


| Basic Information | |
|---|---|
| Family ID | F067967 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VFLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRAVLVNEGFLLLSG |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.40 % |
| % of genes near scaffold ends (potentially truncated) | 82.40 % |
| % of genes from short scaffolds (< 2000 bps) | 84.00 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.400 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF13240 | zinc_ribbon_2 | 6.40 |
| PF13248 | zf-ribbon_3 | 4.00 |
| PF01138 | RNase_PH | 2.40 |
| PF00588 | SpoU_methylase | 2.40 |
| PF01797 | Y1_Tnp | 2.40 |
| PF00891 | Methyltransf_2 | 1.60 |
| PF11645 | PDDEXK_5 | 1.60 |
| PF00474 | SSF | 1.60 |
| PF08238 | Sel1 | 0.80 |
| PF01541 | GIY-YIG | 0.80 |
| PF13847 | Methyltransf_31 | 0.80 |
| PF00583 | Acetyltransf_1 | 0.80 |
| PF08445 | FR47 | 0.80 |
| PF08281 | Sigma70_r4_2 | 0.80 |
| PF03726 | PNPase | 0.80 |
| PF02837 | Glyco_hydro_2_N | 0.80 |
| PF10978 | DUF2785 | 0.80 |
| PF00486 | Trans_reg_C | 0.80 |
| PF08818 | DUF1801 | 0.80 |
| PF00665 | rve | 0.80 |
| PF13429 | TPR_15 | 0.80 |
| PF14559 | TPR_19 | 0.80 |
| PF12848 | ABC_tran_Xtn | 0.80 |
| PF13744 | HTH_37 | 0.80 |
| PF00005 | ABC_tran | 0.80 |
| PF16640 | Big_3_5 | 0.80 |
| PF08681 | DUF1778 | 0.80 |
| PF07589 | PEP-CTERM | 0.80 |
| PF13560 | HTH_31 | 0.80 |
| PF01053 | Cys_Met_Meta_PP | 0.80 |
| PF07676 | PD40 | 0.80 |
| PF02687 | FtsX | 0.80 |
| PF05973 | Gp49 | 0.80 |
| PF07927 | HicA_toxin | 0.80 |
| PF02874 | ATP-synt_ab_N | 0.80 |
| PF03747 | ADP_ribosyl_GH | 0.80 |
| PF00782 | DSPc | 0.80 |
| PF12867 | DinB_2 | 0.80 |
| PF00312 | Ribosomal_S15 | 0.80 |
| PF07366 | SnoaL | 0.80 |
| PF13365 | Trypsin_2 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 3.20 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 2.40 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 2.40 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 2.40 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 2.40 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.40 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 2.40 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.80 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.80 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.80 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.80 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.80 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.80 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.80 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.80 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.80 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.80 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.80 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.80 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.80 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.80 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.80 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.80 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.80 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.80 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.20 % |
| Unclassified | root | N/A | 28.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002915|JGI25387J43893_1069924 | Not Available | 521 | Open in IMG/M |
| 3300004080|Ga0062385_10134976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1252 | Open in IMG/M |
| 3300004156|Ga0062589_101593677 | Not Available | 646 | Open in IMG/M |
| 3300004633|Ga0066395_10856443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300004633|Ga0066395_10900049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 536 | Open in IMG/M |
| 3300004800|Ga0058861_10133761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 508 | Open in IMG/M |
| 3300005174|Ga0066680_10058520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2282 | Open in IMG/M |
| 3300005175|Ga0066673_10140284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1337 | Open in IMG/M |
| 3300005180|Ga0066685_10617636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300005187|Ga0066675_10418299 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005293|Ga0065715_11178538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300005332|Ga0066388_101016006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1391 | Open in IMG/M |
| 3300005332|Ga0066388_102763239 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300005332|Ga0066388_107896296 | Not Available | 532 | Open in IMG/M |
| 3300005335|Ga0070666_10238516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1285 | Open in IMG/M |
| 3300005338|Ga0068868_100207563 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300005434|Ga0070709_10814654 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005435|Ga0070714_100570766 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300005435|Ga0070714_100909671 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300005436|Ga0070713_100626099 | Not Available | 1023 | Open in IMG/M |
| 3300005518|Ga0070699_100963971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300005518|Ga0070699_102118039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300005554|Ga0066661_10299155 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005578|Ga0068854_100283203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300005586|Ga0066691_10059338 | Not Available | 2071 | Open in IMG/M |
| 3300005587|Ga0066654_10726696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300005614|Ga0068856_100002925 | All Organisms → cellular organisms → Bacteria | 17486 | Open in IMG/M |
| 3300005843|Ga0068860_100246074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1740 | Open in IMG/M |
| 3300005904|Ga0075280_10144741 | Not Available | 509 | Open in IMG/M |
| 3300006034|Ga0066656_10571881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300006162|Ga0075030_100051180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3449 | Open in IMG/M |
| 3300006162|Ga0075030_100488165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 980 | Open in IMG/M |
| 3300006175|Ga0070712_101472642 | Not Available | 595 | Open in IMG/M |
| 3300006237|Ga0097621_100600126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300006794|Ga0066658_10686210 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006804|Ga0079221_10139167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1253 | Open in IMG/M |
| 3300006806|Ga0079220_11967147 | Not Available | 520 | Open in IMG/M |
| 3300006806|Ga0079220_12017717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300009093|Ga0105240_10302075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1831 | Open in IMG/M |
| 3300009174|Ga0105241_10518569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300009176|Ga0105242_12799815 | Not Available | 538 | Open in IMG/M |
| 3300009177|Ga0105248_10127239 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
| 3300009545|Ga0105237_10027956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5747 | Open in IMG/M |
| 3300009545|Ga0105237_10306376 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300009551|Ga0105238_10069057 | All Organisms → cellular organisms → Bacteria | 3534 | Open in IMG/M |
| 3300009553|Ga0105249_12011684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300009672|Ga0116215_1303456 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009826|Ga0123355_10257373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2447 | Open in IMG/M |
| 3300009826|Ga0123355_10324521 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300009826|Ga0123355_11220638 | Not Available | 765 | Open in IMG/M |
| 3300010043|Ga0126380_10213826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300010048|Ga0126373_10033778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4446 | Open in IMG/M |
| 3300010048|Ga0126373_10911410 | Not Available | 943 | Open in IMG/M |
| 3300010048|Ga0126373_11620066 | Not Available | 712 | Open in IMG/M |
| 3300010049|Ga0123356_11433443 | Not Available | 850 | Open in IMG/M |
| 3300010323|Ga0134086_10346761 | Not Available | 586 | Open in IMG/M |
| 3300010358|Ga0126370_11683386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 610 | Open in IMG/M |
| 3300010360|Ga0126372_11673818 | Not Available | 677 | Open in IMG/M |
| 3300010360|Ga0126372_12774029 | Not Available | 542 | Open in IMG/M |
| 3300010366|Ga0126379_11213583 | Not Available | 860 | Open in IMG/M |
| 3300010375|Ga0105239_13438278 | Not Available | 515 | Open in IMG/M |
| 3300010376|Ga0126381_101583965 | Not Available | 946 | Open in IMG/M |
| 3300010376|Ga0126381_102610374 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010376|Ga0126381_104220122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300010396|Ga0134126_10254375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2076 | Open in IMG/M |
| 3300010399|Ga0134127_12669675 | Not Available | 579 | Open in IMG/M |
| 3300011269|Ga0137392_10207158 | Not Available | 1606 | Open in IMG/M |
| 3300012096|Ga0137389_10069326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2722 | Open in IMG/M |
| 3300012198|Ga0137364_10557510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300012199|Ga0137383_10295895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300012207|Ga0137381_10025563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4720 | Open in IMG/M |
| 3300012207|Ga0137381_10362770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
| 3300012209|Ga0137379_10020302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6380 | Open in IMG/M |
| 3300012211|Ga0137377_10977813 | Not Available | 777 | Open in IMG/M |
| 3300012353|Ga0137367_10347217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1056 | Open in IMG/M |
| 3300012354|Ga0137366_10757773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300012357|Ga0137384_10068456 | All Organisms → cellular organisms → Bacteria | 2947 | Open in IMG/M |
| 3300012357|Ga0137384_10158419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1895 | Open in IMG/M |
| 3300012357|Ga0137384_10832510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300012469|Ga0150984_118891438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300012532|Ga0137373_10313783 | Not Available | 1242 | Open in IMG/M |
| 3300012944|Ga0137410_11590048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012948|Ga0126375_10653542 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012971|Ga0126369_10116282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium dinghuense | 2454 | Open in IMG/M |
| 3300012977|Ga0134087_10717601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 532 | Open in IMG/M |
| 3300012987|Ga0164307_10157742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1501 | Open in IMG/M |
| 3300013100|Ga0157373_10178637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1494 | Open in IMG/M |
| 3300013296|Ga0157374_11407060 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300013308|Ga0157375_12102155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300013832|Ga0120132_1000915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4060 | Open in IMG/M |
| 3300014497|Ga0182008_10715755 | Not Available | 573 | Open in IMG/M |
| 3300014968|Ga0157379_10516374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300015264|Ga0137403_10382889 | Not Available | 1289 | Open in IMG/M |
| 3300016357|Ga0182032_10767702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. PC23-8 | 813 | Open in IMG/M |
| 3300017955|Ga0187817_10105858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1773 | Open in IMG/M |
| 3300018431|Ga0066655_10199670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300018468|Ga0066662_11408466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300018482|Ga0066669_10624110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300019361|Ga0173482_10136871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300020199|Ga0179592_10372764 | Not Available | 626 | Open in IMG/M |
| 3300020580|Ga0210403_10079623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 2639 | Open in IMG/M |
| 3300021170|Ga0210400_10578897 | Not Available | 926 | Open in IMG/M |
| 3300021560|Ga0126371_10346706 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300022504|Ga0242642_1059769 | Not Available | 609 | Open in IMG/M |
| 3300025928|Ga0207700_10762220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 865 | Open in IMG/M |
| 3300025941|Ga0207711_11675039 | Not Available | 579 | Open in IMG/M |
| 3300026313|Ga0209761_1249504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300026335|Ga0209804_1104861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300026537|Ga0209157_1069266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1776 | Open in IMG/M |
| 3300026809|Ga0207820_113520 | Not Available | 606 | Open in IMG/M |
| 3300027000|Ga0207803_1020902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300027576|Ga0209003_1079149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300027645|Ga0209117_1034345 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300028381|Ga0268264_10830333 | Not Available | 925 | Open in IMG/M |
| 3300029903|Ga0247271_102137 | All Organisms → cellular organisms → Bacteria | 4579 | Open in IMG/M |
| 3300030339|Ga0311360_11538748 | Not Available | 519 | Open in IMG/M |
| 3300030617|Ga0311356_10894584 | Not Available | 836 | Open in IMG/M |
| 3300031057|Ga0170834_112477843 | Not Available | 687 | Open in IMG/M |
| 3300031231|Ga0170824_103709859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300031231|Ga0170824_119633366 | Not Available | 579 | Open in IMG/M |
| 3300031573|Ga0310915_10528210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300031912|Ga0306921_12409549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300032059|Ga0318533_11275038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300032261|Ga0306920_100072010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5066 | Open in IMG/M |
| 3300034965|Ga0370497_0202137 | Not Available | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 3.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.40% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.80% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.80% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.80% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25387J43893_10699242 | 3300002915 | Grasslands Soil | MIFLVRFEVVRQLTYTFAQQSNLDFRAAGIGGMRSVLIND* |
| Ga0062385_101349761 | 3300004080 | Bog Forest Soil | EKAAARAVVFLVRLEVLRQLSNAFAQQRDLNFRASGIGCMRTVLVNEGFLLLSG* |
| Ga0062589_1015936772 | 3300004156 | Soil | RLEVLRQLANSFTQQRNLDFGAAGVGRMRSVSVNEGLLLLSG* |
| Ga0066395_108564431 | 3300004633 | Tropical Forest Soil | ARAVILLVRFEVFRQMTNALAQQSDLHFRTACVGGMRTVLVDEGFLLLSG* |
| Ga0066395_109000491 | 3300004633 | Tropical Forest Soil | VFLVRLEVLRQLANPFAEQSDLNFRATGIACMRAVLVNEGFLLLSG* |
| Ga0058861_101337611 | 3300004800 | Host-Associated | MVFLVRLEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG |
| Ga0066680_100585201 | 3300005174 | Soil | LADQHEKTPARAVVFLVRLEVLRQVTNALAQKRDLDFWAACVRAMSTVLVNEGLLLLSG* |
| Ga0066673_101402842 | 3300005175 | Soil | MVFLVHFEVVRQLTNAFAQQSDLDFWTARIGRVRTVLINEGFLLLSG* |
| Ga0066685_106176363 | 3300005180 | Soil | QATPLADQHEKAAARAVVFLVRLEVLRQLPNPFADQRDLDLRAPGVRNMRTVLVNEGFLLLSG* |
| Ga0066675_104182991 | 3300005187 | Soil | AVVFLVRLEVLRQLANAFAKQSDLDLGAPGIAGSSPVLVNEGFLLLSG* |
| Ga0065715_111785381 | 3300005293 | Miscanthus Rhizosphere | MVFLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG* |
| Ga0066388_1010160064 | 3300005332 | Tropical Forest Soil | HEKTAARAMVFQVRFEVLRQLTNAFAQQSDLDFWAARIGGMRSVLINDRFLLLSG* |
| Ga0066388_1027632392 | 3300005332 | Tropical Forest Soil | VFQVRFEVVRQLTNAFAQQSDLDFWAARIGGVRSVLIDDRFLLLSG* |
| Ga0066388_1078962961 | 3300005332 | Tropical Forest Soil | VRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLFSG* |
| Ga0070666_102385161 | 3300005335 | Switchgrass Rhizosphere | MVLLVRFEVIRQLANALAKQRDLDFGAARIGGMRSVLVDEGFLLLSG* |
| Ga0068868_1002075632 | 3300005338 | Miscanthus Rhizosphere | MVFLVRLEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG* |
| Ga0070709_108146542 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRLEVLRQLANPFAKQSDLNFRASGVARVGPVLVNEGFLLLSG* |
| Ga0070714_1005707662 | 3300005435 | Agricultural Soil | MVFLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLINEGFLLLSG* |
| Ga0070714_1009096713 | 3300005435 | Agricultural Soil | FLVRLEVLRQLANAFAKQSDLDLWAPGIAGSSPVLVNEGSLLLSG* |
| Ga0070713_1006260992 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VVFLVRLEVLRQLADAFAKQSDLDLWAPGIAGSSPVLVNEGFLLLSG* |
| Ga0070699_1009639711 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AVILLVRFEVLRQLTNALAQQRDLDFGAARIGGMRPVLVDEGFLLLSG* |
| Ga0070699_1021180392 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFQVRLEVVLQLTNAFAQQSDLDFWTARIGGMRAVLVNEGFLLLSG* |
| Ga0066661_102991551 | 3300005554 | Soil | MVLQVRFEVVRQLTNPFAQQSDLDFWTARIGGVRSVLINDRFLLLSG* |
| Ga0068854_1002832031 | 3300005578 | Corn Rhizosphere | EVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG* |
| Ga0066691_100593384 | 3300005586 | Soil | RQLPNAFADQRDLDLRAPGVRSMRTVLVNEGFLLLSG* |
| Ga0066654_107266961 | 3300005587 | Soil | VFLVRFEVLRQLANALAQQRDLYFWTARIGGMRAMLVNEGPFLLSG* |
| Ga0068856_10000292518 | 3300005614 | Corn Rhizosphere | MVFLVRLEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLS |
| Ga0068860_1002460741 | 3300005843 | Switchgrass Rhizosphere | VLLVRFEVIRQLANTLAQQRDLDFGAARISSVGAVLVDEGFLLLSG* |
| Ga0075280_101447411 | 3300005904 | Rice Paddy Soil | KVFRQLTNALAQQRYLDFRASRVRSVRAILVNEGFLLLSG* |
| Ga0066656_105718811 | 3300006034 | Soil | VIFQVRFEVVRQLTNPFAQQSDLDFWTARIGGVRSVLINNGFLLLSG* |
| Ga0075030_1000511805 | 3300006162 | Watersheds | LADQHEKSAARAVVFLVRLEVLRQLANAFAKQSDLHFRASGIACVGPVLVNEGFLLLSG* |
| Ga0075030_1004881652 | 3300006162 | Watersheds | RLEVLRQLANAFTEQRDLDFRTAGIAWMRAVLVDEGFFVLSG* |
| Ga0070712_1014726422 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNAFAQQSDLDFWTARIGGMRAVLINEGFLLLSG* |
| Ga0097621_1006001262 | 3300006237 | Miscanthus Rhizosphere | RFEVLRQLTNALAQQSDLNFRAAGIGSMGCILVNEGFLLLSG* |
| Ga0066658_106862102 | 3300006794 | Soil | FLVRLEVLRQLANAFAKQSDLDLGAPGIAGSSPVLVNEGFLLLSG* |
| Ga0079221_101391671 | 3300006804 | Agricultural Soil | KVFRQLTNSLAQQCDLDLRAPGVRGMRAILVNEGFLLLSG* |
| Ga0079220_119671471 | 3300006806 | Agricultural Soil | MIFQVRFEVVRQLTNAFAQQSDLDFWTARIGGVSSVLINEGFLLLSG* |
| Ga0079220_120177172 | 3300006806 | Agricultural Soil | IFLVRFEVLRQLTNALAQQSDLNFRAAGVGSMGCILVNEGFLLLSG* |
| Ga0105240_103020754 | 3300009093 | Corn Rhizosphere | RFEVLRQLTNAFAQQSDLDFWTARIGGVRSVLINDRFLLLSG* |
| Ga0105241_105185692 | 3300009174 | Corn Rhizosphere | EKTAARAMVLLVRFEVLRQLTNALAQQRDLDFGAARVGGMGPVLVDEGFLLLSG* |
| Ga0105242_127998151 | 3300009176 | Miscanthus Rhizosphere | VLLVRFEVIRQLANALAKQRDLDFGAARIGGMRSVLVDEGFLLLSG* |
| Ga0105248_101272393 | 3300009177 | Switchgrass Rhizosphere | LVRLEVLRQLANSFTQQRNLDFGAAGVGRMRSVSVNEGLLLLSG* |
| Ga0105237_100279561 | 3300009545 | Corn Rhizosphere | MIFQVRFEVVRQLTNAFAQQSDLDFWTARIGGVRSVLINDRFLLLSG* |
| Ga0105237_103063763 | 3300009545 | Corn Rhizosphere | VFLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRAVLVNEGFLLLSG* |
| Ga0105238_100690571 | 3300009551 | Corn Rhizosphere | LRQLTNAFAQQSDLDFWTARIGGMRAVLVNEGFLLLSG* |
| Ga0105249_120116841 | 3300009553 | Switchgrass Rhizosphere | QLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG* |
| Ga0116215_13034561 | 3300009672 | Peatlands Soil | RAVVFLVRLEVLRQLANAFTQQRDLNFRAAGIARMRAVLVDEGFLVLSG* |
| Ga0123355_102573734 | 3300009826 | Termite Gut | EKSAARAVVFLVRLEVLRQLANPLAKQGNLDFRATGIARMRAVLVNEGFFLLSG* |
| Ga0123355_103245214 | 3300009826 | Termite Gut | EKSAARAVVFLVRLEVLRQLANPLAKQGNLDFRATGIARMRAVSVNEGFLLLSG* |
| Ga0123355_112206382 | 3300009826 | Termite Gut | GQLANPLAKQSNLDFGATGIARMRAVLVNEGFLLLSG* |
| Ga0126380_102138261 | 3300010043 | Tropical Forest Soil | AVVFLVRLEVLRQLANPFAEQGDLDFRASGIARMRAVLVNEGFLLLSG* |
| Ga0126373_100337781 | 3300010048 | Tropical Forest Soil | QVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG* |
| Ga0126373_109114101 | 3300010048 | Tropical Forest Soil | QVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLFSG* |
| Ga0126373_116200661 | 3300010048 | Tropical Forest Soil | VLRQLANPFAEQGDLDFRASGIARMRAVLVNERFLLLSG* |
| Ga0123356_114334432 | 3300010049 | Termite Gut | MVFLVRLEVLRQLTNAFAQQSDLDFWTTRIGGMRSVLVNEGFLLLSG* |
| Ga0134086_103467611 | 3300010323 | Grasslands Soil | RFEVARQLTNPFAQQSDLDFWTARIGRVRSVLINNGFLLLSG* |
| Ga0126370_116833862 | 3300010358 | Tropical Forest Soil | RQLTNAFAQQSDLDFWTARIGGVRSVLINDRFLLLSG* |
| Ga0126372_116738182 | 3300010360 | Tropical Forest Soil | RQLANAFAKQSDLNFRAAGIACMRAVLINEGFLLLSG* |
| Ga0126372_127740291 | 3300010360 | Tropical Forest Soil | ARAMIFQVRFEVVRQLTNAFAQQSDLYFWTARIGRVRSVLINDRFLLLSG* |
| Ga0126379_112135832 | 3300010366 | Tropical Forest Soil | TVVLQVRFEVFRQLTNAFAQQSDLDFWAARIGGMRSVLINEGFLLFSG* |
| Ga0105239_134382781 | 3300010375 | Corn Rhizosphere | QLANALAKQRDLDFGAARIGGMRSVLVDEGFLLLSG* |
| Ga0126381_1015839651 | 3300010376 | Tropical Forest Soil | RFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG* |
| Ga0126381_1026103742 | 3300010376 | Tropical Forest Soil | ATRAVILQVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLINEGFLLFSG* |
| Ga0126381_1042201222 | 3300010376 | Tropical Forest Soil | LVCLEVLRQLANAFAQQSDLDFWTARIGGMRAVLINDGSLLLSG* |
| Ga0134126_102543753 | 3300010396 | Terrestrial Soil | FEVVRQLTNALAQQSDLNFRAAGIGSVGTVLIND* |
| Ga0134127_126696752 | 3300010399 | Terrestrial Soil | FLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRAVLVNEGFLLLSG* |
| Ga0137392_102071582 | 3300011269 | Vadose Zone Soil | LLVRFEVLRQLTNALAQQRDLDFGAARIGGMRPVLVDEGFLLLSG* |
| Ga0137389_100693261 | 3300012096 | Vadose Zone Soil | MIFQVRLEVVLQLTNAFAQQSDLNLWTARIGGMRAVLVNEGFLLLSG* |
| Ga0137364_105575102 | 3300012198 | Vadose Zone Soil | RAVVFLVRLEVLRQMTDAFAQQSDLDLWAAGVGSMRRIGLNEGFFLLSG* |
| Ga0137383_102958951 | 3300012199 | Vadose Zone Soil | RQLTNPFAQQSDLDFWTARIGGVRSVLINDRFLLLSG* |
| Ga0137381_100255636 | 3300012207 | Vadose Zone Soil | VLQVRFEVVCQLTDAFAQQSDLDFRTPSIGGMRSVLINDRFLLLSG* |
| Ga0137381_103627702 | 3300012207 | Vadose Zone Soil | VRLEVLRQVTNALAQKRDLDFWAAGVRAMSTVLVNEGLLLLSG* |
| Ga0137379_100203021 | 3300012209 | Vadose Zone Soil | VVFLVRLEVLRQLANAFAEQRDLDFRAAGIAGMLPVLVDEGFLVLSG* |
| Ga0137377_109778131 | 3300012211 | Vadose Zone Soil | VLRQLANAFAEQRDLDFRAAGIAGMLPVLVDEGFLVLSG* |
| Ga0137367_103472171 | 3300012353 | Vadose Zone Soil | DQHEKPAARAVVFLVRLEVLRQLPNPFAQQSDLYFRASGIARMGPVLVNEGFLLLSG* |
| Ga0137366_107577732 | 3300012354 | Vadose Zone Soil | EKTAARAMVFQVRFEVARQLTNAFAQQSDLNFWTARIGGMRAVLVNEGFLMLSG* |
| Ga0137384_100684567 | 3300012357 | Vadose Zone Soil | LRQLANAFAEQRDLEFRAAGIAGMLPVLVDEGFLVLSG* |
| Ga0137384_101584192 | 3300012357 | Vadose Zone Soil | MIFQVHFEVVCQLTDAFAQQSDLDFWTARIGGMRPVLINDRFLLLSG* |
| Ga0137384_108325101 | 3300012357 | Vadose Zone Soil | TNALAQQRDLDFGAARIGGMGPVLVDEGFLLLSG* |
| Ga0150984_1188914382 | 3300012469 | Avena Fatua Rhizosphere | RLEVLRQLTNPFAEQRNLNFRTARIRGMRAVLVDEGLFLLSG* |
| Ga0137373_103137833 | 3300012532 | Vadose Zone Soil | RAMVLQVRLEVVRQLTNAFAQQSDLDFWAARIGGVRSVLINDGFLLLSG* |
| Ga0137410_115900481 | 3300012944 | Vadose Zone Soil | LQLTNPFAQQSDLYLWAARIGGMRAVLVNEGFLLLSG* |
| Ga0126375_106535422 | 3300012948 | Tropical Forest Soil | AARAVVFLVRLEVLRQLANPLAKQSDLDFGTAGIARVRSVLVNEGSFLLSG* |
| Ga0126369_101162821 | 3300012971 | Tropical Forest Soil | QATPLADQHEKAAARAVVFLVRLEVLRQLANPFAEQSDLHFRAAGIARVGPVLVNEGFLLLSG* |
| Ga0134087_107176012 | 3300012977 | Grasslands Soil | EKSAARAVVFLVRLEVLRQLPNTFAKQSDLNLGAAGIARSSPVLVNEGFLLLSG* |
| Ga0164307_101577422 | 3300012987 | Soil | MVLQVRLEVVLQLTNAFAQQSDLDFGTARIGGMGPVLVNEGFLLLSG* |
| Ga0157373_101786373 | 3300013100 | Corn Rhizosphere | MVFLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRAVLVNEGFLLLSG* |
| Ga0157374_114070601 | 3300013296 | Miscanthus Rhizosphere | AARAVVFLVRLEVLRQLANAFAKQSDLDLWAPGIAGSSPVLVNEGFLLLSG* |
| Ga0157375_121021552 | 3300013308 | Miscanthus Rhizosphere | LLVRFEVIRQLANTLAQQRDLDFGAARISSVGAVLVDEGFLLLSG* |
| Ga0120132_10009153 | 3300013832 | Permafrost | MVFLVRFEVVRQLANTFAQQSDLDFWTARIGGVSSVLVDEGFLLLSG* |
| Ga0182008_107157551 | 3300014497 | Rhizosphere | MVFLVRFEVLRQLTNAFAQQSDLDFWTARIGGVRSVLINNGFLLLSG* |
| Ga0157379_105163742 | 3300014968 | Switchgrass Rhizosphere | VVLLVRFEVIRQLANTLAQQRDLDFGAARISSVGAVLVDEGFLLLSG* |
| Ga0137403_103828894 | 3300015264 | Vadose Zone Soil | VLRQLTNALAQQRDLDFGAARIGGMGPVLVNEGFLLLSG* |
| Ga0182032_107677022 | 3300016357 | Soil | FLVRLEVLRQLANALAEQSDLDFGTAGVARMRAVLVNEGFLLLSG |
| Ga0187817_101058581 | 3300017955 | Freshwater Sediment | EKPAARAVVFLVRLEVLRQLANPFAKQCDLDFRASGVAGMRVVLVNEGFLLLPR |
| Ga0066655_101996702 | 3300018431 | Grasslands Soil | QVRFEVVRQLTNPFAQQSDLDFWTARIGGVRSVLINDRFLLLSG |
| Ga0066662_114084661 | 3300018468 | Grasslands Soil | LADQHEKAAARAVVFLVRLEVLRQLPNPFADQRDLDLRAPGVRSMRTVLVNEGFLLLSG |
| Ga0066669_106241102 | 3300018482 | Grasslands Soil | FQVRFEVVRQLTNPFAQQSDLDFWTARIGGVRSVLINNGFFLLSG |
| Ga0173482_101368712 | 3300019361 | Soil | MVFLVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLLSG |
| Ga0179592_103727641 | 3300020199 | Vadose Zone Soil | QHEKTAARAMVLLVRFEVIRQLANPFAKQRDLDFGAARIGGMRAVLVDEGFLLLSG |
| Ga0210403_100796231 | 3300020580 | Soil | LVRFEVFRQLTDALAYQRDLDFGATRVGGMRAVVVNEGFLLLSG |
| Ga0210400_105788972 | 3300021170 | Soil | MIFQVRFEVVLQMTNTFAQQSDLYLWTARIGGMRAVLVNEGFLLLSG |
| Ga0126371_103467061 | 3300021560 | Tropical Forest Soil | QVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLVNEGFLLFSG |
| Ga0242642_10597691 | 3300022504 | Soil | VVLQVRLEVLRQMANALAKQRDLNFRTAGIVRVRTVLVNEGSFFVLWLALTW |
| Ga0207700_107622202 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VVFLVRLEVLRQLTDTFAEKGDLNFRAAGIARMRAVLVDEGFLVLSG |
| Ga0207711_116750392 | 3300025941 | Switchgrass Rhizosphere | LVRLEVLRQLANSFTQQRNLDFGAAGVGRMRSVSVNEGLLLLSG |
| Ga0209761_12495041 | 3300026313 | Grasslands Soil | LVRLEVLRQVTNALAQKRDLDFWAACVRAMSTVLVNEGLLLLSG |
| Ga0209804_11048612 | 3300026335 | Soil | MIFLVRFEVVRQLTYTFAQQSNLDFRAAGIGGMRSVLIND |
| Ga0209157_10692662 | 3300026537 | Soil | EVLRQVTNALAQKRDLDFWAACVRAMSTVLVNEGLLLLSG |
| Ga0207820_1135201 | 3300026809 | Tropical Forest Soil | AVVFLVRFEVLRQLANPFAEQSDLDFWAAGIARMRSVLVDEGFFVLSG |
| Ga0207803_10209021 | 3300027000 | Tropical Forest Soil | VFLVRFEVLRQLANPFAEQSDLDFWAAGIARMRSVLVDEGFFVLSG |
| Ga0209003_10791493 | 3300027576 | Forest Soil | EVLRQLANAFAEQRDLDFRAAGIAGMRAVLVDEGFLVLSG |
| Ga0209117_10343451 | 3300027645 | Forest Soil | FLVRLEVLRQLANPFAEQRDLDFRAAGIAGMRPVLVDEGFLVLSG |
| Ga0268264_108303332 | 3300028381 | Switchgrass Rhizosphere | LRQLANSFTQQRNLDFGAAGVGRMRSVSVNEGLLLLSG |
| Ga0247271_1021378 | 3300029903 | Soil | TPAYHHKKTATRSVILLVRTEVLGQLADALAEKGNLNFRAAGIARMRAVLVDEGFLVLSG |
| Ga0311360_115387481 | 3300030339 | Bog | VVFLVRFKMLRQLTNPFTQQRDLYFGTPRVGGMGTVLVNEGFFLLSG |
| Ga0311356_108945842 | 3300030617 | Palsa | AVVFLVRLEVLRQLPNTLAEQCNLNFGAPGVTGMRAVLVDEGFFVLSG |
| Ga0170834_1124778432 | 3300031057 | Forest Soil | MIFQVRFEVVRQLTNAFAQQSDLDFWTARIGGVRSVLVNNGFLLLSG |
| Ga0170824_1037098592 | 3300031231 | Forest Soil | RQLANPFAKQRDLDFGAARIGGMRAVLVDEGFLLLSG |
| Ga0170824_1196333662 | 3300031231 | Forest Soil | MIFQVRFEVVRQLTNAFAQQSDLDFWTARIGGVSSVLINEGFLLLSG |
| Ga0310915_105282102 | 3300031573 | Soil | LVCLEVLRQLANAFAQQSDLDFWTARFGGIRSVLINDRSLLLSG |
| Ga0306921_124095491 | 3300031912 | Soil | LLVCLEVLRQLANAFAQQSDLDFWTARIGGMRSVLINDRSLLLSG |
| Ga0318533_112750382 | 3300032059 | Soil | VLLVCLEVLRQLANAFAQQSDLDFWTARIGGMRSVLINDRSLLLSG |
| Ga0306920_1000720101 | 3300032261 | Soil | KTAARAMIFQVRFEVLRQLTNAFAQQSDLDFWTARIGGMRSVLINDRSLLLSG |
| Ga0370497_0202137_346_489 | 3300034965 | Untreated Peat Soil | VVFLVRFEVLRQLANAFAQQRDLDFRATGVGSVRTVLVNEGLLLLSG |
| ⦗Top⦘ |