


| Basic Information | |
|---|---|
| Family ID | F067916 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 85.60 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.400 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 96.00 |
| PF13242 | Hydrolase_like | 0.80 |
| PF12806 | Acyl-CoA_dh_C | 0.80 |
| PF00909 | Ammonium_transp | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502000|ACOD_GAKN62C01EC1NQ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 504 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig573154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SB2 | 674 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0849356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 2067 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1059534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300000955|JGI1027J12803_101727954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 909 | Open in IMG/M |
| 3300001686|C688J18823_10020244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4474 | Open in IMG/M |
| 3300001977|JGI24746J21847_1040405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 648 | Open in IMG/M |
| 3300004480|Ga0062592_100864970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 810 | Open in IMG/M |
| 3300004633|Ga0066395_10148601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300004633|Ga0066395_10831438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 556 | Open in IMG/M |
| 3300005164|Ga0066815_10055825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 662 | Open in IMG/M |
| 3300005168|Ga0066809_10081009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 770 | Open in IMG/M |
| 3300005332|Ga0066388_107750261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300005451|Ga0066681_10438612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 802 | Open in IMG/M |
| 3300005471|Ga0070698_101683183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
| 3300005713|Ga0066905_100899770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 774 | Open in IMG/M |
| 3300005713|Ga0066905_101455933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 622 | Open in IMG/M |
| 3300005764|Ga0066903_105649138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 658 | Open in IMG/M |
| 3300006032|Ga0066696_10041010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2545 | Open in IMG/M |
| 3300006038|Ga0075365_10055276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2634 | Open in IMG/M |
| 3300006186|Ga0075369_10618609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300006580|Ga0074049_13054669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300006844|Ga0075428_101951119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 609 | Open in IMG/M |
| 3300006847|Ga0075431_101770545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 574 | Open in IMG/M |
| 3300006852|Ga0075433_11497786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 583 | Open in IMG/M |
| 3300006854|Ga0075425_101226847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 852 | Open in IMG/M |
| 3300006871|Ga0075434_101088224 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300009792|Ga0126374_10592037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300010046|Ga0126384_11682401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300010048|Ga0126373_13261483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010326|Ga0134065_10435000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2 | 534 | Open in IMG/M |
| 3300010359|Ga0126376_12358674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300010360|Ga0126372_11389985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300010360|Ga0126372_12098730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 613 | Open in IMG/M |
| 3300010361|Ga0126378_11445621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300010362|Ga0126377_10928548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300010362|Ga0126377_11423869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 766 | Open in IMG/M |
| 3300010398|Ga0126383_12846447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300010400|Ga0134122_10111609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2179 | Open in IMG/M |
| 3300010863|Ga0124850_1022426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2026 | Open in IMG/M |
| 3300011434|Ga0137464_1171529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300012198|Ga0137364_10033444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3303 | Open in IMG/M |
| 3300012199|Ga0137383_11237837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300012209|Ga0137379_11662601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300012212|Ga0150985_108830401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300012355|Ga0137369_10326887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 1128 | Open in IMG/M |
| 3300012361|Ga0137360_11348274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300012911|Ga0157301_10452925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300012930|Ga0137407_12095820 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012971|Ga0126369_10851162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300012972|Ga0134077_10517454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300015374|Ga0132255_100007303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12619 | Open in IMG/M |
| 3300016270|Ga0182036_11906786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300016294|Ga0182041_11388262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300016319|Ga0182033_11875374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300016341|Ga0182035_11756136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300016357|Ga0182032_10066519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2413 | Open in IMG/M |
| 3300016371|Ga0182034_10525422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 990 | Open in IMG/M |
| 3300016404|Ga0182037_10163546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1691 | Open in IMG/M |
| 3300016422|Ga0182039_10662620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300016422|Ga0182039_11821660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300016445|Ga0182038_10522019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1016 | Open in IMG/M |
| 3300018056|Ga0184623_10421041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300018433|Ga0066667_11582634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300020581|Ga0210399_10419502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1116 | Open in IMG/M |
| 3300021406|Ga0210386_10277329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1434 | Open in IMG/M |
| 3300021420|Ga0210394_10580001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 986 | Open in IMG/M |
| 3300021475|Ga0210392_10062084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2343 | Open in IMG/M |
| 3300021560|Ga0126371_12370507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300025900|Ga0207710_10680785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300026342|Ga0209057_1055245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1837 | Open in IMG/M |
| 3300027866|Ga0209813_10486104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300027874|Ga0209465_10492868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300027908|Ga0209006_10817761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300031170|Ga0307498_10381788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300031198|Ga0307500_10243936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031474|Ga0170818_101116688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300031544|Ga0318534_10415335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300031545|Ga0318541_10268475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 949 | Open in IMG/M |
| 3300031545|Ga0318541_10555316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300031573|Ga0310915_10251124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1244 | Open in IMG/M |
| 3300031680|Ga0318574_10209930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1120 | Open in IMG/M |
| 3300031681|Ga0318572_10971848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300031708|Ga0310686_103165740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11615 | Open in IMG/M |
| 3300031719|Ga0306917_10349970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1148 | Open in IMG/M |
| 3300031719|Ga0306917_10892985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300031719|Ga0306917_11532009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031744|Ga0306918_10000427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18822 | Open in IMG/M |
| 3300031744|Ga0306918_10416744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1047 | Open in IMG/M |
| 3300031747|Ga0318502_10314307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 923 | Open in IMG/M |
| 3300031765|Ga0318554_10620252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300031768|Ga0318509_10748342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031768|Ga0318509_10818983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300031781|Ga0318547_10055764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2142 | Open in IMG/M |
| 3300031792|Ga0318529_10026923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2349 | Open in IMG/M |
| 3300031795|Ga0318557_10546883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031805|Ga0318497_10180982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1161 | Open in IMG/M |
| 3300031819|Ga0318568_10489995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300031846|Ga0318512_10010207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3595 | Open in IMG/M |
| 3300031879|Ga0306919_11294277 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031890|Ga0306925_11485759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300031894|Ga0318522_10238878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300031896|Ga0318551_10843764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031897|Ga0318520_10638391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300031897|Ga0318520_10805084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300031912|Ga0306921_10993627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300031943|Ga0310885_10266322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300031946|Ga0310910_10944275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031954|Ga0306926_11021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 982 | Open in IMG/M |
| 3300031954|Ga0306926_12504551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300031954|Ga0306926_12519724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031962|Ga0307479_10796282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300031981|Ga0318531_10567269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300032035|Ga0310911_10082781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1733 | Open in IMG/M |
| 3300032035|Ga0310911_10845554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300032042|Ga0318545_10356751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300032060|Ga0318505_10012976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3066 | Open in IMG/M |
| 3300032066|Ga0318514_10306357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300032067|Ga0318524_10652781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300032068|Ga0318553_10708267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300032090|Ga0318518_10026015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2633 | Open in IMG/M |
| 3300032174|Ga0307470_10032242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2506 | Open in IMG/M |
| 3300032205|Ga0307472_102319502 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032261|Ga0306920_100909532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1286 | Open in IMG/M |
| 3300033290|Ga0318519_10637045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACODB_21383300 | 2040502000 | Fungus Garden | VLGVPFSWPPFTVLQAGAVLAIAFSAILGLAGAFLPAWRVRRMAPYALIQTEGRAT |
| KansclcFeb2_00806420 | 2124908045 | Soil | PPAAVLQTGAVLAIVFSAVLGLIGAFLPAWRVRRMAPYALIQAEGR |
| ICChiseqgaiiDRAFT_08493561 | 3300000033 | Soil | PLAVLQISAVLAVSFSAVLGLVGAFLPAWRARRMAPYALIQAEGR* |
| AF_2010_repII_A01DRAFT_10595342 | 3300000580 | Forest Soil | AIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR* |
| JGI1027J12803_1017279541 | 3300000955 | Soil | AVLQVGAIVAIAFSALLGLAGALLPAWRVRRMAPYALIQSEAH* |
| C688J18823_100202445 | 3300001686 | Soil | PPLAVLQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR* |
| JGI24746J21847_10404052 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | QISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR* |
| Ga0062592_1008649701 | 3300004480 | Soil | VLQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR* |
| Ga0066395_101486012 | 3300004633 | Tropical Forest Soil | QIGAVLAIVFSAVLGLAGAFLPAWRVRRMAPYALIQAEGR* |
| Ga0066395_108314381 | 3300004633 | Tropical Forest Soil | LGIPFSWPPFAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR* |
| Ga0066815_100558252 | 3300005164 | Soil | LVVLQAAAVLAVVFSAVLGLIGAFLPAWRVRRTAPYALIPAEAQAT* |
| Ga0066809_100810092 | 3300005168 | Soil | ISAILAISFSAILGLAGAFLPAWRARRMAPYALIQAEGR* |
| Ga0066388_1077502611 | 3300005332 | Tropical Forest Soil | LEIGALAALAFSALLGLLGAALPAWRARCMAPYALIRSEAR* |
| Ga0066681_104386122 | 3300005451 | Soil | WPPAAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0070698_1016831832 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVLQVGAIVAIVFSAILGLVGALLPAWRVRRMAPYALIQTEGR* |
| Ga0066905_1008997702 | 3300005713 | Tropical Forest Soil | AVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR* |
| Ga0066905_1014559331 | 3300005713 | Tropical Forest Soil | AIIAVAFSALLGLVGAFLPAWRVRRMAPYELILAEGR* |
| Ga0066903_1056491382 | 3300005764 | Tropical Forest Soil | VALTFSAALGLVGAFIPAWRVRRIAPYALIQAENAVK* |
| Ga0066696_100410101 | 3300006032 | Soil | GAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0075365_100552761 | 3300006038 | Populus Endosphere | FSWPPFTVLQAGAVLAIAFSAILGLAGAFLPAWRVRRMAPYTLIQTEGRPT* |
| Ga0075369_106186092 | 3300006186 | Populus Endosphere | VLQISAILAISFSTILGLVGAFLPAWRARRMAPYALIQAEGR* |
| Ga0074049_130546692 | 3300006580 | Soil | PMIVFSAILGLLGALLPAWRVRRMAPDALIHAEGR* |
| Ga0075428_1019511192 | 3300006844 | Populus Rhizosphere | GFYFALAGVPFSWPPAAVLEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0075431_1017705452 | 3300006847 | Populus Rhizosphere | PLAVLQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR* |
| Ga0075433_114977862 | 3300006852 | Populus Rhizosphere | YFALAGVPFSWPPAAVLEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0075425_1012268471 | 3300006854 | Populus Rhizosphere | VLEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0075434_1010882242 | 3300006871 | Populus Rhizosphere | LAIVFSAVLGLVGALLPAWRVRRMAPYALIQTEGR* |
| Ga0126374_105920371 | 3300009792 | Tropical Forest Soil | FRLLGIPFSWPPPAILETGAVVAVAFSAVLGLVGAFVPAWRVLGMAPYALIQAEVR* |
| Ga0126384_116824012 | 3300010046 | Tropical Forest Soil | LAIVFSAVLGLIGAVLPAWRVRRMAPYALIQAEER* |
| Ga0126373_132614832 | 3300010048 | Tropical Forest Soil | YFGLLGIPFSWPPFAILEAGAVLAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR* |
| Ga0134065_104350001 | 3300010326 | Grasslands Soil | GFYFALLGVPFSWPPAAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0126376_123586741 | 3300010359 | Tropical Forest Soil | IVLQLGSLTAIGLSAGLGLVGAFLPAWRVRRTEPYALVQTEAR* |
| Ga0126372_113899852 | 3300010360 | Tropical Forest Soil | FSWPPFAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR* |
| Ga0126372_120987301 | 3300010360 | Tropical Forest Soil | LLGIPFAWPPLSVLPAIAVLALAFSALLGLVGALLPAWRVRRLAPYELIQAEGR* |
| Ga0126378_114456211 | 3300010361 | Tropical Forest Soil | PFAILEAGAVLAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR* |
| Ga0126377_109285482 | 3300010362 | Tropical Forest Soil | LQLGSVTAIGLSTVLGLAGAFLPAWRVRRTAPYALVQTEAR* |
| Ga0126377_114238691 | 3300010362 | Tropical Forest Soil | PFSWPPAAVIETGAVLAIVCSVALGLLGAFMPAWRVRRMAPYALIQADAR* |
| Ga0126383_128464471 | 3300010398 | Tropical Forest Soil | PAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR* |
| Ga0134122_101116093 | 3300010400 | Terrestrial Soil | EAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0124850_10224261 | 3300010863 | Tropical Forest Soil | QASALLAIVFSAVLGLAGAFLPAWRVRRMAPYALIQAEGR* |
| Ga0137464_11715291 | 3300011434 | Soil | GVPFSWPPFAVLQTAAIVAIAFSTILGLVGAFLPAWRVRRMAPYELIRAEGR* |
| Ga0137364_100334443 | 3300012198 | Vadose Zone Soil | PAAVLEAGALLAIVFSVALGLLGAFLPAWRVRRMEPYALIQAEAR* |
| Ga0137383_112378372 | 3300012199 | Vadose Zone Soil | VLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR* |
| Ga0137379_116626011 | 3300012209 | Vadose Zone Soil | PLAVLQVTVLAALVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR* |
| Ga0150985_1088304012 | 3300012212 | Avena Fatua Rhizosphere | LAISFSAVLGLVGAFLPAWRARRMAPYALIQAEGQ* |
| Ga0137369_103268872 | 3300012355 | Vadose Zone Soil | VPFSWPPAAVLEAGALLAIVFSVTLGLLGAFLPAWRVRRMEPYALIQAEAR* |
| Ga0137360_113482741 | 3300012361 | Vadose Zone Soil | AAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQMEGR* |
| Ga0157301_104529252 | 3300012911 | Soil | SSAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR* |
| Ga0137407_120958202 | 3300012930 | Vadose Zone Soil | LIFARTLGFYFGQLGIPFSWPPLAILEIGGGVAVAASAILGLARASMPAWRVCRKAPYALIQPEAR* |
| Ga0126369_108511621 | 3300012971 | Tropical Forest Soil | GAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR* |
| Ga0134077_105174541 | 3300012972 | Grasslands Soil | AVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR* |
| Ga0132255_10000730315 | 3300015374 | Arabidopsis Rhizosphere | FIVLQAGAVLAIAFSAILGLAGAFLPAWRVRRMAPYPLIQTEGRAT* |
| Ga0182036_119067862 | 3300016270 | Soil | AVLQLSVFMALGFSVILGLVGAFVPAWRVRQLPPHALIQTEAR |
| Ga0182041_113882621 | 3300016294 | Soil | PAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0182033_118753742 | 3300016319 | Soil | GALLVIMFSVLLGVLGAFVPAWRVRRMAPYALIQSEAR |
| Ga0182035_117561362 | 3300016341 | Soil | SWPPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR |
| Ga0182032_100665191 | 3300016357 | Soil | QASALLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0182034_105254222 | 3300016371 | Soil | LGIPFSWPPFAILETGAVVAVTFSATLGLVGAFVPAWRVRGMAPYGLIQAEVR |
| Ga0182037_101635462 | 3300016404 | Soil | GFYFALLGVPFSWPPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR |
| Ga0182039_106626201 | 3300016422 | Soil | SALLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0182039_118216602 | 3300016422 | Soil | FSWPPAAVLQIGAVLAIVFSAVLGLVGAFLQAWRVRRMAPYALIQAEGR |
| Ga0182038_105220191 | 3300016445 | Soil | GLLGIPFSWPPFAILETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR |
| Ga0184623_104210411 | 3300018056 | Groundwater Sediment | QTAAIVAIAFSTILGLVGAFLPAWRVRRMAPYELIQAEGR |
| Ga0066667_115826341 | 3300018433 | Grasslands Soil | WPPGAVPQGAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR |
| Ga0210399_104195021 | 3300020581 | Soil | LALLQESAVVAVVFSAVLGLVGSFLPAWRARGLDPYALIQTQVR |
| Ga0210386_102773292 | 3300021406 | Soil | VAIAFSGILGLVGAFVPAWRVRQLAPHALIQAEVR |
| Ga0210394_105800011 | 3300021420 | Soil | GIPFSWPPPAILEAGSGVAVVLSAILGLLGAFLPAWRVRRMAPHALIQTEAR |
| Ga0210392_100620841 | 3300021475 | Soil | VPFSWPPLPVLQVSALVAIVFSAILGLLGALLPAWRVRRMAPDALIHAEGR |
| Ga0126371_123705071 | 3300021560 | Tropical Forest Soil | LAIVFSALLGLIGAFLPAWRVRRMAPYALIQAEGR |
| Ga0207710_106807852 | 3300025900 | Switchgrass Rhizosphere | WPPLSVLQAGALVALVFSALLGLVGALLPAWRVRRMAPHALIQSEGR |
| Ga0209057_10552453 | 3300026342 | Soil | FALLGVPFSWPPAAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR |
| Ga0209813_104861041 | 3300027866 | Populus Endosphere | LALSFSAVLGLVGAFLPAWRARRMAPYALIQAEGR |
| Ga0209465_104928681 | 3300027874 | Tropical Forest Soil | LLGIPFSWPPLAILETSALVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0209006_108177611 | 3300027908 | Forest Soil | PFSWPPLPVLQVSALVAIVFSAILGLLGALLPAWRVRRMAPDALIHAEGR |
| Ga0307498_103817882 | 3300031170 | Soil | AVLAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR |
| Ga0307500_102439361 | 3300031198 | Soil | LAVLQISAVLAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR |
| Ga0170818_1011166882 | 3300031474 | Forest Soil | VLQVTALVAIAFSGILGVLGALLPAWRVRRMAPDALIHAEGR |
| Ga0318534_104153351 | 3300031544 | Soil | VVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318541_102684751 | 3300031545 | Soil | LQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0318541_105553162 | 3300031545 | Soil | FSWPPFAILETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR |
| Ga0310915_102511241 | 3300031573 | Soil | PAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR |
| Ga0318574_102099301 | 3300031680 | Soil | AILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318572_109718481 | 3300031681 | Soil | ETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR |
| Ga0310686_1031657409 | 3300031708 | Soil | LQASAVVAVLFSGIIGLLGAFVPAWRVRRMAPYALIQSDTLR |
| Ga0306917_103499702 | 3300031719 | Soil | ILETGAVVAVAFSAALGLVGAFVPAWRVRAMAPYALIQAEVH |
| Ga0306917_108929852 | 3300031719 | Soil | ILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0306917_115320092 | 3300031719 | Soil | LGVPFSWPPAAVLQIGAGLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0306918_100004271 | 3300031744 | Soil | GAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0306918_104167441 | 3300031744 | Soil | SWPPFAILETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR |
| Ga0318502_103143072 | 3300031747 | Soil | LETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318554_106202522 | 3300031765 | Soil | AVVAVIFSAALGLVGAFVPAWRVRGMAPYALIQAEVR |
| Ga0318509_107483422 | 3300031768 | Soil | IGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0318509_108189831 | 3300031768 | Soil | PFAILATGATVAVAFSATLGLAGAFVPAWRVRGMAPYALIQAEVR |
| Ga0318547_100557643 | 3300031781 | Soil | VLQIGAVLAIVFSAVLGLVGAFLQAWRVRRMAPYALIQAEGR |
| Ga0318529_100269231 | 3300031792 | Soil | AALALSALLGLLGAALPAWRARRMAPFALIRSEAR |
| Ga0318557_105468831 | 3300031795 | Soil | LLGVPFSWPPAAVLQIGAGLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0318497_101809821 | 3300031805 | Soil | LEIGSLAALALSALLGLLGAALPAWRARRMAPYALIRSEAR |
| Ga0318568_104899951 | 3300031819 | Soil | VPFSWPPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR |
| Ga0318512_100102071 | 3300031846 | Soil | LLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0306919_112942771 | 3300031879 | Soil | ASLLLLFDRSLGFWFAMLGIPFSWPPAGVLLASAAVAVLVSALLGLLGAFVPAWRVRRMPPYALIQPEVPG |
| Ga0306925_114857591 | 3300031890 | Soil | LGFYFGLLGIPFSWPPFAILETGAIVAAAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR |
| Ga0318522_102388782 | 3300031894 | Soil | ETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318551_108437642 | 3300031896 | Soil | GFYFGLLGIPFSWPPFAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318520_106383912 | 3300031897 | Soil | PPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0318520_108050841 | 3300031897 | Soil | VLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQMEGR |
| Ga0306921_109936271 | 3300031912 | Soil | PFSWPPAGVLQASAAVAMLVSALLGLVGAFVPAWRVRRMPPYALIQPEVPG |
| Ga0310885_102663222 | 3300031943 | Soil | QISAILAISFSTILGLVGAFLPAWRARRMAPYALIQAEGR |
| Ga0310910_109442751 | 3300031946 | Soil | FSWPPFAILATGATVAVAFSATLGLAGAFVPAWRVRGMAPYALIQAEVR |
| Ga0306926_110219951 | 3300031954 | Soil | WPPFAILETGAVVAVAFSAILGLVGAFVPAWRVRRMAPYALIQAEVR |
| Ga0306926_125045512 | 3300031954 | Soil | LGISFSWPPPGILQASAIAALVFSAILGVVGAFVPAWRVRRMAPYALIQAEAR |
| Ga0306926_125197241 | 3300031954 | Soil | QIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQMEGR |
| Ga0307479_107962821 | 3300031962 | Hardwood Forest Soil | PFSWPPLTILETGAVVAVAFSAILGLVGAFVPAWRVRRMAPYTLIQTEVG |
| Ga0318531_105672691 | 3300031981 | Soil | IPFSWPPFAILATGATVAVAFSATLGLAGAFVPAWRVRGMAPYALIQAEVR |
| Ga0310911_100827812 | 3300032035 | Soil | GLLGIPFSWPPFAILETGAILTVTFSAALGLVGAFVPAWRACGMAPYALIQAEVC |
| Ga0310911_108455542 | 3300032035 | Soil | VLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR |
| Ga0318545_103567511 | 3300032042 | Soil | PPAAVLQIGAGLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR |
| Ga0318505_100129761 | 3300032060 | Soil | LETGAVVAVIFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318514_103063572 | 3300032066 | Soil | SWPPFAILETGAVVAITFSAALGLVGAFVPAWRVRGMAPYALIQVEVR |
| Ga0318524_106527811 | 3300032067 | Soil | FSWPPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR |
| Ga0318553_107082672 | 3300032068 | Soil | LGVPFSWPPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR |
| Ga0318518_100260151 | 3300032090 | Soil | AVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR |
| Ga0307470_100322421 | 3300032174 | Hardwood Forest Soil | FSWPPPAILEAGSGVAVVLSASLGLLGAFLPAWRVRRMAPHALIQTEAR |
| Ga0307472_1023195021 | 3300032205 | Hardwood Forest Soil | VPFSWPPPAVLHAGAILAIVFSAILGLVGAFLPAWRVRRMAPYALIQRDGR |
| Ga0306920_1009095322 | 3300032261 | Soil | SAAVALLLSALLGLLGAFVPAWRVRRVAPYALIQPEAPG |
| Ga0318519_106370452 | 3300033290 | Soil | FGLLGIPFFWPPFAILETGAIVAVTFSATLGLVGAFVPAWRACGMAPYALIQAEVR |
| ⦗Top⦘ |