


| Basic Information | |
|---|---|
| Family ID | F067795 |
| Family Type | Metagenome |
| Number of Sequences | 125 |
| Average Sequence Length | 41 residues |
| Representative Sequence | KPTVGAMKLELELDQRDMGLKELPKPEQIYDFSILDELAKR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.80 % |
| % of genes near scaffold ends (potentially truncated) | 96.80 % |
| % of genes from short scaffolds (< 2000 bps) | 95.20 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.600 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.600 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 16.00 |
| PF12172 | DUF35_N | 12.00 |
| PF01796 | OB_aCoA_assoc | 5.60 |
| PF01522 | Polysacc_deac_1 | 4.00 |
| PF01738 | DLH | 3.20 |
| PF01797 | Y1_Tnp | 2.40 |
| PF08239 | SH3_3 | 1.60 |
| PF07719 | TPR_2 | 1.60 |
| PF13649 | Methyltransf_25 | 1.60 |
| PF02436 | PYC_OADA | 1.60 |
| PF04365 | BrnT_toxin | 0.80 |
| PF00682 | HMGL-like | 0.80 |
| PF12156 | ATPase-cat_bd | 0.80 |
| PF05598 | DUF772 | 0.80 |
| PF01842 | ACT | 0.80 |
| PF14559 | TPR_19 | 0.80 |
| PF11799 | IMS_C | 0.80 |
| PF00589 | Phage_integrase | 0.80 |
| PF04909 | Amidohydro_2 | 0.80 |
| PF07589 | PEP-CTERM | 0.80 |
| PF01547 | SBP_bac_1 | 0.80 |
| PF00291 | PALP | 0.80 |
| PF13240 | zinc_ribbon_2 | 0.80 |
| PF03466 | LysR_substrate | 0.80 |
| PF13419 | HAD_2 | 0.80 |
| PF02515 | CoA_transf_3 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 16.00 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 16.00 |
| COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 5.60 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 4.00 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.40 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.80 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.60 % |
| Unclassified | root | N/A | 6.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1019339 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1074614 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300000891|JGI10214J12806_13108005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 956 | Open in IMG/M |
| 3300000953|JGI11615J12901_11363941 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300002128|JGI24036J26619_10064596 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300003998|Ga0055472_10099976 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300003999|Ga0055469_10166561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300004643|Ga0062591_101062197 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005295|Ga0065707_10751540 | Not Available | 605 | Open in IMG/M |
| 3300005331|Ga0070670_100577460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300005332|Ga0066388_105341021 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005367|Ga0070667_100768709 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005440|Ga0070705_101469077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300005536|Ga0070697_100880098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300005543|Ga0070672_100203605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1655 | Open in IMG/M |
| 3300005543|Ga0070672_101958241 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005546|Ga0070696_100183597 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300005546|Ga0070696_101908682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_107010149 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006032|Ga0066696_10209507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300006358|Ga0068871_100828691 | Not Available | 854 | Open in IMG/M |
| 3300006796|Ga0066665_10958839 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006800|Ga0066660_11600226 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006852|Ga0075433_11239297 | Not Available | 647 | Open in IMG/M |
| 3300006871|Ga0075434_100984274 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300006904|Ga0075424_100871146 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006914|Ga0075436_100134167 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300007076|Ga0075435_100413955 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300009012|Ga0066710_104221941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300009036|Ga0105244_10390878 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009088|Ga0099830_11728660 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009100|Ga0075418_11175046 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300009100|Ga0075418_11428605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300009100|Ga0075418_12250999 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009111|Ga0115026_11199921 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009143|Ga0099792_11026246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK | 552 | Open in IMG/M |
| 3300009147|Ga0114129_10411588 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300009147|Ga0114129_11857816 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300009148|Ga0105243_11141476 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009157|Ga0105092_10701753 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009162|Ga0075423_12538155 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009167|Ga0113563_12992787 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010047|Ga0126382_11919765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300010336|Ga0134071_10015621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3135 | Open in IMG/M |
| 3300010360|Ga0126372_11658677 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010360|Ga0126372_12146106 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010362|Ga0126377_11692021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300010366|Ga0126379_10461201 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300010373|Ga0134128_10600103 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300010376|Ga0126381_103303100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300010397|Ga0134124_10381776 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300010400|Ga0134122_11233762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300010403|Ga0134123_11158512 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300010868|Ga0124844_1126225 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300011444|Ga0137463_1337247 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012202|Ga0137363_10289179 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300012357|Ga0137384_11398470 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012499|Ga0157350_1059016 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012515|Ga0157338_1037107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300012925|Ga0137419_10355695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1134 | Open in IMG/M |
| 3300012927|Ga0137416_10886893 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012929|Ga0137404_10129192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2077 | Open in IMG/M |
| 3300012971|Ga0126369_11193573 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012971|Ga0126369_12248045 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012976|Ga0134076_10409102 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012987|Ga0164307_10262898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1211 | Open in IMG/M |
| 3300015241|Ga0137418_10946667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300015371|Ga0132258_10696222 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300015371|Ga0132258_12529621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300015372|Ga0132256_100247064 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300015372|Ga0132256_100837524 | Not Available | 1036 | Open in IMG/M |
| 3300015374|Ga0132255_100549233 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300015374|Ga0132255_102700211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300015374|Ga0132255_103970789 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300015374|Ga0132255_105214287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK | 550 | Open in IMG/M |
| 3300016270|Ga0182036_10135108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1734 | Open in IMG/M |
| 3300016404|Ga0182037_12051159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK | 514 | Open in IMG/M |
| 3300018027|Ga0184605_10215174 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300018032|Ga0187788_10204185 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018053|Ga0184626_10428175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300018072|Ga0184635_10147969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 938 | Open in IMG/M |
| 3300018072|Ga0184635_10165191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300018075|Ga0184632_10483406 | Not Available | 510 | Open in IMG/M |
| 3300018076|Ga0184609_10008274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3782 | Open in IMG/M |
| 3300018076|Ga0184609_10314229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300018079|Ga0184627_10448727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300018429|Ga0190272_13180119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 511 | Open in IMG/M |
| 3300018466|Ga0190268_11971332 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300018476|Ga0190274_12253646 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300019881|Ga0193707_1012302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2896 | Open in IMG/M |
| 3300022534|Ga0224452_1189972 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300022756|Ga0222622_11125499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| 3300025908|Ga0207643_11007126 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025917|Ga0207660_11127422 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025930|Ga0207701_10763837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300025930|Ga0207701_11329622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300025936|Ga0207670_10584265 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300025945|Ga0207679_11607842 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025945|Ga0207679_11801489 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300025959|Ga0210116_1009789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1725 | Open in IMG/M |
| 3300025959|Ga0210116_1095531 | Not Available | 585 | Open in IMG/M |
| 3300026089|Ga0207648_10252830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1571 | Open in IMG/M |
| 3300026089|Ga0207648_11869263 | Not Available | 562 | Open in IMG/M |
| 3300027513|Ga0208685_1012477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2028 | Open in IMG/M |
| 3300027815|Ga0209726_10238302 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300027840|Ga0209683_10249755 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300027907|Ga0207428_10176803 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300027909|Ga0209382_11263561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300027909|Ga0209382_11828297 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300030619|Ga0268386_10137224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1871 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10242493 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031538|Ga0310888_10247353 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300031720|Ga0307469_10274240 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300031820|Ga0307473_10585686 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031852|Ga0307410_11414190 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031941|Ga0310912_11167789 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032075|Ga0310890_10227999 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300032144|Ga0315910_10859995 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300032174|Ga0307470_10136259 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300032205|Ga0307472_100190478 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300032205|Ga0307472_100383576 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300032770|Ga0335085_11039613 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300033413|Ga0316603_11165304 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300034164|Ga0364940_0033019 | Not Available | 1351 | Open in IMG/M |
| 3300034164|Ga0364940_0165923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 640 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.60% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.80% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.80% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.80% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.80% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.80% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.80% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10193392 | 3300000655 | Forest Soil | GRPTANAQKLDGELTRRNMGLKEPAKTEQIYDFSLLDELKQK* |
| AF_2010_repII_A100DRAFT_10746142 | 3300000655 | Forest Soil | PAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEELGKR* |
| JGI10214J12806_131080051 | 3300000891 | Soil | EFELDQRDMGLKEMPKAEQVFDFSLLDEVLAQKR* |
| JGI11615J12901_113639412 | 3300000953 | Soil | DGRPTAGAVKLDAELSQRDMGLKELPKVEQTYDFSILDELAKK* |
| JGI24036J26619_100645961 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | WAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0055472_100999761 | 3300003998 | Natural And Restored Wetlands | LDGKPTAAAMKLEFELDERLMNLKETPKPEQIYDFSLLDAVEKK* |
| Ga0055469_101665612 | 3300003999 | Natural And Restored Wetlands | TANAMKLEFELDQRSMNLKELPKPEQIYDFSLLDEASKR* |
| Ga0062591_1010621971 | 3300004643 | Soil | ALDGKPTAAANKLDFELTQRDMGLKEPPKMEQVYDFSLLDELAKR* |
| Ga0065707_107515402 | 3300005295 | Switchgrass Rhizosphere | GAWALDSRPTANAQRLDAELTRRSMGLKEPAKPEQIYDFSLLDELKQK* |
| Ga0070670_1005774603 | 3300005331 | Switchgrass Rhizosphere | NGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0066388_1053410211 | 3300005332 | Tropical Forest Soil | ALDGKPTPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEKLGKR* |
| Ga0070667_1007687093 | 3300005367 | Switchgrass Rhizosphere | KGWAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0070705_1014690772 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GRPTVEVLKLDAELSQRDMGLKELPRPEQTYDLSMLDELAKR* |
| Ga0070697_1008800982 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | WALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK* |
| Ga0070672_1002036051 | 3300005543 | Miscanthus Rhizosphere | NANKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR* |
| Ga0070672_1019582412 | 3300005543 | Miscanthus Rhizosphere | VNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0070696_1001835973 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AWALDGRPTANAQKLDAELTRRNMGMKEPAKPEQIYDFSLLDELKQK* |
| Ga0070696_1019086822 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TPGSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQKR* |
| Ga0066903_1070101491 | 3300005764 | Tropical Forest Soil | ALDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSMLDELAKR* |
| Ga0066696_102095073 | 3300006032 | Soil | GSWALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK* |
| Ga0068871_1008286912 | 3300006358 | Miscanthus Rhizosphere | DGRPSVNANKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR* |
| Ga0066665_109588391 | 3300006796 | Soil | TKFEFELDQRDMGLKEPPRPEQVYDFSLLEELAKR* |
| Ga0066660_116002261 | 3300006800 | Soil | MKLEFELDQRDMGLKELPKVDQVYDFSLLEESGRR* |
| Ga0075433_112392971 | 3300006852 | Populus Rhizosphere | NVEGAWALDGRPTANAQKLDAELTRRSMGLKEPPKSEQIYDFSLLDELKQR* |
| Ga0075434_1009842742 | 3300006871 | Populus Rhizosphere | GALKLELELDQKDAGLKELPKAEQIYDFSLLDELEKR* |
| Ga0075424_1008711461 | 3300006904 | Populus Rhizosphere | IHKGWAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0075436_1001341673 | 3300006914 | Populus Rhizosphere | PGATKFEFEIDQRDMGLKEPPKPEQVFDFSLLDEVAKR* |
| Ga0075435_1004139552 | 3300007076 | Populus Rhizosphere | PTIGSQSFEFELAQREMGLKEPPKPEQVYDFSILDEISKR* |
| Ga0066710_1042219412 | 3300009012 | Grasslands Soil | SWALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK |
| Ga0105244_103908781 | 3300009036 | Miscanthus Rhizosphere | TAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0099830_117286602 | 3300009088 | Vadose Zone Soil | RPTPGSQKFEFDLAQRDMGLKEPPKPEQVYDFSLLEELAKR* |
| Ga0075418_111750461 | 3300009100 | Populus Rhizosphere | EALKLELELDQKDAGLKELPKAEQIYDFSLLDEVTKR* |
| Ga0075418_114286051 | 3300009100 | Populus Rhizosphere | GWALDGKPTAGAMKLEFELDQRDMGLKELPRAEQIYDFSLLDGLARR* |
| Ga0075418_122509992 | 3300009100 | Populus Rhizosphere | RPSVNANKLDFEMTQRDMGLKEPPRLEQIYDFSLLDEIAKR* |
| Ga0115026_111999212 | 3300009111 | Wetland | LDGRPTPGAVKLDAELSQRDMGLKELPKAEQTYDFSMLDELAKR* |
| Ga0099792_110262461 | 3300009143 | Vadose Zone Soil | KGWSVDGKPTPGALKLELELDQKDAGLKDLPKPEQIYDFALLDEIAKR* |
| Ga0114129_104115881 | 3300009147 | Populus Rhizosphere | KGWSVDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSLLDELAKK* |
| Ga0114129_118578161 | 3300009147 | Populus Rhizosphere | NFEFALAQREMGLKEPPKPEQVYDFSILDEISKR* |
| Ga0105243_111414761 | 3300009148 | Miscanthus Rhizosphere | GSQKFEFDLAQREMGLKEPPKPEQVYDFSILEEVTKK* |
| Ga0105092_107017532 | 3300009157 | Freshwater Sediment | ALKLELELDQKDAGLKELPKPEQIYDFSMLDELAKR* |
| Ga0075423_125381551 | 3300009162 | Populus Rhizosphere | KPTPGALKLELELDQKDAGLKELPKAEQIYDFSLLDELEKR* |
| Ga0113563_129927872 | 3300009167 | Freshwater Wetlands | KLDAELSQRDMGLKELPRAEQTYDFSMLDELTKR* |
| Ga0126382_119197652 | 3300010047 | Tropical Forest Soil | AAMKLELELDQRDLGLKELPRPEQIYDFSLLSELPKK* |
| Ga0134071_100156211 | 3300010336 | Grasslands Soil | GKPTPGAMKLEFELDQRDMGLKELPRAEQIYDFSLLDELARR* |
| Ga0126372_116586772 | 3300010360 | Tropical Forest Soil | GKPTPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEELGKR* |
| Ga0126372_121461062 | 3300010360 | Tropical Forest Soil | TKFEFEIDQRDMGLKEFPKPEQVFDFSLLEELAKR* |
| Ga0126377_116920211 | 3300010362 | Tropical Forest Soil | NKLDFALTQRDMGLKEPPKLEQIYDFSLLDEIAKR* |
| Ga0126379_104612012 | 3300010366 | Tropical Forest Soil | PAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEKLGKR* |
| Ga0134128_106001031 | 3300010373 | Terrestrial Soil | WAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVAKR* |
| Ga0126381_1033031002 | 3300010376 | Tropical Forest Soil | SINANKLDFALTQRDMRLKEPPKLEQIYDFSLLDEIAKR* |
| Ga0134124_103817763 | 3300010397 | Terrestrial Soil | GALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVAKR* |
| Ga0134122_112337621 | 3300010400 | Terrestrial Soil | AGALKCDAELSKRDMGLKELPRPEQTYDLSMLDELVKR* |
| Ga0134123_111585123 | 3300010403 | Terrestrial Soil | PTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK* |
| Ga0124844_11262251 | 3300010868 | Tropical Forest Soil | KFEFEIDQRDMGLKEFPSPEQVFDFSLLDEVANR* |
| Ga0137463_13372472 | 3300011444 | Soil | ANANKLDFELTQRDMGLKEPPKMEQIYDFSLLDELAKR* |
| Ga0137363_102891793 | 3300012202 | Vadose Zone Soil | KLELELDQKDAGLKELPRAEQIYDFSLLDELAKR* |
| Ga0137384_113984701 | 3300012357 | Vadose Zone Soil | IHKGWAVDGKPTPGALKVELELDQKDAGLKELPKPEQIYDFSLLDELAKK* |
| Ga0157350_10590162 | 3300012499 | Unplanted Soil | PGSQKFEFDLAQREMGLKEPPKPEQVYDFSILEELTKK* |
| Ga0157338_10371071 | 3300012515 | Arabidopsis Rhizosphere | NKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR* |
| Ga0137419_103556952 | 3300012925 | Vadose Zone Soil | ALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK* |
| Ga0137416_108868931 | 3300012927 | Vadose Zone Soil | PTPGSQKFEFDLAQREMGLKEPPKPEQVYDFSILDEIARR* |
| Ga0137404_101291921 | 3300012929 | Vadose Zone Soil | PTPGALKLELELDQKDAGLKELPKVEQIYDFSMLDELAKR* |
| Ga0126369_111935732 | 3300012971 | Tropical Forest Soil | TPGALKLELELDQKDAGLKELPKPEQIYDFSMLDELAKR* |
| Ga0126369_122480452 | 3300012971 | Tropical Forest Soil | PTPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEELGKR* |
| Ga0134076_104091021 | 3300012976 | Grasslands Soil | RPSRGAMKLEFELDQRDMGLKELPKVDQVYDFSLLEESGKR* |
| Ga0164307_102628981 | 3300012987 | Soil | LKLELELDQKDAGLKELPKPEQIYDFSLLDEVAKR* |
| Ga0137418_109466671 | 3300015241 | Vadose Zone Soil | DAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK* |
| Ga0132258_106962221 | 3300015371 | Arabidopsis Rhizosphere | HKGWAVDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSILDELAKR* |
| Ga0132258_125296211 | 3300015371 | Arabidopsis Rhizosphere | KLELELDQKDAGLKELPKPEQIYDFSLLDEIGRR* |
| Ga0132256_1002470641 | 3300015372 | Arabidopsis Rhizosphere | PTSGALKLDVQLSQKDAGLKELPEPEQIYDFSLLDEIAKR* |
| Ga0132256_1008375241 | 3300015372 | Arabidopsis Rhizosphere | SVDGRPSVNANKLDFELTQRDMGVKEPPKLEQIYDFSLLDEIAKR* |
| Ga0132255_1005492331 | 3300015374 | Arabidopsis Rhizosphere | RPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVTTNKGM* |
| Ga0132255_1027002111 | 3300015374 | Arabidopsis Rhizosphere | PGALKLELELDQKDAGLKELPKPEQIYDFSLLDEITRR* |
| Ga0132255_1039707891 | 3300015374 | Arabidopsis Rhizosphere | GALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVRK* |
| Ga0132255_1052142872 | 3300015374 | Arabidopsis Rhizosphere | GALKLELELDQKDAGLKELPKPEQIYDFSLLDEITRR* |
| Ga0182036_101351081 | 3300016270 | Soil | EGAWALDGRPTASAHKLDAELTRRNMGLKEAPKPEQIYDFSLLDESKQK |
| Ga0182037_120511592 | 3300016404 | Soil | AEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKR |
| Ga0184605_102151742 | 3300018027 | Groundwater Sediment | GKPTVGAMKLELELDQRDMGLKELPKPEQIYDFSILDELAKR |
| Ga0187788_102041852 | 3300018032 | Tropical Peatland | WALDGKPTPGALKLELELDQRDAGLKEFPKPEQIYDFSMLGELAKR |
| Ga0184626_104281752 | 3300018053 | Groundwater Sediment | ALDGKPTAGALKLELELDQRDMGLKELPKPEQIYDFSLLDEVGKR |
| Ga0184635_101479691 | 3300018072 | Groundwater Sediment | RFGATKFEFDIDQRLKEPPRPEQVFDFSLLDELGKR |
| Ga0184635_101651913 | 3300018072 | Groundwater Sediment | PGSQKFEFDLAQREMGLKEPPKPEQVYDFSILDEVAKK |
| Ga0184632_104834062 | 3300018075 | Groundwater Sediment | LDGKPTAAAMKLDAELSMRDMGLKELPKPEQSYDFSLLDEVGKR |
| Ga0184609_100082743 | 3300018076 | Groundwater Sediment | KPTAGALKLELELDQRDMGLKELPKPEQIYDFSLLDEVGRR |
| Ga0184609_103142292 | 3300018076 | Groundwater Sediment | GATEFEFDLDQRDMGLKEPPRPEQVYDFSLLDELAKR |
| Ga0184627_104487271 | 3300018079 | Groundwater Sediment | GWALDGRPTPAALKLDAELSQRDMGLKELPRPEQTYDLSMLDEITKR |
| Ga0190272_131801192 | 3300018429 | Soil | SMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQRR |
| Ga0190268_119713321 | 3300018466 | Soil | MKFEFELAQREMSLKEPPRPEQVYDFSILDELSKK |
| Ga0190274_122536461 | 3300018476 | Soil | PTANAIKLDAELSQRDMGLKELPRVEQTYDFSMLDELTKK |
| Ga0193707_10123021 | 3300019881 | Soil | DGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK |
| Ga0224452_11899721 | 3300022534 | Groundwater Sediment | KPTVGAMKLELELDQRDMGLKELPKPEQIYDFSILDELAKR |
| Ga0222622_111254992 | 3300022756 | Groundwater Sediment | KGWAKDGRTTPGSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQKR |
| Ga0207643_110071261 | 3300025908 | Miscanthus Rhizosphere | EALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK |
| Ga0207660_111274222 | 3300025917 | Corn Rhizosphere | KGWALDGKPTANAMKLEFDLDQRDMGLKELPKAEQLFDFSLLDEALAQKR |
| Ga0207701_107638372 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PTASAQKLDAELTRRNMGMKEPAKPEQIYDFSLLDELKQK |
| Ga0207701_113296222 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PGSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQKR |
| Ga0207670_105842653 | 3300025936 | Switchgrass Rhizosphere | TPGSQKFEFDLAQREMGLKEPPKPEQVYDFSILDELAKK |
| Ga0207679_116078422 | 3300025945 | Corn Rhizosphere | GRPTIGSQSFEFELAQREMGLKEPPKPEQVYDFSILDEISKR |
| Ga0207679_118014891 | 3300025945 | Corn Rhizosphere | VDGKPTPGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVAKR |
| Ga0210116_10097891 | 3300025959 | Natural And Restored Wetlands | VKLDAELSQRDMGLKELPRPEQTYDLSMLDELAKR |
| Ga0210116_10955312 | 3300025959 | Natural And Restored Wetlands | LLAGWALDGKPTPAAMKLEFELDERLMNLKETPKPEQIYDFSLLDAVGKK |
| Ga0207648_102528302 | 3300026089 | Miscanthus Rhizosphere | PTPGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVVKK |
| Ga0207648_118692632 | 3300026089 | Miscanthus Rhizosphere | PSVNANKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR |
| Ga0208685_10124771 | 3300027513 | Soil | AIRPGWALDGRPTAGAVKLDAELSQRDMGLKELPRPEQTYDFSMLEELTRKQ |
| Ga0209726_102383022 | 3300027815 | Groundwater | GWALDGRPTPGAVKLDAELSQRDMGLKELPRVDQTYDFSMLDELIKK |
| Ga0209683_102497552 | 3300027840 | Wetland Sediment | ALDGRPTPGAVKLDAELSQRDLGLKELPRPEQTYDFSMLDELGKK |
| Ga0207428_101768033 | 3300027907 | Populus Rhizosphere | DGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSLLDELAKK |
| Ga0209382_112635611 | 3300027909 | Populus Rhizosphere | ALKLDAELSRRDMGLKELPRPEQTYDFSMLDELANR |
| Ga0209382_118282972 | 3300027909 | Populus Rhizosphere | MPINLTFEMTQRDMGLKEPPRLEQIYDFSLLDEIAKR |
| Ga0268386_101372242 | 3300030619 | Soil | MRLEFELDQRDMNLKETPKPEQVYDFSLLDEVGRK |
| (restricted) Ga0255310_102424932 | 3300031197 | Sandy Soil | GRPSPGALKLDAELSQRDMGLKELPRPEQTYDLSLLDELAKR |
| Ga0310888_102473532 | 3300031538 | Soil | PAAANKLDFELTQRDMGLKEVPKMEQVYDFSLLDELAKR |
| Ga0307469_102742403 | 3300031720 | Hardwood Forest Soil | GKPTPAAMKLEFELDQRDLGLKEPPKPEQIYDFSLLEELGKR |
| Ga0307473_105856861 | 3300031820 | Hardwood Forest Soil | DGKPTAAAMKLEFELDQRDLGLKEPPKPEQIYDFSLLEELSKR |
| Ga0307410_114141901 | 3300031852 | Rhizosphere | KPTAAANKLDFELTQRDMGLKEVPKMEQVYDFSLLDELAKR |
| Ga0310912_111677891 | 3300031941 | Soil | VDGKPTPGALKLELELDQKDAGLKELPRAEQIYDFSMLDELAKR |
| Ga0310890_102279992 | 3300032075 | Soil | TPGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVVRK |
| Ga0315910_108599951 | 3300032144 | Soil | ASMKLEFELDQRDMGLKDLPKPEQIYDFSILEELSKR |
| Ga0307470_101362593 | 3300032174 | Hardwood Forest Soil | PTPGATKFEFEIDQRDMGLKEMPRSEQVFDFSLLEELAKR |
| Ga0307472_1001904783 | 3300032205 | Hardwood Forest Soil | RLWLLRNGRPTANAQKLDAELTRRSMGLKEPPKSEQIYDFSLLDELKQR |
| Ga0307472_1003835762 | 3300032205 | Hardwood Forest Soil | PTANAQKLDAELTRRSMGLKEPPRSEQIYDFSLLDELKQR |
| Ga0335085_110396132 | 3300032770 | Soil | GATKFEFEIDQRDMGLKEFPKPEQVFDFSLLEELTRR |
| Ga0316603_111653042 | 3300033413 | Soil | RPTAGAIKLDAELSQRDMGLKELPRPEQTYDFSMLEELTRKQ |
| Ga0364940_0033019_877_987 | 3300034164 | Sediment | LKFVLGEQAQRDMGLKEQPKPEQVYDFSLLDEVAKR |
| Ga0364940_0165923_509_640 | 3300034164 | Sediment | DGKPTPGALKLEFELDQRDLGLKEPPKLEQVYDFSLLDELGSR |
| ⦗Top⦘ |