


| Basic Information | |
|---|---|
| Family ID | F067968 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTSPRKK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.20 % |
| % of genes near scaffold ends (potentially truncated) | 56.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.80 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.400 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.600 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF02954 | HTH_8 | 18.40 |
| PF01408 | GFO_IDH_MocA | 11.20 |
| PF05870 | PA_decarbox | 9.60 |
| PF00158 | Sigma54_activat | 8.80 |
| PF00171 | Aldedh | 5.60 |
| PF08447 | PAS_3 | 3.20 |
| PF00512 | HisKA | 2.40 |
| PF04542 | Sigma70_r2 | 1.60 |
| PF13372 | Alginate_exp | 0.80 |
| PF02518 | HATPase_c | 0.80 |
| PF00248 | Aldo_ket_red | 0.80 |
| PF02627 | CMD | 0.80 |
| PF12697 | Abhydrolase_6 | 0.80 |
| PF08240 | ADH_N | 0.80 |
| PF01266 | DAO | 0.80 |
| PF13557 | Phenol_MetA_deg | 0.80 |
| PF00107 | ADH_zinc_N | 0.80 |
| PF00126 | HTH_1 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG3479 | Phenolic acid decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 9.60 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 5.60 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 5.60 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 5.60 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.60 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.60 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.60 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.60 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.80 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.40 % |
| Unclassified | root | N/A | 9.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100852354 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300002908|JGI25382J43887_10418555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 566 | Open in IMG/M |
| 3300005171|Ga0066677_10169794 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005181|Ga0066678_10298006 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300005334|Ga0068869_101938480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005341|Ga0070691_10911776 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005436|Ga0070713_101731894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300005439|Ga0070711_101511093 | Not Available | 586 | Open in IMG/M |
| 3300005445|Ga0070708_101170285 | Not Available | 720 | Open in IMG/M |
| 3300005471|Ga0070698_102120923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005536|Ga0070697_100942404 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005556|Ga0066707_10902329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005602|Ga0070762_10552932 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005921|Ga0070766_11296843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300006059|Ga0075017_101277794 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006175|Ga0070712_101414326 | Not Available | 607 | Open in IMG/M |
| 3300006176|Ga0070765_100851784 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006893|Ga0073928_11106761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 536 | Open in IMG/M |
| 3300007265|Ga0099794_10770694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300009012|Ga0066710_101342123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1109 | Open in IMG/M |
| 3300009088|Ga0099830_11341570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300009093|Ga0105240_12309496 | Not Available | 557 | Open in IMG/M |
| 3300009137|Ga0066709_102997022 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009143|Ga0099792_11168581 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009174|Ga0105241_11576810 | Not Available | 634 | Open in IMG/M |
| 3300010159|Ga0099796_10092468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300010373|Ga0134128_11782607 | Not Available | 677 | Open in IMG/M |
| 3300010373|Ga0134128_12343751 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010403|Ga0134123_10833255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 920 | Open in IMG/M |
| 3300010876|Ga0126361_10045287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300012189|Ga0137388_10513935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300012200|Ga0137382_10296162 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300012202|Ga0137363_10896283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012205|Ga0137362_10985867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 718 | Open in IMG/M |
| 3300012208|Ga0137376_11117422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300012208|Ga0137376_11717708 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012211|Ga0137377_10971383 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012362|Ga0137361_10076386 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300012362|Ga0137361_11080826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300012582|Ga0137358_10739745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300012683|Ga0137398_10765189 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012683|Ga0137398_10768870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012925|Ga0137419_10666851 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300012929|Ga0137404_10849686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300012930|Ga0137407_10783563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300012944|Ga0137410_10524784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300012944|Ga0137410_10642144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300012984|Ga0164309_11067790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300015053|Ga0137405_1095859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2079 | Open in IMG/M |
| 3300015054|Ga0137420_1421784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4115 | Open in IMG/M |
| 3300015241|Ga0137418_10137335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2165 | Open in IMG/M |
| 3300015356|Ga0134073_10398404 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300019887|Ga0193729_1142246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300020021|Ga0193726_1013494 | All Organisms → cellular organisms → Bacteria | 4314 | Open in IMG/M |
| 3300020140|Ga0179590_1157556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300020199|Ga0179592_10017533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3154 | Open in IMG/M |
| 3300020579|Ga0210407_11339288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300020580|Ga0210403_10066101 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300020580|Ga0210403_10136040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2005 | Open in IMG/M |
| 3300020580|Ga0210403_10956573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300020582|Ga0210395_10373323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300020583|Ga0210401_10031522 | All Organisms → cellular organisms → Bacteria | 5049 | Open in IMG/M |
| 3300020583|Ga0210401_10063225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3484 | Open in IMG/M |
| 3300020583|Ga0210401_10074400 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
| 3300020583|Ga0210401_10941825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300020583|Ga0210401_11019463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300021088|Ga0210404_10727248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300021168|Ga0210406_10844628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300021170|Ga0210400_10398829 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300021178|Ga0210408_10594058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300021180|Ga0210396_10229928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1651 | Open in IMG/M |
| 3300021180|Ga0210396_10345141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
| 3300021401|Ga0210393_10610917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300021403|Ga0210397_10659361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300021413|Ga0193750_1066657 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021420|Ga0210394_10810223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300021433|Ga0210391_10054524 | All Organisms → cellular organisms → Bacteria | 3178 | Open in IMG/M |
| 3300021478|Ga0210402_11564366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300021559|Ga0210409_10689126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300025900|Ga0207710_10188833 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300025939|Ga0207665_10765089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 762 | Open in IMG/M |
| 3300025942|Ga0207689_11583921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300026041|Ga0207639_12126157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. AZCC_0083 | 522 | Open in IMG/M |
| 3300026088|Ga0207641_10932069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300026325|Ga0209152_10380225 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026361|Ga0257176_1001493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2087 | Open in IMG/M |
| 3300026377|Ga0257171_1018482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
| 3300026467|Ga0257154_1009327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1327 | Open in IMG/M |
| 3300026467|Ga0257154_1080584 | Not Available | 519 | Open in IMG/M |
| 3300026482|Ga0257172_1056782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300026508|Ga0257161_1006940 | Not Available | 1985 | Open in IMG/M |
| 3300026514|Ga0257168_1140836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300026551|Ga0209648_10306165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300026557|Ga0179587_10543151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300026920|Ga0208575_1013617 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300027583|Ga0209527_1012580 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
| 3300027591|Ga0209733_1109319 | Not Available | 692 | Open in IMG/M |
| 3300027629|Ga0209422_1153152 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027698|Ga0209446_1100345 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300027729|Ga0209248_10139734 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300027862|Ga0209701_10497831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300027889|Ga0209380_10337936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 884 | Open in IMG/M |
| 3300028047|Ga0209526_10340710 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300028673|Ga0257175_1088504 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300028906|Ga0308309_10415416 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300030776|Ga0075396_1832583 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300030841|Ga0075384_11356986 | Not Available | 542 | Open in IMG/M |
| 3300030847|Ga0075405_12231817 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300030851|Ga0075380_11344592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1003 | Open in IMG/M |
| 3300030854|Ga0075385_11723431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300030935|Ga0075401_10011767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300030991|Ga0073994_10076822 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300031122|Ga0170822_15480548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300031231|Ga0170824_113912938 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300031231|Ga0170824_127387179 | Not Available | 666 | Open in IMG/M |
| 3300031446|Ga0170820_10200541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031446|Ga0170820_12428251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300031715|Ga0307476_10317417 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300031718|Ga0307474_10041406 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| 3300031718|Ga0307474_11362340 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031753|Ga0307477_10970398 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031754|Ga0307475_10474002 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300031754|Ga0307475_10991417 | Not Available | 661 | Open in IMG/M |
| 3300032174|Ga0307470_10507186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300032180|Ga0307471_104202428 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030851 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1008523542 | 3300002245 | Forest Soil | VQEADHPQEIEKTEEEGRKAACGFGEIGENCDFTSPQEKA* |
| JGI25382J43887_104185552 | 3300002908 | Grasslands Soil | VQEAGHPQEIEKTEEEGRKAACGFGEIGGNCDFTSSQKRPS* |
| Ga0066677_101697941 | 3300005171 | Soil | VQEAGHPQQIETTEEEGREAACGFGEIGENCDFTILGRG* |
| Ga0066678_102980062 | 3300005181 | Soil | MFSQQLQVQEADHSQEIEKTEEEGRKAARGFGEIGENCDFTSPRKRPS* |
| Ga0068869_1019384801 | 3300005334 | Miscanthus Rhizosphere | QVQEADHSQEIEKTEEEGRKVACGFGEIGENCDFTSPRKRPS* |
| Ga0070691_109117762 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VQEADHSQEIEKAEEEGLKAACGFGEIGGNCDFTIPRKRPG* |
| Ga0070713_1017318941 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VQEAGHPQEIEKTEEEGREAACGFGEIGENCDFTILGRG* |
| Ga0070711_1015110931 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VQEADHSQEIEKTEEVRRKAACGFGEIGETCDFTSSWKRPS* |
| Ga0070708_1011702853 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SQQLQVQEADHSQEIEKAEEEGRKVACGFGEIGGNCDFTSPQKKKA* |
| Ga0070698_1021209232 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RRYVTLSQQLQEQEANHPQEIEKTEEEGGKAACGFGEIGENCDFTSPRKRPS* |
| Ga0070697_1009424042 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VQEADHTQEIEKTEEEGLKAAGFFGEIGGNRDFTIPRKRPG* |
| Ga0066707_109023292 | 3300005556 | Soil | SQQLQVQEADHTQEIEKAEQVERKAACGFGEIGENCDFTSPRKRPS* |
| Ga0070762_105529322 | 3300005602 | Soil | MQEAGHQQEIEKTEEGTRKAACGFGETGENRDFTNPGEKD* |
| Ga0070766_112968432 | 3300005921 | Soil | KVQEAGHPQEIERTEEEGREAAGGFGEIGENCDFTILGRG* |
| Ga0075017_1012777942 | 3300006059 | Watersheds | VQEAGHPQVIERTEEEGREAAGEFCEIGENCDFTSGNA* |
| Ga0070712_1014143262 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VQEADHTQEIEKTEEEGLKAAGFFGEIGGNCDFTIPRKRPG* |
| Ga0070765_1008517842 | 3300006176 | Soil | VQEADHSQKIEKAEEEGRKAICGFGEIGENCDFTNPGERPS* |
| Ga0073928_111067611 | 3300006893 | Iron-Sulfur Acid Spring | QVQEADHSQKIEKTEEEGRKATCGFGEIGENCDFTSPRQGPS* |
| Ga0099794_107706941 | 3300007265 | Vadose Zone Soil | QLQVQEADHSQEIEKTEEVGRKAARGFGEIGENCDFASPRKRPS* |
| Ga0066710_1013421231 | 3300009012 | Grasslands Soil | VQEAGHPQEIEKTEEEGRKAACGFGEIGGNCDFTS |
| Ga0099830_113415702 | 3300009088 | Vadose Zone Soil | VQEAGHPQEIERTEEEGREAACGFGEIGENCDFTILGRG* |
| Ga0105240_123094962 | 3300009093 | Corn Rhizosphere | MQKVEKTEEEGRKASGFFGEIGENCDFTSPRKRPT* |
| Ga0066709_1029970221 | 3300009137 | Grasslands Soil | MFSQQLQVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTSP |
| Ga0099792_111685811 | 3300009143 | Vadose Zone Soil | VQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTSPRKK |
| Ga0105241_115768101 | 3300009174 | Corn Rhizosphere | VQKADHTQEIEKTEEEGLKAAGFFGEIGGNRDFTIPRKRPG* |
| Ga0099796_100924681 | 3300010159 | Vadose Zone Soil | HPQEIEKAEQVERKAACGFGEIGENCDFTSPRKRPS* |
| Ga0134128_117826072 | 3300010373 | Terrestrial Soil | LSQQLQVQEADHMQKVEKTEEEGRKASGFFGEIGENCDFTSPRKRPT* |
| Ga0134128_123437512 | 3300010373 | Terrestrial Soil | VQEADHSQEIEKAEEEGLKAACGFGEIGGNCDFTIPR |
| Ga0134123_108332551 | 3300010403 | Terrestrial Soil | SQEIEKAEEEGLKAACGFGEIGGNCDFTIPRKRPG* |
| Ga0126361_100452872 | 3300010876 | Boreal Forest Soil | QQLQVQEPDHSQEIEKTEEERRKAACGFGEIGKNCDFTSPRKRPS* |
| Ga0137388_105139352 | 3300012189 | Vadose Zone Soil | VQEADHTQEIEKTEEERRKAACEFGEIGENCDFTSPQEKKA* |
| Ga0137382_102961622 | 3300012200 | Vadose Zone Soil | PQEIGKTEEEGRKAACGFGEIGEDCDFTSPRKKA* |
| Ga0137363_108962832 | 3300012202 | Vadose Zone Soil | VQEAGHQQQIETTEEEGREAACGFGEIGENCDFTILGRG* |
| Ga0137362_109858671 | 3300012205 | Vadose Zone Soil | TQEIEKTEEEGLKAAGFFGEIGGNCDFTIPRKMPG* |
| Ga0137376_111174221 | 3300012208 | Vadose Zone Soil | QLQVQEADHTQEIEKAEQVERKAACGFGEIGENCDFTSPQKRPS* |
| Ga0137376_117177082 | 3300012208 | Vadose Zone Soil | VQEADHTQEIEKAEQVERKAACGFGEIGENCDFTSPQ |
| Ga0137377_109713832 | 3300012211 | Vadose Zone Soil | VQEADHPQEIEKTEEEGRKAACGFGEIGGNCDFTSPRKKA* |
| Ga0137361_100763861 | 3300012362 | Vadose Zone Soil | VQEADHSQEIEKTEEEGRKTGCGFGEIGENCDFTSS |
| Ga0137361_110808262 | 3300012362 | Vadose Zone Soil | QVQEADHPQEIEKAEQVERKAACGFGEIGENCDFTSPRKRPS* |
| Ga0137358_107397451 | 3300012582 | Vadose Zone Soil | QQLQVQEADHSQEIEKTEEVGRKAARGFGEIGENCDFTSPRKMPS* |
| Ga0137398_107651891 | 3300012683 | Vadose Zone Soil | RVTFSQQLRVQEADHLQEIEKTKEEGRKAACGFGEIGETCDFTSSWKRPS* |
| Ga0137398_107688701 | 3300012683 | Vadose Zone Soil | EADHPQEIEKAEQVERKAACGFGEIGENCDFTSSWKRPS* |
| Ga0137419_106668511 | 3300012925 | Vadose Zone Soil | QEADHPQEIEKAEQVERKAACGFGEIGENCDFTSSWKRPS* |
| Ga0137404_108496861 | 3300012929 | Vadose Zone Soil | QVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTNPRKKA* |
| Ga0137407_107835631 | 3300012930 | Vadose Zone Soil | FSQQLQVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTNPRKKA* |
| Ga0137410_105247841 | 3300012944 | Vadose Zone Soil | LQVQEADHLQEIEKAEQVERKAACGFGEIGENCDFTSPRKRPS* |
| Ga0137410_106421441 | 3300012944 | Vadose Zone Soil | DHLQEIEKAEQVERKAACGFGEIGENCDFTSPRKRPS* |
| Ga0164309_110677902 | 3300012984 | Soil | HVTFSQELQVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFASLRKKA* |
| Ga0137405_10958592 | 3300015053 | Vadose Zone Soil | VQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTNPRKKA* |
| Ga0137420_14217849 | 3300015054 | Vadose Zone Soil | RSAKVQEADHTQEIEKTEEERRKAACGFGEIGENCDFTSSWKRPS* |
| Ga0137418_101373351 | 3300015241 | Vadose Zone Soil | ADHSQEIEKTEEVGRKAARGFGEIGGYCDFTSAQKRPS* |
| Ga0134073_103984041 | 3300015356 | Grasslands Soil | VQEAGHPQQIETTEEEGREAACGFGEIGENCDFTILG |
| Ga0193729_11422462 | 3300019887 | Soil | VQEAGHPQEIERTEEEGREAACGFGEIGENCDFTILGRG |
| Ga0193726_10134944 | 3300020021 | Soil | VNLYVRGRKQLQVQAADHPQEIEKTEEEGREAACGFGEIGGNCDFTILGRG |
| Ga0179590_11575561 | 3300020140 | Vadose Zone Soil | EADHPQEIEKAEQVERKAACGFGEIGENCDFTSSWKRPS |
| Ga0179592_100175333 | 3300020199 | Vadose Zone Soil | QLQVQEADHSQEIEKTEEVGRKAARGFGEIGENCDFTSPRKRPS |
| Ga0210407_113392882 | 3300020579 | Soil | PQLKVQEVGHPQEIERTEEEGREAACGFGESGENCDFTILGRG |
| Ga0210403_100661012 | 3300020580 | Soil | VQEADHPQEIEKTEEEGRKAACGFGEIGESCDFAVLGKV |
| Ga0210403_101360403 | 3300020580 | Soil | MQEADHPQEIEKTEEEGRKAACGFGEIRKNCDFTSPRKRPK |
| Ga0210403_109565732 | 3300020580 | Soil | VQEAGHPEEIEKTEEEGREAACGFGGFGEIGEKCDFTSPHIAR |
| Ga0210395_103733232 | 3300020582 | Soil | VQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFASLRKKA |
| Ga0210401_100315224 | 3300020583 | Soil | MQEAGHQQEIEKTEEGTRKAACGFGETGENRDFTNPGEKD |
| Ga0210401_100632253 | 3300020583 | Soil | VQEADHPQEIEKTEEEGRKAACGFGEIGGNCDFASLRKKA |
| Ga0210401_100744002 | 3300020583 | Soil | VQEVGHSQEIEKTEEEGREAACGFGEFGENCDFTNPGRMPS |
| Ga0210401_109418252 | 3300020583 | Soil | VQEADHSQEIEKTEDEARKAAGGFGEIGGNCDFTSAIQ |
| Ga0210401_110194632 | 3300020583 | Soil | LKVQEAGHPQEIEKTEKEGREAACGFGEIGENCDFTILGRG |
| Ga0210404_107272481 | 3300021088 | Soil | VQEADHPQEIEKTEEEGREAACGFSEIGENCDFTS |
| Ga0210406_108446282 | 3300021168 | Soil | MFSQQLQVQEADHSQEIEKTEEVGRKAARGFREIRGNRDFTIAARHSSLA |
| Ga0210400_103988292 | 3300021170 | Soil | VQEADHSQEIEKTEEEERKGARGFGEIGGNCDFASLRKKA |
| Ga0210408_105940581 | 3300021178 | Soil | VQEAGHPQEIEKTEKEGRNVACGFGEIGENCDFTILGRG |
| Ga0210396_102299282 | 3300021180 | Soil | VQEAGHPQEIERTEEERREAACGFGEIGENCDFTILGRG |
| Ga0210396_103451412 | 3300021180 | Soil | VQEAGHQQQIETTEEEEREAACGFGEIGENCDFTILGRG |
| Ga0210393_106109172 | 3300021401 | Soil | LSQQLPVHEADHSQEIERTEEEGRKAACGFGEIGENCDFTSSRNEV |
| Ga0210397_106593612 | 3300021403 | Soil | VQEAGHQQQIETTEEEGREAACGFGEIGENCDFTILGRG |
| Ga0193750_10666572 | 3300021413 | Soil | VQEAGHPQEIEKTEEEGRKAACGFGEIGGNCDFTSSQKD |
| Ga0210394_108102231 | 3300021420 | Soil | EADHSQEIEKTEEEGRKAACGFGEIGGNCDFASLRKKA |
| Ga0210391_100545244 | 3300021433 | Soil | VQEVGHSQEIEKTEEEGREAACGFGEIGENCDFTNPGRMPS |
| Ga0210402_115643662 | 3300021478 | Soil | QVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFASLRKKA |
| Ga0210409_106891262 | 3300021559 | Soil | VQEADHSQEIEKTEEEGRKGARGFGEIGGNCDFASLRKKA |
| Ga0207710_101888331 | 3300025900 | Switchgrass Rhizosphere | VQEADHSQEIEKAEEEGLKAACGFGEIGGNCDFTIPRKRPG |
| Ga0207665_107650892 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DHTQEIEKTEEEGLKAAGFFGEIGGNCDFTIPRKRRG |
| Ga0207689_115839212 | 3300025942 | Miscanthus Rhizosphere | RLSQQLQVQEADHSQEIEKTEEEGRKVACGFGEIGENCDFTSPRKRPS |
| Ga0207639_121261573 | 3300026041 | Corn Rhizosphere | DHSQEIEKTEEEGRKVACGFGEIGENCDFTSPRKRPS |
| Ga0207641_109320692 | 3300026088 | Switchgrass Rhizosphere | LSQQLQVQKANHSQEIEKAEQVERKAACGFGEIGENCDFTSSWKRPS |
| Ga0209152_103802252 | 3300026325 | Soil | VQEAGHPQQIETTEEEGREAACGFGEFGENCDFTILGRG |
| Ga0257176_10014932 | 3300026361 | Soil | VQEAGHPQQIETTEEEGREAACGFGEIGENCDFTILGRG |
| Ga0257171_10184823 | 3300026377 | Soil | TLSQQLQVQEADHSQEIEKTEEERRKAACGFGEIGENCDFTSSWKRPS |
| Ga0257154_10093273 | 3300026467 | Soil | VQEAGHPQEIEKTEEEGRKAACGFGEIGGNCDFTSSQKRP |
| Ga0257154_10805842 | 3300026467 | Soil | VQEADHSQEIEKTEKEGRKAACGFGEIGENCDFTSPRKKA |
| Ga0257172_10567822 | 3300026482 | Soil | MQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFASLRKKA |
| Ga0257161_10069403 | 3300026508 | Soil | VQEAGHPQEIERTEEEGREAACGFGEIGENCDFTISEEAS |
| Ga0257168_11408362 | 3300026514 | Soil | VQEAGHPQEIERTEKERREAACGFGEIGENCDFTILGKG |
| Ga0209648_103061653 | 3300026551 | Grasslands Soil | GRLSLQVQEADHPQEIEKAAEEGRKAACGFGEIGKNCDFTSPRRRPS |
| Ga0179587_105431512 | 3300026557 | Vadose Zone Soil | LLLSFQEADHSQEIEKTEEVGRKAARGFGEIGENCDFTSPRKRPS |
| Ga0208575_10136172 | 3300026920 | Soil | VQEAGHPQEIERTEEEGREAACGFGEIGENCDFTILGR |
| Ga0209527_10125801 | 3300027583 | Forest Soil | RLSQQLQVQEADHPQEIEKTEEEGRKAACGFGEIGENCDFTSARKRDSGVFSLD |
| Ga0209733_11093191 | 3300027591 | Forest Soil | VQEADHTQEIEKTEEEGLKAAGFFGEIGGNCDFTIPRKRPG |
| Ga0209422_11531522 | 3300027629 | Forest Soil | VQEADHSQEIEKTEEEGRKAACGFGEIGENCDFTS |
| Ga0209446_11003451 | 3300027698 | Bog Forest Soil | VQVAGHPQKVERTEEEAREAACEFCEIGENCDFTS |
| Ga0209248_101397342 | 3300027729 | Bog Forest Soil | VQAAGHPQEVERTEEEGREAACEFCEIGENCDFTSPRQKLS |
| Ga0209701_104978312 | 3300027862 | Vadose Zone Soil | VQEADHSQEIEKTEEERRKAACGFGEIGENCDFTSS |
| Ga0209380_103379361 | 3300027889 | Soil | MQEAGHSQGIEKTEEERRKVAGGFGENGEKCDFTGAQS |
| Ga0209526_103407101 | 3300028047 | Forest Soil | MRAICCSGRGSKELQVQEADHPQEIERTEEEGREAACGFGEIGENCDFTSPRKRP |
| Ga0257175_10885041 | 3300028673 | Soil | QLQVQEADHRQEIEKTEEEGRKAACGFGEIGGNCDFTSPRKIGSSH |
| Ga0308309_104154163 | 3300028906 | Soil | VQEAGHPQQIETTEEEGREAACGFGEIGENCDFTSCGWRIVI |
| Ga0075396_18325832 | 3300030776 | Soil | VQEADHSQEIEKTEEEARKAACGFGEIGGNCDFASFLEKA |
| Ga0075384_113569861 | 3300030841 | Soil | MKLCGRRGSKQLQVQEADHPQEMEKTEEEGREAACGFSEIGENCDFTS |
| Ga0075405_122318172 | 3300030847 | Soil | VQEADHSQEIEKIEDEGRKAACGFGEIGENCDFTS |
| Ga0075380_113445923 | 3300030851 | Soil | VQEADHSQEIEKTEEEGRKAACGFGEIGENCDFTSPR |
| Ga0075385_117234311 | 3300030854 | Soil | SQQLQVQEADHPQEIEKTEEEGRKAACGFGEIGENCDFTSPRKRPR |
| Ga0075401_100117671 | 3300030935 | Soil | SQQLQVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTSPRKKA |
| Ga0073994_100768222 | 3300030991 | Soil | VQKAGHPQEIERTEEEGREAACGFGEIGENCDFTISEEAS |
| Ga0170822_154805482 | 3300031122 | Forest Soil | VTFSQQLQVQEADHSQEIEKTEEEGRKAACGFGEIGGNCDFTSPRKKA |
| Ga0170824_1139129382 | 3300031231 | Forest Soil | VQEAGHPQEIEKTEEEGREATCGFGEIGENCDFTILGRG |
| Ga0170824_1273871791 | 3300031231 | Forest Soil | RLSQQLQVQEADHPQEIEKTEEEGRKAAGFFGEIGENCDFTSPRKRPG |
| Ga0170820_102005412 | 3300031446 | Forest Soil | MDHSQEIEKIEDEGRKAACGFGEIGENCDFASSQEKPS |
| Ga0170820_124282512 | 3300031446 | Forest Soil | VQEAGRPQEIEKTEEEGREAACGFGEIGENCDFTILGRG |
| Ga0307476_103174172 | 3300031715 | Hardwood Forest Soil | VQEAGHPQEIEKTEEEGREAVCGFGEIGENCDFTILRRG |
| Ga0307474_100414062 | 3300031718 | Hardwood Forest Soil | VQEADHPQEIEKTEEEGRKAACGFGEIGGNCDFASLREKA |
| Ga0307474_113623401 | 3300031718 | Hardwood Forest Soil | VQEAGHPQEIERTEEEEREAACGFGEIGENCDFTTTRKRPS |
| Ga0307477_109703981 | 3300031753 | Hardwood Forest Soil | VQEAGHPQQIETTEEEGPEAACGFGEIGENCDFTILGRG |
| Ga0307475_104740021 | 3300031754 | Hardwood Forest Soil | LQVQEADHSQEIEKAEEEGRKVACGFGEIGGNCDFTSPQKKRPSCV |
| Ga0307475_109914171 | 3300031754 | Hardwood Forest Soil | QVQEAGHSQAIEKTEEVGRKAACGFGEIGENCDFT |
| Ga0307470_105071862 | 3300032174 | Hardwood Forest Soil | YVTLSQQLQAQEADQPQEIEKTEEEGRKAVCGFGEIGENYDFTNPRKRPS |
| Ga0307471_1042024282 | 3300032180 | Hardwood Forest Soil | VQEAGHPQEIEKTEEEGREAACGFGEIGENCDFTILGRH |
| ⦗Top⦘ |