


| Basic Information | |
|---|---|
| Family ID | F067953 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MARRNFPDVTFEVVQHDSGWAIWLVVILGGALGVFALTALIVSFLIQG |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.20 % |
| % of genes near scaffold ends (potentially truncated) | 33.60 % |
| % of genes from short scaffolds (< 2000 bps) | 82.40 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.600 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.16% β-sheet: 0.00% Coil/Unstructured: 61.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00180 | Iso_dh | 13.60 |
| PF04392 | ABC_sub_bind | 11.20 |
| PF13458 | Peripla_BP_6 | 8.00 |
| PF03781 | FGE-sulfatase | 8.00 |
| PF00248 | Aldo_ket_red | 4.00 |
| PF16640 | Big_3_5 | 4.00 |
| PF00296 | Bac_luciferase | 2.40 |
| PF00723 | Glyco_hydro_15 | 2.40 |
| PF03401 | TctC | 1.60 |
| PF08734 | GYD | 1.60 |
| PF04909 | Amidohydro_2 | 1.60 |
| PF13531 | SBP_bac_11 | 0.80 |
| PF04964 | Flp_Fap | 0.80 |
| PF00501 | AMP-binding | 0.80 |
| PF00083 | Sugar_tr | 0.80 |
| PF02371 | Transposase_20 | 0.80 |
| PF09130 | DUF1932 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 11.20 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 8.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.40 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 2.40 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.60 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.60 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.80 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.20 % |
| Unclassified | root | N/A | 40.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459022|GZEQPF102G3HNZ | Not Available | 503 | Open in IMG/M |
| 3300001867|JGI12627J18819_10452580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10326836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300004152|Ga0062386_101038189 | Not Available | 679 | Open in IMG/M |
| 3300004633|Ga0066395_10063951 | Not Available | 1672 | Open in IMG/M |
| 3300004633|Ga0066395_10123403 | Not Available | 1281 | Open in IMG/M |
| 3300004633|Ga0066395_10124243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1277 | Open in IMG/M |
| 3300005179|Ga0066684_10165026 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300005332|Ga0066388_102194348 | Not Available | 996 | Open in IMG/M |
| 3300005332|Ga0066388_102763596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga vignae | 896 | Open in IMG/M |
| 3300005435|Ga0070714_100822996 | Not Available | 900 | Open in IMG/M |
| 3300005436|Ga0070713_100030597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4277 | Open in IMG/M |
| 3300005436|Ga0070713_100721199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300005439|Ga0070711_100142478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1799 | Open in IMG/M |
| 3300005536|Ga0070697_101202287 | Not Available | 675 | Open in IMG/M |
| 3300005569|Ga0066705_10257719 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300005764|Ga0066903_100024101 | All Organisms → cellular organisms → Bacteria | 6626 | Open in IMG/M |
| 3300005764|Ga0066903_100100798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3900 | Open in IMG/M |
| 3300005764|Ga0066903_101863631 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005764|Ga0066903_102103715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1086 | Open in IMG/M |
| 3300005764|Ga0066903_102208954 | Not Available | 1061 | Open in IMG/M |
| 3300006028|Ga0070717_10407804 | Not Available | 1221 | Open in IMG/M |
| 3300006028|Ga0070717_10540161 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300006041|Ga0075023_100364885 | Not Available | 615 | Open in IMG/M |
| 3300006047|Ga0075024_100311368 | Not Available | 775 | Open in IMG/M |
| 3300006057|Ga0075026_100154151 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300006057|Ga0075026_100158093 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300006057|Ga0075026_100873854 | Not Available | 550 | Open in IMG/M |
| 3300006086|Ga0075019_10143889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 1391 | Open in IMG/M |
| 3300006176|Ga0070765_100131946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2206 | Open in IMG/M |
| 3300006755|Ga0079222_10033146 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300006755|Ga0079222_12241522 | Not Available | 544 | Open in IMG/M |
| 3300006806|Ga0079220_10991001 | Not Available | 665 | Open in IMG/M |
| 3300006806|Ga0079220_11616729 | Not Available | 562 | Open in IMG/M |
| 3300006854|Ga0075425_100490967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1414 | Open in IMG/M |
| 3300006893|Ga0073928_10090021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2603 | Open in IMG/M |
| 3300006893|Ga0073928_10095760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2502 | Open in IMG/M |
| 3300006903|Ga0075426_11404414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 530 | Open in IMG/M |
| 3300006954|Ga0079219_10028821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2167 | Open in IMG/M |
| 3300006954|Ga0079219_10924971 | Not Available | 709 | Open in IMG/M |
| 3300009792|Ga0126374_10159143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1380 | Open in IMG/M |
| 3300010046|Ga0126384_10148500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1802 | Open in IMG/M |
| 3300010048|Ga0126373_10021383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5475 | Open in IMG/M |
| 3300010048|Ga0126373_10030997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4624 | Open in IMG/M |
| 3300010048|Ga0126373_11697029 | Not Available | 696 | Open in IMG/M |
| 3300010360|Ga0126372_10003713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7099 | Open in IMG/M |
| 3300010360|Ga0126372_12510707 | Not Available | 566 | Open in IMG/M |
| 3300010361|Ga0126378_11439763 | Not Available | 781 | Open in IMG/M |
| 3300010361|Ga0126378_11596368 | Not Available | 740 | Open in IMG/M |
| 3300010361|Ga0126378_11762040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300010361|Ga0126378_12236116 | Not Available | 624 | Open in IMG/M |
| 3300010361|Ga0126378_12730068 | Not Available | 564 | Open in IMG/M |
| 3300010366|Ga0126379_11283417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella variicola | 838 | Open in IMG/M |
| 3300010396|Ga0134126_12776828 | Not Available | 531 | Open in IMG/M |
| 3300010868|Ga0124844_1044815 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300010868|Ga0124844_1264776 | Not Available | 597 | Open in IMG/M |
| 3300012019|Ga0120139_1089261 | Not Available | 766 | Open in IMG/M |
| 3300012198|Ga0137364_10078794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
| 3300012199|Ga0137383_10492990 | Not Available | 897 | Open in IMG/M |
| 3300012202|Ga0137363_11362713 | Not Available | 599 | Open in IMG/M |
| 3300012349|Ga0137387_10831436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300012359|Ga0137385_10897715 | Not Available | 733 | Open in IMG/M |
| 3300012948|Ga0126375_10779905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 754 | Open in IMG/M |
| 3300012971|Ga0126369_10662838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300016294|Ga0182041_10817613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
| 3300016319|Ga0182033_11320706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus acidophilus | 648 | Open in IMG/M |
| 3300016319|Ga0182033_12007455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300016371|Ga0182034_11021241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300016387|Ga0182040_11941987 | Not Available | 505 | Open in IMG/M |
| 3300017936|Ga0187821_10280906 | Not Available | 657 | Open in IMG/M |
| 3300017959|Ga0187779_10062377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2190 | Open in IMG/M |
| 3300017973|Ga0187780_10423681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 946 | Open in IMG/M |
| 3300018058|Ga0187766_11308536 | Not Available | 528 | Open in IMG/M |
| 3300018433|Ga0066667_10482645 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300018482|Ga0066669_10074881 | Not Available | 2254 | Open in IMG/M |
| 3300018482|Ga0066669_10177768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300019888|Ga0193751_1010977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4755 | Open in IMG/M |
| 3300020150|Ga0187768_1098118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300020579|Ga0210407_11306732 | Not Available | 541 | Open in IMG/M |
| 3300020580|Ga0210403_10262784 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300020581|Ga0210399_10546243 | Not Available | 961 | Open in IMG/M |
| 3300021168|Ga0210406_10049856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3671 | Open in IMG/M |
| 3300021560|Ga0126371_10034280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4777 | Open in IMG/M |
| 3300021560|Ga0126371_10677866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1179 | Open in IMG/M |
| 3300021560|Ga0126371_11060601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
| 3300021560|Ga0126371_11728494 | Not Available | 749 | Open in IMG/M |
| 3300025906|Ga0207699_10759392 | Not Available | 712 | Open in IMG/M |
| 3300027070|Ga0208365_1038357 | Not Available | 637 | Open in IMG/M |
| 3300027680|Ga0207826_1137647 | Not Available | 668 | Open in IMG/M |
| 3300027703|Ga0207862_1005184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3822 | Open in IMG/M |
| 3300027898|Ga0209067_10046984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2199 | Open in IMG/M |
| 3300027910|Ga0209583_10072880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300027915|Ga0209069_10275985 | Not Available | 883 | Open in IMG/M |
| 3300029636|Ga0222749_10623221 | Not Available | 590 | Open in IMG/M |
| 3300031057|Ga0170834_105781029 | Not Available | 616 | Open in IMG/M |
| 3300031057|Ga0170834_107917096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1708 | Open in IMG/M |
| 3300031057|Ga0170834_108923227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2061 | Open in IMG/M |
| 3300031122|Ga0170822_12080828 | Not Available | 529 | Open in IMG/M |
| 3300031231|Ga0170824_107403012 | Not Available | 733 | Open in IMG/M |
| 3300031231|Ga0170824_122289042 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031446|Ga0170820_11440550 | Not Available | 640 | Open in IMG/M |
| 3300031544|Ga0318534_10570635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300031545|Ga0318541_10133156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1356 | Open in IMG/M |
| 3300031572|Ga0318515_10202173 | Not Available | 1065 | Open in IMG/M |
| 3300031708|Ga0310686_101747470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300031724|Ga0318500_10213303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 928 | Open in IMG/M |
| 3300031736|Ga0318501_10054758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1879 | Open in IMG/M |
| 3300031744|Ga0306918_10208233 | Not Available | 1477 | Open in IMG/M |
| 3300031753|Ga0307477_10006411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 8293 | Open in IMG/M |
| 3300031770|Ga0318521_10102356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1578 | Open in IMG/M |
| 3300031777|Ga0318543_10195222 | Not Available | 898 | Open in IMG/M |
| 3300031793|Ga0318548_10456314 | Not Available | 626 | Open in IMG/M |
| 3300031798|Ga0318523_10594996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga vignae | 545 | Open in IMG/M |
| 3300031833|Ga0310917_10677979 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031845|Ga0318511_10288081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300031879|Ga0306919_10371535 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300031879|Ga0306919_11299576 | Not Available | 551 | Open in IMG/M |
| 3300031890|Ga0306925_10368539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1542 | Open in IMG/M |
| 3300031910|Ga0306923_10386159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1594 | Open in IMG/M |
| 3300032043|Ga0318556_10641961 | Not Available | 553 | Open in IMG/M |
| 3300032051|Ga0318532_10338571 | Not Available | 534 | Open in IMG/M |
| 3300032065|Ga0318513_10041663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2028 | Open in IMG/M |
| 3300033289|Ga0310914_10172998 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300033290|Ga0318519_10159236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1267 | Open in IMG/M |
| 3300033412|Ga0310810_10763478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.80% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA2_00486680 | 2170459022 | Grass Soil | MARHNFPDPTFEVVQHDRSWAIWLVVILGGVVGVFAFTALIVSLIHG |
| JGI12627J18819_104525801 | 3300001867 | Forest Soil | MARQNFPDLDFEVVQRDHGGAVWLVAILGGALGVFALTALIVSLLI* |
| JGIcombinedJ51221_103268362 | 3300003505 | Forest Soil | MARQNFPDLDFEVVQRDHGGAIWLVAILGGALGVFALTALIVSLLI* |
| Ga0062386_1010381891 | 3300004152 | Bog Forest Soil | MARRNFPDVTFEVVQHDSGWAIWLVVILGGALGVFALTALIVSFLIQG* |
| Ga0066395_100639512 | 3300004633 | Tropical Forest Soil | MARRNFPDLTFQVVQRDRRWAIWLAVIIGALGVFALTALIVSFLIGG* |
| Ga0066395_101234032 | 3300004633 | Tropical Forest Soil | MTRRNFPEVTREVVQHGSGWAVWLAMLLGGALGVFALTALIASFLIQG* |
| Ga0066395_101242432 | 3300004633 | Tropical Forest Soil | MARQNFPDLANVTFQVVQHESRWGIWLVMILGGVLSVFALTALIVSLLIGG* |
| Ga0066684_101650261 | 3300005179 | Soil | MVRRNLPDLTFEVVQQGQDWAIWLVVILAGLAGVFALTALIGRTLIHG* |
| Ga0066388_1021943481 | 3300005332 | Tropical Forest Soil | MARQNFPDLADLTFEVVQHDRSWAIWLLTIVGGLLAVFILTALVGSL |
| Ga0066388_1027635962 | 3300005332 | Tropical Forest Soil | MTRRNFPEVTPEVVQHGSGWAVWLAMLLGGALGVFALTALIASFLIQG* |
| Ga0070714_1008229962 | 3300005435 | Agricultural Soil | MARQNFPDLVDLKFEVVQHDTGWALWLVTILAGVVGVFALTALLVGLGIHG* |
| Ga0070713_1000305976 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MARQNFPDLADLKFEVVQHDTGWALWLVTILAGVVGVFALTALLVGLGIHG* |
| Ga0070713_1007211991 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PMARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFVLTALIVSLIHG* |
| Ga0070711_1001424782 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRNFPDVTFQVVQRDRIWPIWLMVILGGALGVFALTALIVSILIQG* |
| Ga0070697_1012022872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NLNRFERDPMARRNFPDVTPQVVQRDRVWPIWLVAILGGALVVFALTALIVTLLIQG* |
| Ga0066705_102577193 | 3300005569 | Soil | MVRRNLPDLTFEVIQQGQDWAIWLVVILAGLAGVFALTALIGRTLIHG* |
| Ga0066903_1000241013 | 3300005764 | Tropical Forest Soil | MARRNFPDVTPEVVQRDSGWAIWLVVILGGALGVFALTALIVSFLI* |
| Ga0066903_1001007984 | 3300005764 | Tropical Forest Soil | MARRNFPDVTPEVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG* |
| Ga0066903_1018636312 | 3300005764 | Tropical Forest Soil | MARQNFPDLANVTFEVVQHESRWALWLMAIFGGVLGVFALTALIVSLLIGG* |
| Ga0066903_1021037152 | 3300005764 | Tropical Forest Soil | MARQNFPDLANVTFEVVQRDSRWPLWLVMILGGILGVFAITALIVSLLISA* |
| Ga0066903_1022089542 | 3300005764 | Tropical Forest Soil | MARQNFPDLADLTFEVVQHDRSWAIWLLTIVGGLLAVFILTALVGSLVIHG* |
| Ga0070717_104078042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFVLTALIVSLIHG* |
| Ga0070717_105401612 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MARQNFPDLDFEVVQRGHGGAIWLVAILGGALGVFALTALIVSLLI* |
| Ga0075023_1003648852 | 3300006041 | Watersheds | NPQSFEGCPMARQNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLVHG* |
| Ga0075024_1003113682 | 3300006047 | Watersheds | MARQNFPDLTFEVVQHDRSWAIWLVVILGGVAGVFALTALIVSLFHS* |
| Ga0075026_1001541512 | 3300006057 | Watersheds | MVRRNFPDVTFQVVQRDRIWPIWLVVILGGALGVFALTALIVSVLIHG* |
| Ga0075026_1001580932 | 3300006057 | Watersheds | MARRNFPDLTVEVVQHGHGGAIWLVAILGGVLGVFALTALIVSLLG* |
| Ga0075026_1008738542 | 3300006057 | Watersheds | MARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTA |
| Ga0075019_101438891 | 3300006086 | Watersheds | MARRNFPDVTFEVVRHDSGWAIWLVVILGGALGVFALTALIVSFLIQG* |
| Ga0070765_1001319461 | 3300006176 | Soil | MARRNFPDLTFEVVRHDRGRAIWLVVIPGGVLGVFALTVLIVSLLIHG* |
| Ga0079222_100331463 | 3300006755 | Agricultural Soil | MVRRNLPDLTFEVVQQGHDWAIWLIVILAGVAGVFGLTALIGRTLIHG* |
| Ga0079222_122415222 | 3300006755 | Agricultural Soil | QNFPDLVDLKFEVVQHDTGWALWLVTILAGVVGVFALTALLVGLGIHG* |
| Ga0079220_109910013 | 3300006806 | Agricultural Soil | MARQNFPDLADLRFEVVQHDSNWAVWLVTILVGIIAVFALTALVGNLLI |
| Ga0079220_116167291 | 3300006806 | Agricultural Soil | DLADLTFEVVQHDRSWAIWLLTIVGGLLAVFILTALVGSLVIHG* |
| Ga0075425_1004909672 | 3300006854 | Populus Rhizosphere | MARQNFPDLVDLKFEVVQHDTGWALWLVTILAGVVGVFAVTALLVGLGIHG* |
| Ga0073928_100900212 | 3300006893 | Iron-Sulfur Acid Spring | MARRNFPDLTFEVVRHDRSRAIWLVVILGGVLGVFALTVLIVSLLIHG* |
| Ga0073928_100957602 | 3300006893 | Iron-Sulfur Acid Spring | MARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLIHG* |
| Ga0075426_114044141 | 3300006903 | Populus Rhizosphere | MARRNFPDVTPQVVQRDRVWPIWLVAILGGALVVFALTALIVTL |
| Ga0079219_100288213 | 3300006954 | Agricultural Soil | MVRRNLPDLTFEVVQQGQDWAIWLIVILAGVAGVFGLTALIGRTLIHG* |
| Ga0079219_109249711 | 3300006954 | Agricultural Soil | MARQNFPDLVDLKFEVVQHDTGWALWLVTILAGVVGVFAVTALLVG |
| Ga0126374_101591432 | 3300009792 | Tropical Forest Soil | MARRNFPDVTVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG* |
| Ga0126384_101485002 | 3300010046 | Tropical Forest Soil | MTRRNFPEVTPEVVQHGSGWAVWLAMLLGGTLGVFALTALIASFLIQG* |
| Ga0126373_100213832 | 3300010048 | Tropical Forest Soil | MARRNFPDLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIVSFLIGG* |
| Ga0126373_100309973 | 3300010048 | Tropical Forest Soil | MARRNLPDLTFEVVRPAANWGIWLAVVLAGALGVFALTALIVSLLIHG* |
| Ga0126373_116970291 | 3300010048 | Tropical Forest Soil | MARQNFPDLANVTFEVVQRDSRWPLWLVMILGGILGVFALTALIVSLLISA* |
| Ga0126372_100037131 | 3300010360 | Tropical Forest Soil | NQPQSFLRGPMARRNFPDVTPEVVQRDSGWAIWLVVILGGALGVFALTALIVSFLI* |
| Ga0126372_125107071 | 3300010360 | Tropical Forest Soil | MARRNFPDVTPEVVQHGSGWAIWLAVILGGALGVFALTALIVSFLIQG* |
| Ga0126378_114397631 | 3300010361 | Tropical Forest Soil | MARRNFPDVTPEVVQHGSGWAVWLAMLLGGALGVFALT |
| Ga0126378_115963682 | 3300010361 | Tropical Forest Soil | MARRNLPDLTFEVVRAAPNWGLWLVVVLAGALGVFALTALIASLLIFG* |
| Ga0126378_117620401 | 3300010361 | Tropical Forest Soil | QPQSFLRGPMARRNFPNVTPEVVQHGSGWAIWLAVILGGALGVFALTALIASFLIQG* |
| Ga0126378_122361161 | 3300010361 | Tropical Forest Soil | MARQNSPDLANVTFQVVQHESRWGIWLVMILGGVLSVFALTALIVS |
| Ga0126378_127300682 | 3300010361 | Tropical Forest Soil | MARQNFPDLANVTFQVVQHESRWGIWLVMILGGVLSVFALTALIVS |
| Ga0126379_112834172 | 3300010366 | Tropical Forest Soil | MARRNFPDVTPEVVEHDSGWAIWLVAILGGVLAVFALTALIVSFLI* |
| Ga0134126_127768281 | 3300010396 | Terrestrial Soil | MSHVTYHIVQHDSGWAVWLITILLGILGVFALTALVVGLLIHG* |
| Ga0124844_10448152 | 3300010868 | Tropical Forest Soil | MARRNFPGLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIVSFLIGG* |
| Ga0124844_12647762 | 3300010868 | Tropical Forest Soil | MARRNFPGLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIVNFLIGG* |
| Ga0120139_10892611 | 3300012019 | Permafrost | MARRNFPDLTFEVVRHDRGGAIWLVVILGGVLGVFALTVLIVSLLIHG* |
| Ga0137364_100787942 | 3300012198 | Vadose Zone Soil | MARQNFPDLTFEVVQHGRSWAIWLVVILGGVVGVFALTALIVSLIHG* |
| Ga0137383_104929901 | 3300012199 | Vadose Zone Soil | MARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLIHS* |
| Ga0137363_113627133 | 3300012202 | Vadose Zone Soil | TFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLIHG* |
| Ga0137387_108314362 | 3300012349 | Vadose Zone Soil | MARRNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFAVTALIV |
| Ga0137385_108977152 | 3300012359 | Vadose Zone Soil | RSEADDESNPQSLEGCPMARRNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLIHS* |
| Ga0126375_107799051 | 3300012948 | Tropical Forest Soil | MARRNFPDVTPEVVEHDSGWAIWLVAILGGTLAVFALTALIVSFLI* |
| Ga0126369_106628382 | 3300012971 | Tropical Forest Soil | MARRNLPDLTFEVVRAAPNWGLWLVVVLAGALGAFALTALIASLLIHG* |
| Ga0182041_108176132 | 3300016294 | Soil | SFLRGPMARRNFPDVTPEVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG |
| Ga0182033_113207061 | 3300016319 | Soil | GPMARRNLPDLTFEVVRPGRNWGIWLVVVLAGVLAVFALTALIVSLLISG |
| Ga0182033_120074551 | 3300016319 | Soil | VTPEVVQHGRGWAIWLAMLLGGALGVFALTALIASFLIQG |
| Ga0182034_110212412 | 3300016371 | Soil | FLRGPMARRNFPEVTPEVVQHGSGWAVWLAMLLGGALGVFALTALIASFLIQG |
| Ga0182040_119419872 | 3300016387 | Soil | MARRNFPEVTPEVVQHGSGWAVWLAMLLGGALGVFALTALIASFLIQG |
| Ga0187821_102809061 | 3300017936 | Freshwater Sediment | MARRNFPDLTVEVVQQDRGWAIWLVVILGGVLGVFALTALIVNLLILG |
| Ga0187779_100623771 | 3300017959 | Tropical Peatland | MARRNFPDVPFEVVQHDTSWAIWLAAILAGAVGVFVLTALIVSFLIQG |
| Ga0187780_104236812 | 3300017973 | Tropical Peatland | EVVEHDAGWGIWLVVILGGAVGVFALTALIVSFLIQS |
| Ga0187766_113085361 | 3300018058 | Tropical Peatland | MARQNLPDLTFEVVQPALNWGIWLVVVLAGTLGVFALTALIASLLIHG |
| Ga0066667_104826453 | 3300018433 | Grasslands Soil | MARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFAFTALIVSLIHG |
| Ga0066669_100748813 | 3300018482 | Grasslands Soil | MVRRNLPDLTFEVVQQGQDWAIWLVLILAGLAGVFALTALIGRTLIHG |
| Ga0066669_101777683 | 3300018482 | Grasslands Soil | MARQNFPDLTFEVVQHDRSWAIWLVAILGGVVGAFALTALIVSLIHG |
| Ga0193751_10109772 | 3300019888 | Soil | MARRNFPDLTFEVVRHDRGRAIWLVVIPGGVLGVFALTVLIVSLLIHG |
| Ga0187768_10981182 | 3300020150 | Tropical Peatland | DVPFEVVQHDTSWAIWLAAILAGAVGVFVLTALIVSFLIQS |
| Ga0210407_113067321 | 3300020579 | Soil | MARQNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLIHG |
| Ga0210403_102627842 | 3300020580 | Soil | MARQNFPDLDFEVVQRDHGGAIWLVAILGGALGVFALTALIVSLLI |
| Ga0210399_105462432 | 3300020581 | Soil | RVEGGPMARQNFPDLDFEVVQRDHGGAIWLVAILGGALGVFALTALIVSLLI |
| Ga0210406_100498563 | 3300021168 | Soil | MVRRNFPDVTPQVVRRDRIWPIWLVVILGGALGVFALTALIVSILIQG |
| Ga0126371_100342804 | 3300021560 | Tropical Forest Soil | MARRNFPDLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIVSFLIGG |
| Ga0126371_106778662 | 3300021560 | Tropical Forest Soil | MARQNFPDLANVTFQVVQHESRWGIWLVMILGGVLSVFALTALIVSLLIGG |
| Ga0126371_110606012 | 3300021560 | Tropical Forest Soil | MARRNLPDLTFEVVRPAANWGIWLAVVLAGALGVFALTALIVSLLIHG |
| Ga0126371_117284941 | 3300021560 | Tropical Forest Soil | MARRNFPDLADLTFEVVQHDSGWAIWLVTIVGGLMAVFALTALVGSLVIHG |
| Ga0207699_107593922 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MARQNFPDLVDLKFEVVQHDTGWALWLVTILAGVVGVFAVTALLVGLGIHG |
| Ga0208365_10383572 | 3300027070 | Forest Soil | MARQNFPDLDFEVVQRDHGGAIWLVAILGGVLGVFALTALIVSLLG |
| Ga0207826_11376471 | 3300027680 | Tropical Forest Soil | MARRNFPDVPFEVVQHDTSWAIWMAAILAGAVGVFVLTALIVSFLIQG |
| Ga0207862_10051843 | 3300027703 | Tropical Forest Soil | MARRNFPDVPFEVVQHDTSWAIWLGAILAGAVGVFALTALIVSFLIQD |
| Ga0209067_100469842 | 3300027898 | Watersheds | MARRNFPDVTFEVVRHDSGWAIWLVVILGGALGVFALTALIVSFLIQG |
| Ga0209583_100728803 | 3300027910 | Watersheds | MARQNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLVHG |
| Ga0209069_102759851 | 3300027915 | Watersheds | MARQNFPDLTFEVVQHDRSWAIWLVVILGGVAGVFALTALIVSLFHS |
| Ga0222749_106232212 | 3300029636 | Soil | MARRNFPDLTFEVVRHDRGRAIWLVVIPGGVLGVFALTALIVSLLIHG |
| Ga0170834_1057810291 | 3300031057 | Forest Soil | MARHNFPDLTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLV |
| Ga0170834_1079170962 | 3300031057 | Forest Soil | MARQNFPEVTFEVVQHDRSWAIWLVVILGGVVGVFALTALIVSLVDG |
| Ga0170834_1089232273 | 3300031057 | Forest Soil | MARQNFPDLDFEVVQRGHGGAIWLVAILGGALGVFALTALIVSLLI |
| Ga0170822_120808281 | 3300031122 | Forest Soil | MARQNFPEVTFEVVQHDRSWAIWLVVILGGVVGVFVLTALIVSLIHG |
| Ga0170824_1074030122 | 3300031231 | Forest Soil | MARRNFPDLTVEVVQHGHGGAIWLVAILGGVLGVFALTALIVSLLG |
| Ga0170824_1222890422 | 3300031231 | Forest Soil | MARQNFPDLTFEVVQHGRSWAIWLVVILGGVVGVFALTALIVSLVHG |
| Ga0170820_114405501 | 3300031446 | Forest Soil | MARRNFPDLTVEVVQHGHGGAIWLVAILGGVLGVFAITALIVSLLG |
| Ga0318534_105706351 | 3300031544 | Soil | PDVIPEVVRHGSGWAIWLVVVLGGALGVFALTALIVSFLIQG |
| Ga0318541_101331562 | 3300031545 | Soil | MARRNFPDVTPEVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG |
| Ga0318515_102021731 | 3300031572 | Soil | MARRNFPDVTPEVVQHGSGWAIWLAVILGGALGVFALTALIVSFLIQG |
| Ga0310686_1017474701 | 3300031708 | Soil | MARQNFPDLDFEVVQRDHGVAIWLAAILGGALGVFALTALIVSLLI |
| Ga0318500_102133032 | 3300031724 | Soil | VTPEVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG |
| Ga0318501_100547582 | 3300031736 | Soil | MARQNFPDVIPEVVRHGSGWAIWLVVVLGGALGVFALTALIVSFLIQG |
| Ga0306918_102082331 | 3300031744 | Soil | MARRNFPGLTFQVVQRDRRWAIWLAVIPIGALGVFALTAL |
| Ga0307477_100064111 | 3300031753 | Hardwood Forest Soil | MVRRNFPDVTFQVVQRDRIWPIWLVVILGGALGVFSLTALIVSVLIQG |
| Ga0318521_101023561 | 3300031770 | Soil | RFEGGPMARQNFPDLANVTFQVVQHESRWGIWLVMILGGVLSVFALTALIVSLLIGG |
| Ga0318543_101952221 | 3300031777 | Soil | MARQNFPDVIPEVVRHGSGWAIWLVVVLGGALGVFALTALIVSF |
| Ga0318548_104563141 | 3300031793 | Soil | MARRNFPDVTPEVVQHGSGWAIWLAVILGGALGVFALTALIV |
| Ga0318523_105949962 | 3300031798 | Soil | MARRNFPDVTPEVVQHGSGWAIWLAVILGGALGVFALTALIVSFLI |
| Ga0310917_106779792 | 3300031833 | Soil | FPDLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIASFLIGG |
| Ga0318511_102880812 | 3300031845 | Soil | PEVVRHGSGWAIWLVVVLGGALGVFALTALIVSFLIQG |
| Ga0306919_103715351 | 3300031879 | Soil | MARRNFPDLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIASFLIGG |
| Ga0306919_112995761 | 3300031879 | Soil | MARRNLPDLTFEVVRPGRNWGIWLVVVLAGVLAVFALTALIVSLLISG |
| Ga0306925_103685393 | 3300031890 | Soil | MARRNLPDLTFEVVRPARNWGIWLVVVLAGVLAVFALTALIVSLLISG |
| Ga0306923_103861592 | 3300031910 | Soil | MARRNFPNVTPDVVQHGSGWAIWLAVILGGALGVFALTALIVSFLIQG |
| Ga0318556_106419611 | 3300032043 | Soil | VFTRSHGEANFPDVTPEVVQHGSGWAIWLAVILGGALGVFALTALIVSFLIQG |
| Ga0318532_103385711 | 3300032051 | Soil | MARRNFPDLTFQVVQRDRRWAIWLAVIPIGALGVF |
| Ga0318513_100416631 | 3300032065 | Soil | LRGPMARRNFPDVTPEVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG |
| Ga0310914_101729981 | 3300033289 | Soil | RNFPDLTFQVVQRDRRWAIWLAVIPIGALGVFALTALIASFLIGG |
| Ga0318519_101592362 | 3300033290 | Soil | PMARRNFPDVTPEVVQHGSGWAIWLAMILGGALGVFALTALIVSFLIQG |
| Ga0310810_107634781 | 3300033412 | Soil | VQHDSGWAVWLITILLGILGVFALTALVVGLLIHG |
| ⦗Top⦘ |