


| Basic Information | |
|---|---|
| Family ID | F067692 |
| Family Type | Metagenome |
| Number of Sequences | 125 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MMIFGEAVTKANLKRLAIKYKAEIAGLVVAFILGALLF |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.60 % |
| % of genes near scaffold ends (potentially truncated) | 18.40 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 53 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.200 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (61.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 81.58% β-sheet: 0.00% Coil/Unstructured: 18.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 13.60 |
| PF13578 | Methyltransf_24 | 6.40 |
| PF08291 | Peptidase_M15_3 | 4.80 |
| PF08241 | Methyltransf_11 | 0.80 |
| PF04545 | Sigma70_r4 | 0.80 |
| PF06034 | DUF919 | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.20 % |
| All Organisms | root | All Organisms | 32.00 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005613|Ga0074649_1007058 | Not Available | 8979 | Open in IMG/M |
| 3300006025|Ga0075474_10044895 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1508 | Open in IMG/M |
| 3300006025|Ga0075474_10216321 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 584 | Open in IMG/M |
| 3300006026|Ga0075478_10018703 | Not Available | 2341 | Open in IMG/M |
| 3300006027|Ga0075462_10033073 | Not Available | 1661 | Open in IMG/M |
| 3300006637|Ga0075461_10093622 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 948 | Open in IMG/M |
| 3300006637|Ga0075461_10099669 | Not Available | 914 | Open in IMG/M |
| 3300006802|Ga0070749_10048209 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 2600 | Open in IMG/M |
| 3300006802|Ga0070749_10123020 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1523 | Open in IMG/M |
| 3300006802|Ga0070749_10227600 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1061 | Open in IMG/M |
| 3300006802|Ga0070749_10301626 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 898 | Open in IMG/M |
| 3300006802|Ga0070749_10401743 | Not Available | 756 | Open in IMG/M |
| 3300006802|Ga0070749_10494545 | Not Available | 667 | Open in IMG/M |
| 3300006802|Ga0070749_10664550 | Not Available | 559 | Open in IMG/M |
| 3300006802|Ga0070749_10680402 | Not Available | 551 | Open in IMG/M |
| 3300006810|Ga0070754_10066699 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1850 | Open in IMG/M |
| 3300006810|Ga0070754_10370736 | Not Available | 630 | Open in IMG/M |
| 3300006867|Ga0075476_10110764 | Not Available | 1050 | Open in IMG/M |
| 3300006868|Ga0075481_10089097 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1152 | Open in IMG/M |
| 3300006868|Ga0075481_10151138 | Not Available | 846 | Open in IMG/M |
| 3300006874|Ga0075475_10167087 | Not Available | 957 | Open in IMG/M |
| 3300006874|Ga0075475_10292834 | Not Available | 673 | Open in IMG/M |
| 3300006916|Ga0070750_10036503 | Not Available | 2425 | Open in IMG/M |
| 3300006919|Ga0070746_10140904 | Not Available | 1179 | Open in IMG/M |
| 3300006919|Ga0070746_10435913 | Not Available | 583 | Open in IMG/M |
| 3300007346|Ga0070753_1067569 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1434 | Open in IMG/M |
| 3300007538|Ga0099851_1048091 | Not Available | 1677 | Open in IMG/M |
| 3300007538|Ga0099851_1124460 | Not Available | 972 | Open in IMG/M |
| 3300007538|Ga0099851_1126264 | Not Available | 963 | Open in IMG/M |
| 3300007538|Ga0099851_1269935 | Not Available | 605 | Open in IMG/M |
| 3300007538|Ga0099851_1278897 | Not Available | 593 | Open in IMG/M |
| 3300007538|Ga0099851_1359231 | Not Available | 507 | Open in IMG/M |
| 3300007539|Ga0099849_1178213 | Not Available | 809 | Open in IMG/M |
| 3300007540|Ga0099847_1049322 | Not Available | 1328 | Open in IMG/M |
| 3300007540|Ga0099847_1049488 | Not Available | 1325 | Open in IMG/M |
| 3300007540|Ga0099847_1098219 | Not Available | 893 | Open in IMG/M |
| 3300007541|Ga0099848_1081749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1259 | Open in IMG/M |
| 3300007541|Ga0099848_1314180 | Not Available | 535 | Open in IMG/M |
| 3300007542|Ga0099846_1034395 | Not Available | 1945 | Open in IMG/M |
| 3300007542|Ga0099846_1043542 | Not Available | 1713 | Open in IMG/M |
| 3300007542|Ga0099846_1098713 | Not Available | 1076 | Open in IMG/M |
| 3300007960|Ga0099850_1187336 | Not Available | 819 | Open in IMG/M |
| 3300007960|Ga0099850_1301894 | Not Available | 607 | Open in IMG/M |
| 3300009149|Ga0114918_10721375 | Not Available | 522 | Open in IMG/M |
| 3300009469|Ga0127401_1014152 | Not Available | 2339 | Open in IMG/M |
| 3300009529|Ga0114919_10069262 | Not Available | 2589 | Open in IMG/M |
| 3300010296|Ga0129348_1049444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1517 | Open in IMG/M |
| 3300010296|Ga0129348_1150386 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 806 | Open in IMG/M |
| 3300010297|Ga0129345_1205432 | Not Available | 698 | Open in IMG/M |
| 3300010299|Ga0129342_1071261 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1333 | Open in IMG/M |
| 3300010300|Ga0129351_1164515 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 871 | Open in IMG/M |
| 3300010316|Ga0136655_1066003 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1114 | Open in IMG/M |
| 3300010316|Ga0136655_1150559 | Not Available | 695 | Open in IMG/M |
| 3300010318|Ga0136656_1086870 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1104 | Open in IMG/M |
| 3300010354|Ga0129333_10669569 | Not Available | 895 | Open in IMG/M |
| 3300010354|Ga0129333_11738083 | Not Available | 507 | Open in IMG/M |
| 3300010368|Ga0129324_10286089 | Not Available | 651 | Open in IMG/M |
| 3300010368|Ga0129324_10329743 | Not Available | 596 | Open in IMG/M |
| 3300010368|Ga0129324_10367441 | Not Available | 558 | Open in IMG/M |
| 3300013010|Ga0129327_10543094 | Not Available | 635 | Open in IMG/M |
| 3300017824|Ga0181552_10420070 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 638 | Open in IMG/M |
| 3300017950|Ga0181607_10057763 | Not Available | 2596 | Open in IMG/M |
| 3300017950|Ga0181607_10162268 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1346 | Open in IMG/M |
| 3300018041|Ga0181601_10413096 | Not Available | 719 | Open in IMG/M |
| 3300018416|Ga0181553_10048956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → unclassified Cellvibrionales → Cellvibrionales bacterium TMED49 | 2820 | Open in IMG/M |
| 3300018424|Ga0181591_10304379 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1214 | Open in IMG/M |
| 3300018424|Ga0181591_10442490 | Not Available | 959 | Open in IMG/M |
| 3300019459|Ga0181562_10415878 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 647 | Open in IMG/M |
| 3300020174|Ga0181603_10378777 | Not Available | 523 | Open in IMG/M |
| 3300020178|Ga0181599_1326223 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 556 | Open in IMG/M |
| 3300021389|Ga0213868_10211587 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1156 | Open in IMG/M |
| 3300021960|Ga0222715_10540482 | Not Available | 612 | Open in IMG/M |
| 3300022057|Ga0212025_1054186 | Not Available | 693 | Open in IMG/M |
| 3300022063|Ga0212029_1059187 | Not Available | 558 | Open in IMG/M |
| 3300022065|Ga0212024_1016768 | Not Available | 1163 | Open in IMG/M |
| 3300022065|Ga0212024_1062353 | Not Available | 659 | Open in IMG/M |
| 3300022065|Ga0212024_1098132 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 522 | Open in IMG/M |
| 3300022068|Ga0212021_1008043 | Not Available | 1713 | Open in IMG/M |
| 3300022069|Ga0212026_1064535 | Not Available | 555 | Open in IMG/M |
| 3300022169|Ga0196903_1004241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1904 | Open in IMG/M |
| 3300022176|Ga0212031_1072429 | Not Available | 586 | Open in IMG/M |
| 3300022187|Ga0196899_1059158 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1228 | Open in IMG/M |
| 3300022187|Ga0196899_1154261 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 636 | Open in IMG/M |
| 3300022198|Ga0196905_1092092 | Not Available | 816 | Open in IMG/M |
| 3300022200|Ga0196901_1032161 | Not Available | 2042 | Open in IMG/M |
| 3300024262|Ga0210003_1090557 | Not Available | 1415 | Open in IMG/M |
| 3300024433|Ga0209986_10421428 | Not Available | 604 | Open in IMG/M |
| 3300025543|Ga0208303_1082549 | Not Available | 709 | Open in IMG/M |
| 3300025543|Ga0208303_1089144 | Not Available | 670 | Open in IMG/M |
| 3300025646|Ga0208161_1034601 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Kordia → unclassified Kordia → Kordia sp. | 1746 | Open in IMG/M |
| 3300025646|Ga0208161_1146659 | Not Available | 594 | Open in IMG/M |
| 3300025647|Ga0208160_1073309 | Not Available | 930 | Open in IMG/M |
| 3300025653|Ga0208428_1061826 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1114 | Open in IMG/M |
| 3300025655|Ga0208795_1049756 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1243 | Open in IMG/M |
| 3300025671|Ga0208898_1021588 | Not Available | 2826 | Open in IMG/M |
| 3300025671|Ga0208898_1109033 | Not Available | 824 | Open in IMG/M |
| 3300025687|Ga0208019_1085496 | Not Available | 998 | Open in IMG/M |
| 3300025687|Ga0208019_1136710 | Not Available | 706 | Open in IMG/M |
| 3300025759|Ga0208899_1033850 | Not Available | 2356 | Open in IMG/M |
| 3300025769|Ga0208767_1043571 | Not Available | 2162 | Open in IMG/M |
| 3300025769|Ga0208767_1111445 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1070 | Open in IMG/M |
| 3300025769|Ga0208767_1204931 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 658 | Open in IMG/M |
| 3300025771|Ga0208427_1237864 | Not Available | 564 | Open in IMG/M |
| 3300025840|Ga0208917_1044038 | unclassified Hyphomonas → Hyphomonas sp. | 1792 | Open in IMG/M |
| 3300025853|Ga0208645_1135056 | Not Available | 961 | Open in IMG/M |
| 3300025889|Ga0208644_1240308 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 756 | Open in IMG/M |
| 3300025889|Ga0208644_1310823 | Not Available | 621 | Open in IMG/M |
| 3300027888|Ga0209635_10549976 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium DG_23 | 871 | Open in IMG/M |
| 3300027901|Ga0209427_10071310 | Not Available | 3206 | Open in IMG/M |
| 3300027917|Ga0209536_101255551 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 907 | Open in IMG/M |
| 3300031539|Ga0307380_10650923 | Not Available | 897 | Open in IMG/M |
| 3300031566|Ga0307378_11547458 | Not Available | 502 | Open in IMG/M |
| 3300031578|Ga0307376_10220899 | Not Available | 1287 | Open in IMG/M |
| 3300031578|Ga0307376_10291779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1091 | Open in IMG/M |
| 3300031578|Ga0307376_10297566 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1078 | Open in IMG/M |
| 3300031578|Ga0307376_10386903 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 921 | Open in IMG/M |
| 3300031578|Ga0307376_10480092 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 806 | Open in IMG/M |
| 3300031578|Ga0307376_10506264 | Not Available | 780 | Open in IMG/M |
| 3300031578|Ga0307376_10728470 | Not Available | 619 | Open in IMG/M |
| 3300031669|Ga0307375_10125327 | Not Available | 1810 | Open in IMG/M |
| 3300031673|Ga0307377_10209089 | Not Available | 1514 | Open in IMG/M |
| 3300031673|Ga0307377_11025064 | Not Available | 552 | Open in IMG/M |
| 3300031673|Ga0307377_11054435 | Not Available | 542 | Open in IMG/M |
| 3300034374|Ga0348335_010184 | Not Available | 5218 | Open in IMG/M |
| 3300034374|Ga0348335_024482 | Not Available | 2800 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 61.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 11.20% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 10.40% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.20% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.40% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.80% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.80% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.80% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0074649_100705819 | 3300005613 | Saline Water And Sediment | MMIFGEAVTKANAKRIITKYKAEIAGLVIAFILGALLF* |
| Ga0075474_100448954 | 3300006025 | Aqueous | MMIFGEAVTKANAKRLITKYKAEIAGLVVAFILGALLF* |
| Ga0075474_102163212 | 3300006025 | Aqueous | MMIFGEAVTKANLKRLAIKYKAEIAGLLAAFILGALLF* |
| Ga0075478_100187037 | 3300006026 | Aqueous | MMIFGEAITKANLKKLAIKYKAEIAGLLAAFILGALLF* |
| Ga0075462_100330734 | 3300006027 | Aqueous | MMIFGEAVTKANAKRLVIKYKAEIAGLVVAFILGALLF* |
| Ga0075461_100936223 | 3300006637 | Aqueous | MIFGEAVTKANAKRLITKYKAEIAGLVVAFILGALLF* |
| Ga0075461_100996693 | 3300006637 | Aqueous | MMIFGEAVTKENVKRLAIKYKTEIAGLVVAFILGALLF* |
| Ga0070749_100482095 | 3300006802 | Aqueous | MMIFGEAVTKANAKRIITKYKAEIAGLVVAFILGALLF* |
| Ga0070749_101230202 | 3300006802 | Aqueous | MMIFGEAVTKANAKRLITKYKAEIAGLVIAFILGALLF* |
| Ga0070749_102276002 | 3300006802 | Aqueous | MMIFGEAVTKANAKRLITKYKTEIAGLVAAFILGALLF* |
| Ga0070749_103016263 | 3300006802 | Aqueous | MIIFGQPITKQNAKRIVLQYKAEIAGLIAAFILGALLF* |
| Ga0070749_104017433 | 3300006802 | Aqueous | MIFGWVPSKDNAKKFVIQYKAEIAGLAAAFILGALLF* |
| Ga0070749_104945453 | 3300006802 | Aqueous | MMIFGEAVTKENVKRLVIKYKAEIAGLLAAFILGALLF* |
| Ga0070749_106645503 | 3300006802 | Aqueous | MMIFGEAVTKANAKRITMKYKAEIAGLVVAFILGALLF* |
| Ga0070749_106804022 | 3300006802 | Aqueous | MMIFGEAVTKANLKRLAIKYKTEIAGLVIAFILGALLF* |
| Ga0070754_100666994 | 3300006810 | Aqueous | MIFGEAVTKANAKRIITKYKAEIAGLVVAFILGALLF* |
| Ga0070754_103707361 | 3300006810 | Aqueous | MMIFGEAVTKENVKKLAIKYKAEIAGLLAAFILGALLF* |
| Ga0075476_101107645 | 3300006867 | Aqueous | MIFGEAVTKENVKRLVIKYKAEIAGLLAAFILGALLF* |
| Ga0075481_100890974 | 3300006868 | Aqueous | MMIFGEAVTKANIKRIAIKYKAEIAGLVAAFILGALLF* |
| Ga0075481_101511381 | 3300006868 | Aqueous | MIFGEAVTKANLKRLAIKYKSEIAGLLAAFILGALLF* |
| Ga0075475_101670872 | 3300006874 | Aqueous | MMIFGEAITKANLKRLAIKYKAEIAGLVVAFILGALLF* |
| Ga0075475_102928343 | 3300006874 | Aqueous | MMIFGEAVTKANVKRLAIKYKAEIAGLVAAFILGALLF* |
| Ga0070750_100365035 | 3300006916 | Aqueous | MIIFGQPITKQNAKRMVLQYKAEIAGLIAAFILGALLF* |
| Ga0070746_101409044 | 3300006919 | Aqueous | IYRRKTMMIFGEAVTKANAKRIITKYKAEIAGLVVAFILGALLF* |
| Ga0070746_104359133 | 3300006919 | Aqueous | MMIFGEAITKANLKRLVIKYKAEIAGLLAAFILGALLF* |
| Ga0070753_10675694 | 3300007346 | Aqueous | MMIFGEAVTKANAKRLITKYKEEIAGLVVAFILGALLF* |
| Ga0099851_10480913 | 3300007538 | Aqueous | MIIFGQPLTKQNAKRMVLQYKAEIAGLIAAFILGALLF* |
| Ga0099851_11244601 | 3300007538 | Aqueous | HLEYITIYRRKTMMIFGEAVTKANAKRLITKYKAEIAGLVIAFILGALLF* |
| Ga0099851_11262641 | 3300007538 | Aqueous | MIIFGQPLTKQNAKRMVLQYKTEIAGLIAAFILGALLF* |
| Ga0099851_12699353 | 3300007538 | Aqueous | HLEYHSIYRRKTMMIFGEAVTKENAKRIAIKYKAEIAGLVIAFILGALLF* |
| Ga0099851_12788971 | 3300007538 | Aqueous | HLEYITIYRRKTMMIFGEAVTKANAKRIITKYKAEIAGLVVAFILGALLF* |
| Ga0099851_13592313 | 3300007538 | Aqueous | MMIFGEAVTKENVKRLAIKYKTEIAGLVIAFILGALLF* |
| Ga0099849_11782133 | 3300007539 | Aqueous | MMIFGEAVTKANLKRLAIKYKAEIAGLVIAFILGALLF* |
| Ga0099847_10493222 | 3300007540 | Aqueous | MMIFGEAVTKENAKRIAIKYKAEIAGLVIAFILGALLF* |
| Ga0099847_10494882 | 3300007540 | Aqueous | MMIFGEAVTKANLKKLITKYKAEIAGLVIAFILGALLF* |
| Ga0099847_10982191 | 3300007540 | Aqueous | IMMIFGEAVTKENVKRIITKYKAEIAGLVIAFILGALLF* |
| Ga0099848_10817491 | 3300007541 | Aqueous | MIIFGEAVTKANAKRIITKYKAEIAGLVIAFILGALLF* |
| Ga0099848_13141803 | 3300007541 | Aqueous | MMIFGEAVTKANAKRIAIKYKAEIAGLVIAFILGALLF* |
| Ga0099846_10343957 | 3300007542 | Aqueous | MIIFGQPLTKQNAKRMVLQYKAEIAGLIAAFILGSLLF* |
| Ga0099846_10435422 | 3300007542 | Aqueous | MMIFGEAVTKANLKRLAIKYKAEIAGLVVAFILGALLF* |
| Ga0099846_10987133 | 3300007542 | Aqueous | GQPLTKQNAKRMVLQYKAEIAGLIAAFILGALLF* |
| Ga0099850_11873361 | 3300007960 | Aqueous | KEKLMIIFGQPITKQNAKRIVLQYKAEIAGLIAAFILGALLF* |
| Ga0099850_13018943 | 3300007960 | Aqueous | MMIFGEAVTKANAKRLAIKYKTEIAGLVVAFILGALLF* |
| Ga0114918_107213753 | 3300009149 | Deep Subsurface | MMIFGEAITKANLKRIITKYKTEIAGLVVAFILGALLF* |
| Ga0127401_101415210 | 3300009469 | Meromictic Pond | MMIFGEAVTKANVKRLAIKYKAEIAGLVAAFILGALLF |
| Ga0114919_100692623 | 3300009529 | Deep Subsurface | MMIFGEAVTKANAKRIITKYKTEIAGLVIAFILGALLF* |
| Ga0129348_10494445 | 3300010296 | Freshwater To Marine Saline Gradient | MMIFGEAVTKANVKRLAIKYKAEIAGLLTAFILGALLF* |
| Ga0129348_11503862 | 3300010296 | Freshwater To Marine Saline Gradient | MMIFGEAVTKANAKRIITKYKTEIAGLVVAFILGALLF* |
| Ga0129345_12054323 | 3300010297 | Freshwater To Marine Saline Gradient | MMIFGEAVTKTNLKRLAIKYKAEIAGLVIAFILGALLF* |
| Ga0129342_10712614 | 3300010299 | Freshwater To Marine Saline Gradient | MMIFGEAITKANLKRLAIKYKAEIAALVVAFILGALLF* |
| Ga0129351_11645153 | 3300010300 | Freshwater To Marine Saline Gradient | MMIFGEAVTKANVKRLAIKYKTEIAGLLAAFILGALLF* |
| Ga0136655_10660031 | 3300010316 | Freshwater To Marine Saline Gradient | ITIYRRKTMMIFGEAITKANLKRLAIKYKAEIAGLVVAFILGALLF* |
| Ga0136655_11505591 | 3300010316 | Freshwater To Marine Saline Gradient | MMIFGEAVTKENVKRLAIKYKTEIAGLLAAFILGALLF* |
| Ga0136656_10868701 | 3300010318 | Freshwater To Marine Saline Gradient | MMIFGEAVTKENVKRLAIKYKAEIAALVVAFILGALLF* |
| Ga0129333_106695694 | 3300010354 | Freshwater To Marine Saline Gradient | MMIFGEAVTKENAKRIAIKYKAEIAGLVVAFILGALLF* |
| Ga0129333_117380833 | 3300010354 | Freshwater To Marine Saline Gradient | MMIFGEAVTKANAERIITKYKAEIVGLVVAFILGALLF* |
| Ga0129324_102860892 | 3300010368 | Freshwater To Marine Saline Gradient | MMIFGEAVTKENVKRIITKYKAEIAGLVIAFILGALLF* |
| Ga0129324_103297431 | 3300010368 | Freshwater To Marine Saline Gradient | TIMMIFGEAVTKENVKRLAIKYKTEIAGLVIAFILGALLF* |
| Ga0129324_103674412 | 3300010368 | Freshwater To Marine Saline Gradient | MMIFGETVTKANAKRIITKYKAEIVGLVVAFILGALLF* |
| Ga0129327_105430942 | 3300013010 | Freshwater To Marine Saline Gradient | MMIFGEAVTKANVKRLAIKYKAEIAGLVVAFILGALLF* |
| Ga0181552_104200701 | 3300017824 | Salt Marsh | EYITIYRRKTMMIFGEAITKANLKRLAIKYKAEIAGLVVAFILGALLF |
| Ga0181607_100577632 | 3300017950 | Salt Marsh | MMIFGEAITKENLKRLAIKYKAEIAGLLAAFILGALLF |
| Ga0181607_101622683 | 3300017950 | Salt Marsh | MMIFGEAITKANLKRLAIKYKAEIAGLVVAFILGALLF |
| Ga0181601_104130961 | 3300018041 | Salt Marsh | MMILGEAITKANLKRIAIKYKAEIAGLVVAFILGALLF |
| Ga0181553_100489568 | 3300018416 | Salt Marsh | MIIFGQPVTKANAKRLVIKYKEEIAGLIAAFILGALLF |
| Ga0181591_103043794 | 3300018424 | Salt Marsh | MMIFGEAITKENLKRLAIKYKAEIAGLVVAFILGALLF |
| Ga0181591_104424903 | 3300018424 | Salt Marsh | IMMIFGEAVTKENVKRLAIKYKAEIAGLLAAFILGALLF |
| Ga0181562_104158784 | 3300019459 | Salt Marsh | TIYRRKTMMIFGEAITKANLKRLAIKYKAEIAGLVVAFILGALLF |
| Ga0181603_103787771 | 3300020174 | Salt Marsh | MMIFGEAITKANLKRIAIKYKAEIAGLVVAFILGALLF |
| Ga0181599_13262231 | 3300020178 | Salt Marsh | MMIFGEAVTKANAKRIAMKYKAEIAGLVVAFILGALLF |
| Ga0213868_102115872 | 3300021389 | Seawater | MMIFGEAVTKENIKRLAIKYKAEIAGLVIAFILGALLF |
| Ga0222715_105404823 | 3300021960 | Estuarine Water | EYNSIYRRKTMMIFGEAVTKANAKRIITKYKAEIAGLLAAFILGALLF |
| Ga0212025_10541862 | 3300022057 | Aqueous | MMIFGEAITKTNLKRLAIKYKAEIAGLLAAFILGALLF |
| Ga0212029_10591872 | 3300022063 | Aqueous | MMIFGEAVTKENVKRLAIKYKTEIAGLLAAFILGALLF |
| Ga0212024_10167683 | 3300022065 | Aqueous | MMIFGEAVTKANAKRLVIKYKAEIAGLVVAFILGALLF |
| Ga0212024_10623531 | 3300022065 | Aqueous | MMIFGEAVTKANAKRITMKYKAEIAGLVVAFILGALLF |
| Ga0212024_10981322 | 3300022065 | Aqueous | MIFGEAVTKANAKRLITKYKTEIAGLVAAFILGALLF |
| Ga0212021_10080436 | 3300022068 | Aqueous | MMIFGEAVTKENVKRLAIKYKTEIAGLVVAFILGALLF |
| Ga0212026_10645353 | 3300022069 | Aqueous | MMIFGEAVTKANAKRLITKYKAEIAGLVIAFILGALLF |
| Ga0196903_10042416 | 3300022169 | Aqueous | MMIFGEAVTKANAKRIITKYKAEIAGLVIAFILGALLF |
| Ga0212031_10724291 | 3300022176 | Aqueous | MMIFGEAVTKANLKKLITKYKAEIAGLVIAFILGALLF |
| Ga0196899_10591581 | 3300022187 | Aqueous | MMIFGEAVTKANAKRIITKYKAEIAGLVVAFILGALLF |
| Ga0196899_11542613 | 3300022187 | Aqueous | MMIFGEAITKANLKRLVIKYKAEIAGLLAAFILGALLF |
| Ga0196905_10920923 | 3300022198 | Aqueous | MIIFGQPITKQNAKRIVLQYKAEIAGLIAAFILGALLF |
| Ga0196901_10321618 | 3300022200 | Aqueous | MIIFGQPLTKQNAKRMVLQYKAEIAGLIAAFILGALLF |
| Ga0210003_10905574 | 3300024262 | Deep Subsurface | MMIFGEAVTKANAKRIITKYKTEIAGLVVAFILGALLF |
| Ga0209986_104214282 | 3300024433 | Deep Subsurface | MIFGEAVTKANAKRIITKYKTEIAGLVIAFILGALLF |
| Ga0208303_10825493 | 3300025543 | Aqueous | MMIFGEAVTKENVKRLAIKYKTEIAGLVIAFILGALLF |
| Ga0208303_10891443 | 3300025543 | Aqueous | MMIFGEAVTKENAKRIAIKYKAEIAGLVIAFILGALLF |
| Ga0208161_10346016 | 3300025646 | Aqueous | MMIFGEAVTKANAKRIAIKYKAEIAGLVIAFILGALLF |
| Ga0208161_11466593 | 3300025646 | Aqueous | MIIFGEAVTKENVKRLAIKYKAEIAGLVIAFILGALLF |
| Ga0208160_10733091 | 3300025647 | Aqueous | YHLEYITIYRRKTMMIFGEAVTKANLKRLAIKYKAEIAGLVIAFILGALLF |
| Ga0208428_10618264 | 3300025653 | Aqueous | MMIFGEAVTKANLKRLAIKYKSEIAGLLAAFILGALLF |
| Ga0208795_10497562 | 3300025655 | Aqueous | MMIFGEAVTKANAKRLAIKYKAEIAALVVAFILGALLF |
| Ga0208898_10215883 | 3300025671 | Aqueous | MMIFGEAVTKENVKRLVIKYKAEIAGLLAAFILGALLF |
| Ga0208898_11090334 | 3300025671 | Aqueous | MMIFGEAVTKENVKKLAIKYKAEIAGLLAAFILGALLF |
| Ga0208019_10854963 | 3300025687 | Aqueous | MMIFGEAVTKANLKRLAIKYKAEIAGLVIAFILGALLF |
| Ga0208019_11367101 | 3300025687 | Aqueous | LMIIFGQPITKQNAKRIVLQYKAEIAGLIAAFILGALLF |
| Ga0208899_10338501 | 3300025759 | Aqueous | MIIFGQPITKQNAKRMVLQYKAEIAGLIAAFILGA |
| Ga0208767_10435711 | 3300025769 | Aqueous | MMIFGEAVTKANAKRLITKYKTEIAGLVAAFILGALLF |
| Ga0208767_11114453 | 3300025769 | Aqueous | MIIFGQPITKQNAKRMVLQYKAEIAGLIAAFILGALLF |
| Ga0208767_12049311 | 3300025769 | Aqueous | MIFGEAVTKANAKRLITKYKAEIAGLVVAFILGALLF |
| Ga0208427_12378643 | 3300025771 | Aqueous | LEYHSIYRRKTMMIFGEAVTKENVKRLVIKYKAEIAGLLAAFILGALLF |
| Ga0208917_10440386 | 3300025840 | Aqueous | MIFGEAVTKENVKRLVIKYKAEIAGLLAAFILGALLF |
| Ga0208645_11350562 | 3300025853 | Aqueous | MMIFGEAVTKANLKRLAIKYKTEIAGLVIAFILGALLF |
| Ga0208644_12403083 | 3300025889 | Aqueous | MIFGEAVTKANLKRLAIKYKAEIAGLLAAFILGALLF |
| Ga0208644_13108233 | 3300025889 | Aqueous | MIFGWVPSKENAKKIVIQYKAEIAGLAAAFILGALLF |
| Ga0209635_105499762 | 3300027888 | Marine Sediment | MMIFGEAITKANLKRLAIKYKAEIAGLLAAFILGALLF |
| Ga0209427_1007131010 | 3300027901 | Marine Sediment | MMIFGEAVTKANLKRLAIKYKAEIAGLLAAFILGALLF |
| Ga0209536_1012555513 | 3300027917 | Marine Sediment | MMIFGEAVTKANAKRFVIKYKAEIAGLVAAFILGALLF |
| Ga0307380_106509232 | 3300031539 | Soil | MMIFGEAVTKENVKRLAIKYKAEIAGLVVAFILGALLF |
| Ga0307378_115474582 | 3300031566 | Soil | MIFGEAVTKANAKRIITKYKTEIAGLLAAFILGALLF |
| Ga0307376_102208995 | 3300031578 | Soil | MMIFGEAVTKANAKRLVIKYKVEIAGLVVAFILGALLF |
| Ga0307376_102917793 | 3300031578 | Soil | FGEAVTKANAKRIITKYKTEIAGLLAAFILGALLF |
| Ga0307376_102975664 | 3300031578 | Soil | MMIFGEALTKANAKRIIIKYKTEIAGLVVAFILGALLF |
| Ga0307376_103869032 | 3300031578 | Soil | MMIFGEAVTKANAKRIAMKYKTEIAGLVVAFILGALLF |
| Ga0307376_104800923 | 3300031578 | Soil | MMIFGEAVTKTNVKRLAIKYKAEIAGLVIAFILGALLF |
| Ga0307376_105062642 | 3300031578 | Soil | MMIFGEAVTKANVKRLITKYKAEIAGLVVAFILGALLF |
| Ga0307376_107284704 | 3300031578 | Soil | MMIFGEAVTKENVKKLAIKYKAEIAGLVVAFILGALLF |
| Ga0307375_101253272 | 3300031669 | Soil | MMIFGEAVTKANLKRLAIKYKAEIVGLLAAFILGALLF |
| Ga0307377_102090894 | 3300031673 | Soil | MMIFGEAVTKANAKRIAIKYKTEIAGLVVAFILGALLF |
| Ga0307377_110250642 | 3300031673 | Soil | MIFGEAVTKENVKKLAIKYKAEIAGLVVAFILGALLF |
| Ga0307377_110544353 | 3300031673 | Soil | MMIFGEAVTKANAKRLITKYKAEIAGLVVAFILGALLF |
| Ga0348335_010184_3038_3151 | 3300034374 | Aqueous | MIFGEAVTKANAKRIITKYKAEIAGLVVAFILGALLF |
| Ga0348335_024482_536_649 | 3300034374 | Aqueous | MIFGEAVTKANLKRFVIKYKAEIAGLLAAFILGALLF |
| ⦗Top⦘ |