peatlands Soil | CPGCGIGINIDTDKLANAAEEMQKAIDKTPSEITIKFFR |
| Ga0307471_1033362771 | 3300032180 | Hardwood Forest Soil | GHDLKQTIGRLKANEHMTCPGCGIGINIDTNRLAKAAEEIRNAIEKIPAEITIKFFR |
| Ga0307472_1014404002 | 3300032205 | Hardwood Forest Soil | MRCPGCAIGINIDTNKLANAAAEIGKAIDMVPPEITIKFFR |
| Ga0306920_1016105122 | 3300032261 | Soil | MQCPGCGIGINIDTNRLANAAEEMPKKVPPEITIKFYR |
| Ga0335081_103742501 | 3300032892 | Soil | RSGEHMRCAGCGIGINIDTNRLADAADQIRKAIEKMPPEITIKFFR |
| Ga0335081_126014212 | 3300032892 | Soil | MQCRACGIGINVDTDRLANAADEIHKAIEKVPPEITIKFFR |
| Ga0335075_117043622 | 3300032896 | Soil | SIGRLKSGERMQCPGCGIGVNIDTNRLANAAEEMHKVLEKVRPEITIKFYR |
| ⦗Top⦘ |