


| Basic Information | |
|---|---|
| Family ID | F067932 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTEQK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.90 % |
| % of genes near scaffold ends (potentially truncated) | 74.40 % |
| % of genes from short scaffolds (< 2000 bps) | 71.20 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01548 | DEDD_Tnp_IS110 | 5.60 |
| PF00665 | rve | 3.20 |
| PF00440 | TetR_N | 2.40 |
| PF13701 | DDE_Tnp_1_4 | 2.40 |
| PF02371 | Transposase_20 | 2.40 |
| PF01527 | HTH_Tnp_1 | 2.40 |
| PF03551 | PadR | 1.60 |
| PF13683 | rve_3 | 1.60 |
| PF07730 | HisKA_3 | 1.60 |
| PF04185 | Phosphoesterase | 1.60 |
| PF07729 | FCD | 0.80 |
| PF00795 | CN_hydrolase | 0.80 |
| PF01145 | Band_7 | 0.80 |
| PF01979 | Amidohydro_1 | 0.80 |
| PF12358 | DUF3644 | 0.80 |
| PF08281 | Sigma70_r4_2 | 0.80 |
| PF04055 | Radical_SAM | 0.80 |
| PF00078 | RVT_1 | 0.80 |
| PF00400 | WD40 | 0.80 |
| PF07228 | SpoIIE | 0.80 |
| PF11412 | DsbC | 0.80 |
| PF03050 | DDE_Tnp_IS66 | 0.80 |
| PF14319 | Zn_Tnp_IS91 | 0.80 |
| PF13624 | SurA_N_3 | 0.80 |
| PF00486 | Trans_reg_C | 0.80 |
| PF13620 | CarboxypepD_reg | 0.80 |
| PF09481 | CRISPR_Cse1 | 0.80 |
| PF05163 | DinB | 0.80 |
| PF03448 | MgtE_N | 0.80 |
| PF00872 | Transposase_mut | 0.80 |
| PF00589 | Phage_integrase | 0.80 |
| PF12543 | DUF3738 | 0.80 |
| PF03965 | Penicillinase_R | 0.80 |
| PF01381 | HTH_3 | 0.80 |
| PF01904 | DUF72 | 0.80 |
| PF13229 | Beta_helix | 0.80 |
| PF07676 | PD40 | 0.80 |
| PF01610 | DDE_Tnp_ISL3 | 0.80 |
| PF12904 | Collagen_bind_2 | 0.80 |
| PF17168 | DUF5127 | 0.80 |
| PF00069 | Pkinase | 0.80 |
| PF02687 | FtsX | 0.80 |
| PF01878 | EVE | 0.80 |
| PF08501 | Shikimate_dh_N | 0.80 |
| PF11949 | DUF3466 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 8.00 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.20 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 3.20 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 3.20 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 3.20 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 3.20 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.40 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.60 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.60 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.60 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.60 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.60 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.60 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.60 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.80 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.80 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.80 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.80 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.80 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.80 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.80 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.80 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.80 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.20 % |
| Unclassified | root | N/A | 36.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005167|Ga0066672_10288731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300005178|Ga0066688_10008337 | All Organisms → cellular organisms → Bacteria | 4950 | Open in IMG/M |
| 3300005447|Ga0066689_10805994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300005764|Ga0066903_101865297 | Not Available | 1150 | Open in IMG/M |
| 3300005764|Ga0066903_105717744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300006162|Ga0075030_101353379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 558 | Open in IMG/M |
| 3300006176|Ga0070765_101210610 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006794|Ga0066658_10003846 | All Organisms → cellular organisms → Bacteria | 5333 | Open in IMG/M |
| 3300006794|Ga0066658_10371070 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300006800|Ga0066660_10626346 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006800|Ga0066660_10730083 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009137|Ga0066709_100078789 | All Organisms → cellular organisms → Bacteria | 3917 | Open in IMG/M |
| 3300009143|Ga0099792_10529868 | Not Available | 742 | Open in IMG/M |
| 3300009518|Ga0116128_1052659 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300011269|Ga0137392_10648046 | Not Available | 876 | Open in IMG/M |
| 3300012202|Ga0137363_11283574 | Not Available | 620 | Open in IMG/M |
| 3300012205|Ga0137362_10309820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1367 | Open in IMG/M |
| 3300012211|Ga0137377_11684234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012351|Ga0137386_11127496 | Not Available | 552 | Open in IMG/M |
| 3300012358|Ga0137368_10891726 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 543 | Open in IMG/M |
| 3300012361|Ga0137360_11653047 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012917|Ga0137395_11271719 | Not Available | 510 | Open in IMG/M |
| 3300012971|Ga0126369_12943925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300014638|Ga0181536_10178194 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300014838|Ga0182030_10916468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 783 | Open in IMG/M |
| 3300015242|Ga0137412_10878163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300016294|Ga0182041_10896695 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300016341|Ga0182035_11527977 | Not Available | 601 | Open in IMG/M |
| 3300016341|Ga0182035_11993239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300016357|Ga0182032_10492336 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300016387|Ga0182040_10659399 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300016387|Ga0182040_10672025 | Not Available | 844 | Open in IMG/M |
| 3300016387|Ga0182040_11007414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300016404|Ga0182037_11335225 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300016422|Ga0182039_12087309 | Not Available | 522 | Open in IMG/M |
| 3300016445|Ga0182038_10304839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300018021|Ga0187882_1082695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300018035|Ga0187875_10262165 | Not Available | 941 | Open in IMG/M |
| 3300018046|Ga0187851_10429726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 754 | Open in IMG/M |
| 3300018046|Ga0187851_10504674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 687 | Open in IMG/M |
| 3300019275|Ga0187798_1320424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300021560|Ga0126371_10589345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1261 | Open in IMG/M |
| 3300024227|Ga0228598_1057675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300025604|Ga0207930_1139128 | Not Available | 528 | Open in IMG/M |
| 3300026309|Ga0209055_1070483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1459 | Open in IMG/M |
| 3300026309|Ga0209055_1076465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1388 | Open in IMG/M |
| 3300026325|Ga0209152_10004200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5337 | Open in IMG/M |
| 3300026325|Ga0209152_10156140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300026529|Ga0209806_1006207 | All Organisms → cellular organisms → Bacteria | 6725 | Open in IMG/M |
| 3300026529|Ga0209806_1044052 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300027064|Ga0208724_1034033 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300027565|Ga0209219_1165214 | Not Available | 528 | Open in IMG/M |
| 3300027603|Ga0209331_1099743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300027703|Ga0207862_1142462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300028795|Ga0302227_10384224 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028798|Ga0302222_10136791 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300029917|Ga0311326_10247127 | Not Available | 920 | Open in IMG/M |
| 3300029954|Ga0311331_10025705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8929 | Open in IMG/M |
| 3300030007|Ga0311338_11985279 | Not Available | 517 | Open in IMG/M |
| 3300030618|Ga0311354_10776052 | Not Available | 907 | Open in IMG/M |
| 3300031170|Ga0307498_10346331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031258|Ga0302318_10666376 | Not Available | 524 | Open in IMG/M |
| 3300031525|Ga0302326_13096970 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031544|Ga0318534_10080284 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300031549|Ga0318571_10231971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300031564|Ga0318573_10591449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300031573|Ga0310915_10055190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2578 | Open in IMG/M |
| 3300031670|Ga0307374_10001053 | All Organisms → cellular organisms → Bacteria | 51784 | Open in IMG/M |
| 3300031708|Ga0310686_103761709 | Not Available | 551 | Open in IMG/M |
| 3300031719|Ga0306917_11261690 | Not Available | 572 | Open in IMG/M |
| 3300031724|Ga0318500_10044158 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300031747|Ga0318502_10264361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300031748|Ga0318492_10202374 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1016 | Open in IMG/M |
| 3300031754|Ga0307475_10137465 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300031772|Ga0315288_11309882 | Not Available | 614 | Open in IMG/M |
| 3300031781|Ga0318547_10428262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 814 | Open in IMG/M |
| 3300031795|Ga0318557_10345312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300031795|Ga0318557_10495308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031833|Ga0310917_10160487 | Not Available | 1488 | Open in IMG/M |
| 3300031859|Ga0318527_10352671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031879|Ga0306919_10038596 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
| 3300031879|Ga0306919_10866654 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300031879|Ga0306919_11157929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300031880|Ga0318544_10233495 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031890|Ga0306925_10054519 | All Organisms → cellular organisms → Bacteria | 4173 | Open in IMG/M |
| 3300031890|Ga0306925_10221531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 2040 | Open in IMG/M |
| 3300031890|Ga0306925_11923063 | Not Available | 561 | Open in IMG/M |
| 3300031945|Ga0310913_10223425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300031946|Ga0310910_10406110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300031947|Ga0310909_11462551 | Not Available | 545 | Open in IMG/M |
| 3300032001|Ga0306922_10242500 | Not Available | 1936 | Open in IMG/M |
| 3300032042|Ga0318545_10105442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300032059|Ga0318533_10382120 | Not Available | 1027 | Open in IMG/M |
| 3300032064|Ga0318510_10163055 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300032069|Ga0315282_10097182 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300032261|Ga0306920_102052080 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300033289|Ga0310914_10034997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4040 | Open in IMG/M |
| 3300033289|Ga0310914_10054233 | All Organisms → cellular organisms → Bacteria | 3317 | Open in IMG/M |
| 3300033289|Ga0310914_10189298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1833 | Open in IMG/M |
| 3300033977|Ga0314861_0025377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3630 | Open in IMG/M |
| 3300033977|Ga0314861_0095758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1526 | Open in IMG/M |
| 3300033977|Ga0314861_0103468 | Not Available | 1450 | Open in IMG/M |
| 3300033977|Ga0314861_0152872 | Not Available | 1126 | Open in IMG/M |
| 3300033977|Ga0314861_0188809 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300034419|Ga0373914_0204641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → unclassified Acidithiobacillales → Acidithiobacillales bacterium SM23_46 | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 4.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.40% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034419 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1012030101 | 3300000559 | Soil | RHLLEMYRRQLGDEHSRHKLRRLDKRLLYVAMELDRLTTTEK* |
| Ga0066672_102887312 | 3300005167 | Soil | MYRRQLGNEKTRRRLQRLDKRLLTVASQLQKIEAEENEERLAS* |
| Ga0066688_100083376 | 3300005178 | Soil | RHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTDQN* |
| Ga0066689_108059942 | 3300005447 | Soil | RHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTEQK* |
| Ga0066903_1018652971 | 3300005764 | Tropical Forest Soil | MYRRSLLDDEKTRRKLQRLDGRLLAVADQLKHLARTEK* |
| Ga0066903_1057177441 | 3300005764 | Tropical Forest Soil | HLLEMYRRGLGNEQTKRKLQRLDRRLLAVASQLEQIDITEK* |
| Ga0075030_1013533791 | 3300006162 | Watersheds | HLLEMYRRGLGNEQAKLKLQRLNRRLLAIASQLE* |
| Ga0070765_1012106101 | 3300006176 | Soil | MYRRQLTDEETRRTLRRLDRRLLAVDSRLDRLATAEE* |
| Ga0066658_100038461 | 3300006794 | Soil | TRHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTDQN* |
| Ga0066658_103710701 | 3300006794 | Soil | TRHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTEQK* |
| Ga0066660_106263461 | 3300006800 | Soil | TRHLLEMYRRQLGDEKTRRKLQRLDKRLLTVGSQLQRIYTEKAGETLAS* |
| Ga0066660_107300831 | 3300006800 | Soil | TRHLLEMYRRQLGDEKTRRKLQRLDKRLLTVGSQLQRIYTAKAEETLAS* |
| Ga0066709_1000787891 | 3300009137 | Grasslands Soil | RHLLEMYRRRLDDSKIQRKLQRLDKRLLAVALQLDRIATAEK* |
| Ga0099792_105298682 | 3300009143 | Vadose Zone Soil | MYRRQLSDEKTRRKLQRLDRRLLDVASQVEQIATTEK* |
| Ga0116128_10526594 | 3300009518 | Peatland | RHLLEMYRRQLGDTKAKRKLRRLDRRLLAVDSQLGRIAIPKK* |
| Ga0137392_106480462 | 3300011269 | Vadose Zone Soil | MYRRQLSDEKTRRTLQRLDKRLLAVDSQLDQIATAEK* |
| Ga0137363_112835741 | 3300012202 | Vadose Zone Soil | YRRQLGDEKIRRRLRRLDKRLLTVASQRQRIQKEQK* |
| Ga0137362_103098201 | 3300012205 | Vadose Zone Soil | LTDEKIRRKLQRLDKRLLTVASELQRIHTEKTEETLAS* |
| Ga0137377_116842341 | 3300012211 | Vadose Zone Soil | MHRRQLSDAKTKRKLRRLDRRLLAVASQLDRIATLEK |
| Ga0137386_111274961 | 3300012351 | Vadose Zone Soil | ATRHVLEMYRRQLTDEKTRRTLQRLDKRLLAVGSQLDQIDKAEK* |
| Ga0137368_108917261 | 3300012358 | Vadose Zone Soil | RQRDDEKTRRKLQRLDKRLLAVASQLEQLARAEK* |
| Ga0137360_116530471 | 3300012361 | Vadose Zone Soil | ALEATRHLLEMYRRQLGDEKIRRRLRRLDKRLLTVASQLQRIQTEQK* |
| Ga0137395_112717191 | 3300012917 | Vadose Zone Soil | MYRRQLSDEKTRRTLQRLDKRLLAANSQLDQIDKAEK* |
| Ga0126369_129439252 | 3300012971 | Tropical Forest Soil | ALGATRHLLEMYRRQLSDERIRRKLQRLDKRLFTVASQLQKIEAEEK* |
| Ga0182016_1000348017 | 3300014493 | Bog | TRHLLEMYRRQLTDEKPRRTLQRLDRRLLDIDARLDRLAPAEK* |
| Ga0181536_101781942 | 3300014638 | Bog | MRHPRHLLEMYRRQLGDEKTQRKLQRLDRRLLAVASQLDRIATVE |
| Ga0182030_109164681 | 3300014838 | Bog | HLLEMYRRQSGEEKERRRLQRLDQRLVAFVSQLKKITTAEK* |
| Ga0137412_108781632 | 3300015242 | Vadose Zone Soil | MHRRQLSDEKTKRKLRRLDRRLLAVASELDRIATLEE* |
| Ga0182041_108966951 | 3300016294 | Soil | VAKELPSADLPGIYQALQATRHLLEMYRRQLGNEKTHRRLLPLGKPLFTVASQLQRIQTEQK |
| Ga0182035_115279771 | 3300016341 | Soil | IRQALEATRHLLEMYRRQLSDEKTRRKLQRLDKRLLGVVSQLQGIHTEEK |
| Ga0182035_119932391 | 3300016341 | Soil | LLEMYRRQLSDERIRRKLQRLDKRLFTIASQLQRIETEEK |
| Ga0182032_104923362 | 3300016357 | Soil | QALKATRHLLEMYRRQQSNEKRQRRLQRLDKRHLNVALELQTMKTEGK |
| Ga0182040_106593991 | 3300016387 | Soil | QALAATRHLLEMYRRQLGDTHAQRKLRRLDRRLLAVASHLERIA |
| Ga0182040_106720251 | 3300016387 | Soil | RGYRRQLGDTHAQRKLRRLDRRLLAVASQLGRITTPEK |
| Ga0182040_110074142 | 3300016387 | Soil | GLPTIFQALEATRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLHRIHTEQK |
| Ga0182037_102000302 | 3300016404 | Soil | LAATRHLLEMYRRGLPDEKTRRRLQRLDRRLLDITVQLDRITTAEK |
| Ga0182037_113352251 | 3300016404 | Soil | LEMFRRQLSDEKTRRKLQRLDKRLLSVDSQLQGIHTEDK |
| Ga0182039_119976391 | 3300016422 | Soil | AAARYLVGMYCRQVNDKKARRTLQRLERRLLAVASELDRIG |
| Ga0182039_120873091 | 3300016422 | Soil | LAATRHLLEIYRRQLGDTQAQRKLRRLDRRLLAVASQLERIA |
| Ga0182038_103048391 | 3300016445 | Soil | ATRHLLEMYRRQLSDERIRRKLQRLDKLLFTVASQLQRIEAEEK |
| Ga0182038_113706941 | 3300016445 | Soil | RGLPDEKTRRRLQRLDRRLLDVAVQLDRTTTTAAEK |
| Ga0182038_121327732 | 3300016445 | Soil | YRRGLPDPKTQRRLQRLDRRLLDIAVQLDRITTAEK |
| Ga0187882_10826953 | 3300018021 | Peatland | YRRQLRDEKAKRKLQRLDRRLLAIASHLQPSATAEK |
| Ga0187863_108431762 | 3300018034 | Peatland | MYRRGIADQKTRERLQRLDRRLMAVANQLDRITAEK |
| Ga0187875_102621652 | 3300018035 | Peatland | IFQGLAATRHLLAMHRRQLGDEETRHKLQRLDKRLLAVFSQLKRIETDQK |
| Ga0187851_104297261 | 3300018046 | Peatland | RHLLEMYRRQLTNEKTRRTLQRLDRRLLDIDSRLDRLAKAEE |
| Ga0187851_105046742 | 3300018046 | Peatland | RHLLEMYRRQLTNEKTRRTLQRLDRRLLDIDSRLDRLAKAEK |
| Ga0187798_13204241 | 3300019275 | Peatland | GMYCRQVNDEKTRRRLQRLDRRLLAVTSQLDGIGEDAK |
| Ga0182031_14109122 | 3300019787 | Bog | MYRRQLTDEKIRRVLQRLDRRLLDVDSRLDRLATAEK |
| Ga0126371_105893453 | 3300021560 | Tropical Forest Soil | ATRHLLEMYRRQLGDEKTSRKLQRLDKRLLAVASQLQKIHTD |
| Ga0228598_10576751 | 3300024227 | Rhizosphere | RHLLEMYRRQLGDENGRRTLRRLDKRLRAVASQLQKIRTEEK |
| Ga0207930_11391281 | 3300025604 | Arctic Peat Soil | HQALEATRHLLEMYRRQVGNEKSKRTLQRLDRRLLAVASQIKQLETGEK |
| Ga0209055_10704832 | 3300026309 | Soil | MYRRQLGNEKTRRRLQRLDKRLLTVASQLQKIEAEENEERLAS |
| Ga0209055_10764651 | 3300026309 | Soil | MYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTEQK |
| Ga0209152_100042001 | 3300026325 | Soil | ATRHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTDQN |
| Ga0209152_101561403 | 3300026325 | Soil | ATRHLLEMYRRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTEQK |
| Ga0209806_10062071 | 3300026529 | Soil | RRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTDQN |
| Ga0209806_10440521 | 3300026529 | Soil | RRQLGDEKTRRNLQRLDKRLLGVASQLQRIQTEQK |
| Ga0208724_10340331 | 3300027064 | Forest Soil | ESTRHLLEMYRRQLGDENGRRTLRRLDKRLRAVASQLQKIRTEEK |
| Ga0209219_11652141 | 3300027565 | Forest Soil | LRATRHLLDMYRRQLSDEKTRRKLQRLDRRLLDVASQVQQIATAEK |
| Ga0209331_10997431 | 3300027603 | Forest Soil | RHLLEMYRRQLDDEKTRRKLHRLDKRLLAIAAQLQRIQTEEK |
| Ga0207862_11424621 | 3300027703 | Tropical Forest Soil | TILQALEATRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLQRIHTEEK |
| Ga0302227_103842241 | 3300028795 | Palsa | AATRHLLEMYRRQLSHARIQRSLRRLDKRLLAVASQLDRLNIAEK |
| Ga0302222_101367912 | 3300028798 | Palsa | HLIEMYRRQLGDLRIQRTLRRLDKRLLAVALQLDRIRVAEK |
| Ga0302157_104631502 | 3300028813 | Bog | EMYRRQLTDEKPRRTLQRLDRRLLDIDARLDRLAPAEK |
| Ga0311361_101247084 | 3300029911 | Bog | MYRRQLTDEKPRRTLQRLDRRLLDIDARLDRLAPAEK |
| Ga0311326_102471271 | 3300029917 | Bog | TRHLLEMYRRQLTDEKPRRTLQRLDRRLLDIDARLDRLAPAEK |
| Ga0311331_100257059 | 3300029954 | Bog | RHLLEMYRRQLTDEKPRRTLQRLDRRLLDIDARLDRLAPAEK |
| Ga0311338_119852792 | 3300030007 | Palsa | AAARHLLEMYRRQLTDVKIQRTLQRLDKRLLAVTSELDRIE |
| Ga0311354_107760522 | 3300030618 | Palsa | IEMYRRQLGDLRIQRTLRRLDKRLLAVALQLDRIRVAEK |
| Ga0307498_103463311 | 3300031170 | Soil | TRHLLEMYRRQLGDENGRRTLRRLDKRLRAVASQLQKIRTEEK |
| Ga0302318_106663762 | 3300031258 | Bog | ATRHLLEMYRRRLTDEKIRRTLQRLNRRLLDIDSRLDRLAKAEK |
| Ga0302326_130969703 | 3300031525 | Palsa | HLLEMYRRQLTDVRLQRTIQRLDKRLLAVASQLDRLQ |
| Ga0318534_100802843 | 3300031544 | Soil | PGIRQALGATRHLLEMYRRQLSDERIRRKLQRLDKRLFTIASQLQRIEAEEK |
| Ga0318571_102319711 | 3300031549 | Soil | LGATRHLLEMYRRQLSDERIRRKLQRLDKRLFTIASQLQRIEAEEK |
| Ga0318528_102842491 | 3300031561 | Soil | RHLLEMYRRGRADEKTRRRLQRLDRRLLDITVQLDRITTAEK |
| Ga0318573_105914492 | 3300031564 | Soil | TRHLLEMYRRQLSDERIRRKLQRLDKRLFTIASQLQRIEAEEK |
| Ga0310915_100551901 | 3300031573 | Soil | LPTIFQALEATRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLHRIHTEQK |
| Ga0307374_1000105312 | 3300031670 | Soil | MYSRQLGDEKAMRKQQRLDRRLLAVASQLEQIATPEK |
| Ga0310686_1037617092 | 3300031708 | Soil | ATRHLLEMYRRQLEDKQSSRKLQRLNIRLQRVAFQLDRFTKPEK |
| Ga0306917_112616901 | 3300031719 | Soil | LGATRHLLEMYRRQLSDERIRRKLQRLDKRLFTIASQLQRIETEEK |
| Ga0318500_100441581 | 3300031724 | Soil | RHLLEMYRRQLGDTQAQRKLRRLDRRLLAVTSQLERIA |
| Ga0318502_102643611 | 3300031747 | Soil | LEMYRRQRGDEKTRRKLQRLDKRLLAVASQLQKIHTD |
| Ga0318492_102023741 | 3300031748 | Soil | LEATRHLLEMYRRQLGDQKIRRKLQRLDKRLLGVASQLQKIDTA |
| Ga0307475_101374653 | 3300031754 | Hardwood Forest Soil | LESTRHLLEMYRRQLGDENGRRTLRRLDKRLRAVASQLQRIHTEEE |
| Ga0318526_101861332 | 3300031769 | Soil | RRALSDEKTRRRLQRLDRRLLDVAVQLDRITTAEK |
| Ga0315288_113098822 | 3300031772 | Sediment | RRQLADRKTSRKLRRLDRRILAVASELDRLAKREE |
| Ga0318547_104282621 | 3300031781 | Soil | LEMYRRQLGNEKTHRRLQRLDKRLLTIASELRRIQTEEK |
| Ga0318557_103453121 | 3300031795 | Soil | LEATRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLQRIHTEEK |
| Ga0318557_104953082 | 3300031795 | Soil | AGLPTIFQALEATRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLHRIHTEEK |
| Ga0310917_101604873 | 3300031833 | Soil | MYRRQLDDQKIRRKLQRLDKRLLGVASQLQKIDTA |
| Ga0310917_108500462 | 3300031833 | Soil | AATRHLLEMYRRGLPDEKTRRRLQRLDRRLLDITVQLGRITTAEK |
| Ga0318527_103526711 | 3300031859 | Soil | QALQVTRHLLEIHRRQLTNEKTRRQLHRLDKRLLAVGSQLKKINTDEK |
| Ga0306919_100385961 | 3300031879 | Soil | TRHLLEMFRRQLSDEKTRRKLQRLDKRLLSVVSQLQGIHTEDK |
| Ga0306919_108666542 | 3300031879 | Soil | RYLLGMYCRQVNDKKARRTLQRLDRRLLAVASELDRIG |
| Ga0306919_111579291 | 3300031879 | Soil | APCLLEMYRRQLSDEKTRRKLQRLDKRLLGVVSQLQGIHTEEK |
| Ga0318544_102334951 | 3300031880 | Soil | LLEMYRRQLGDQKIRRKLQRLDKRLLGVASQLQKIDTA |
| Ga0306925_100545196 | 3300031890 | Soil | QALEATRHLLEMYRRQLREEKTRRRLQRLDKRLLAVASQLEGIDTEEK |
| Ga0306925_102215313 | 3300031890 | Soil | QALEAARHLLEMYRRGLSNEQTKRKLQRLDRRLLAVASQLE |
| Ga0306925_119230632 | 3300031890 | Soil | GATRHLLEMYRRQLSDERIRRKLQRLDKRLFTIASQLQRIETEEK |
| Ga0310913_102234252 | 3300031945 | Soil | MYRRQLGNEKSRRTLQRLDKRLRAVASQLQRIHTEEK |
| Ga0310910_104061102 | 3300031946 | Soil | YRRQLSDEKTRRKLQRLDKRLLGVVSQLQGIHTEEK |
| Ga0310909_114625511 | 3300031947 | Soil | RRQLSDEKTRRKLQRLDKRLLGVVSQLQGIHTEEK |
| Ga0306922_102425003 | 3300032001 | Soil | EATRHLLEMYRRQLSDEKTRRKLQRLDKRLLGVVSQLQGIHTEEK |
| Ga0306922_116459151 | 3300032001 | Soil | TRHLLEMYRRGLSDEKNRRRLQRLDRRLLDVAVQLDRITTAEK |
| Ga0318545_101054421 | 3300032042 | Soil | LPTILQALEATRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLQRIHTEEK |
| Ga0318533_103821203 | 3300032059 | Soil | CQALEATRHLLEMYRRQLDDQKIRRKLQRLDKRLLGVASQLQKIDTA |
| Ga0318533_108522932 | 3300032059 | Soil | ALAAARYLLGMYCRQVNDKKARRTLQRLDRRLLAVASELDRIG |
| Ga0318533_110163082 | 3300032059 | Soil | LLEMYRRGLPDEKTRRRLQRLDRRLPDMTVQLDRITTAEK |
| Ga0318510_101630551 | 3300032064 | Soil | PGIRQALGATRHLLEMFRRQLSDQKTRRKLQRLDKRLLGVVSQLQGIHTEDK |
| Ga0315282_100971821 | 3300032069 | Sediment | HLLEMYRRQLGDEKTKRKLQRLDRRLLAVASQLDRIATDEK |
| Ga0306924_118996981 | 3300032076 | Soil | RHLLEMYRRGLSDEKNRRRLQRLDRRLLDVAVQLDRITTAEK |
| Ga0306920_1020520803 | 3300032261 | Soil | HLLEMYRRQLSDEKTRRKLQRLDKRLLGIVSQLQGIHTEEK |
| Ga0335075_116929132 | 3300032896 | Soil | RSLTATRHLMEMYRRTLADESPRRILQRLDRRLLNVAGQLGRLATPPK |
| Ga0310914_100349971 | 3300033289 | Soil | TRHLLEMYRRQLGNEKSRRTLQRLDKRLRAVASQLQRIHTEEK |
| Ga0310914_100542331 | 3300033289 | Soil | GYRRQLGDTHARRTLRRLDRRLLAVASQLGRIPTPEK |
| Ga0310914_101892981 | 3300033289 | Soil | RHLLEMYRRQLSEEKTRRRLQRLDKRLLAVASQLEGIDTEEK |
| Ga0310810_105310972 | 3300033412 | Soil | RHAPRHPSSRFATRHLLEMYRRQLSDEKTRRILHRLDRRLLAVSSKLEQPTAAEK |
| Ga0334828_030282_2_112 | 3300033822 | Soil | YRRQLTDEKIRRVLQRLDRRLLDVDSRLDRLATAEK |
| Ga0314861_0025377_2236_2346 | 3300033977 | Peatland | MYRRQLGDEKAKRKLQRFDRLLAVAAELGRLSTTEK |
| Ga0314861_0095758_1167_1280 | 3300033977 | Peatland | MYRRQLGDEKAKRKLHRLDRRLLGVAQQLARMATDEK |
| Ga0314861_0103468_1248_1361 | 3300033977 | Peatland | MYRQQLGDDKTRRELQRLDKRLLAVASKLKRINTDEK |
| Ga0314861_0152872_146_286 | 3300033977 | Peatland | VSATRHLLEMYRRQLSDQKAKRTLQRLDRRLLAVASELDRIPIAEK |
| Ga0314861_0188809_845_982 | 3300033977 | Peatland | ALAATRHLLEMYRRQRGDEKTRHRLLRLDKRLLKVLSQLQTLKQS |
| Ga0373914_0204641_365_517 | 3300034419 | Sediment Slurry | IRQAIAATRHLLEMYRRGLPDEKTRRRLQRLDQRLLAVSLQLDHIVTPEK |
| ⦗Top⦘ |