


| Basic Information | |
|---|---|
| Family ID | F067553 |
| Family Type | Metagenome |
| Number of Sequences | 125 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTTLPEGLDPTIRTREIVFEADVSLVTPFLKLATVSRGGAGHMTF |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.80 % |
| % of genes near scaffold ends (potentially truncated) | 93.60 % |
| % of genes from short scaffolds (< 2000 bps) | 89.60 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 52.80 |
| PF02627 | CMD | 4.00 |
| PF03781 | FGE-sulfatase | 1.60 |
| PF07681 | DoxX | 1.60 |
| PF02566 | OsmC | 1.60 |
| PF10048 | DUF2282 | 1.60 |
| PF01327 | Pep_deformylase | 1.60 |
| PF03401 | TctC | 0.80 |
| PF00496 | SBP_bac_5 | 0.80 |
| PF01436 | NHL | 0.80 |
| PF06508 | QueC | 0.80 |
| PF04055 | Radical_SAM | 0.80 |
| PF11412 | DsbC | 0.80 |
| PF00903 | Glyoxalase | 0.80 |
| PF01522 | Polysacc_deac_1 | 0.80 |
| PF00528 | BPD_transp_1 | 0.80 |
| PF02730 | AFOR_N | 0.80 |
| PF04909 | Amidohydro_2 | 0.80 |
| PF03453 | MoeA_N | 0.80 |
| PF11376 | DUF3179 | 0.80 |
| PF01192 | RNA_pol_Rpb6 | 0.80 |
| PF08241 | Methyltransf_11 | 0.80 |
| PF07883 | Cupin_2 | 0.80 |
| PF00202 | Aminotran_3 | 0.80 |
| PF00561 | Abhydrolase_1 | 0.80 |
| PF16925 | TetR_C_13 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 4.00 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 4.00 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 1.60 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.60 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.60 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.60 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.60 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.60 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.80 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.80 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.80 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.80 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.80 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.80 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.80 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.00 % |
| Unclassified | root | N/A | 12.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002122|C687J26623_10076062 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005332|Ga0066388_103320415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300005332|Ga0066388_105114835 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005445|Ga0070708_101442238 | Not Available | 642 | Open in IMG/M |
| 3300005450|Ga0066682_10887007 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005468|Ga0070707_100952309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300005471|Ga0070698_100008465 | All Organisms → cellular organisms → Bacteria | 11112 | Open in IMG/M |
| 3300005529|Ga0070741_10441799 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300005575|Ga0066702_10559622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 690 | Open in IMG/M |
| 3300005577|Ga0068857_101403727 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005598|Ga0066706_10374456 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005764|Ga0066903_106317155 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005764|Ga0066903_106667287 | Not Available | 601 | Open in IMG/M |
| 3300005764|Ga0066903_108793562 | Not Available | 513 | Open in IMG/M |
| 3300005981|Ga0081538_10128923 | Not Available | 1194 | Open in IMG/M |
| 3300006031|Ga0066651_10738421 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006046|Ga0066652_101223135 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006047|Ga0075024_100612104 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006049|Ga0075417_10631714 | Not Available | 546 | Open in IMG/M |
| 3300006058|Ga0075432_10376158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 608 | Open in IMG/M |
| 3300006797|Ga0066659_10816037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 773 | Open in IMG/M |
| 3300006844|Ga0075428_100357338 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300006854|Ga0075425_100539998 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300006854|Ga0075425_101380553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300006871|Ga0075434_102535464 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300007004|Ga0079218_13321238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
| 3300007076|Ga0075435_100597323 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009012|Ga0066710_104757193 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009038|Ga0099829_10296940 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300009038|Ga0099829_11609125 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009088|Ga0099830_11006977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 690 | Open in IMG/M |
| 3300009088|Ga0099830_11266836 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300009089|Ga0099828_10237007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1634 | Open in IMG/M |
| 3300009089|Ga0099828_11999388 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009090|Ga0099827_10365254 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300009143|Ga0099792_10835500 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009147|Ga0114129_13353017 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009795|Ga0105059_1045900 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009809|Ga0105089_1101256 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300009810|Ga0105088_1023613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300009817|Ga0105062_1089669 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009819|Ga0105087_1051171 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009821|Ga0105064_1118384 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009837|Ga0105058_1148579 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010029|Ga0105074_1066299 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010043|Ga0126380_11265333 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010043|Ga0126380_11986541 | Not Available | 532 | Open in IMG/M |
| 3300010043|Ga0126380_12010589 | Not Available | 529 | Open in IMG/M |
| 3300010047|Ga0126382_10477582 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010047|Ga0126382_11422667 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010358|Ga0126370_10383445 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300010359|Ga0126376_10633664 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300010359|Ga0126376_13288618 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010362|Ga0126377_10740470 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300010362|Ga0126377_11405349 | Not Available | 771 | Open in IMG/M |
| 3300010362|Ga0126377_11828583 | Not Available | 683 | Open in IMG/M |
| 3300010362|Ga0126377_12940227 | Not Available | 550 | Open in IMG/M |
| 3300010366|Ga0126379_11315217 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300011270|Ga0137391_10956602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
| 3300012189|Ga0137388_10158436 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300012189|Ga0137388_10195643 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300012189|Ga0137388_11216765 | Not Available | 691 | Open in IMG/M |
| 3300012203|Ga0137399_10724622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300012353|Ga0137367_11116773 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012355|Ga0137369_11058719 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012532|Ga0137373_10220517 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300012685|Ga0137397_11121811 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012918|Ga0137396_10034197 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300012918|Ga0137396_10222932 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300012922|Ga0137394_10205550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
| 3300012923|Ga0137359_10414085 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300012923|Ga0137359_11222508 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012929|Ga0137404_10396634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1216 | Open in IMG/M |
| 3300012948|Ga0126375_11041200 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012971|Ga0126369_10066268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3148 | Open in IMG/M |
| 3300012972|Ga0134077_10090131 | Not Available | 1177 | Open in IMG/M |
| 3300012972|Ga0134077_10586634 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012975|Ga0134110_10383726 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300014154|Ga0134075_10286249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 716 | Open in IMG/M |
| 3300014154|Ga0134075_10528501 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300014254|Ga0075312_1057893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 748 | Open in IMG/M |
| 3300014262|Ga0075301_1076225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300014873|Ga0180066_1113263 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300014881|Ga0180094_1164833 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300015241|Ga0137418_10041099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4264 | Open in IMG/M |
| 3300015241|Ga0137418_10889070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300015264|Ga0137403_10032197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5533 | Open in IMG/M |
| 3300017659|Ga0134083_10022942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2219 | Open in IMG/M |
| 3300017659|Ga0134083_10487379 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018059|Ga0184615_10327978 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300018078|Ga0184612_10626402 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300019458|Ga0187892_10216065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1011 | Open in IMG/M |
| 3300019789|Ga0137408_1373542 | All Organisms → cellular organisms → Bacteria | 4654 | Open in IMG/M |
| 3300021051|Ga0206224_1011200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 995 | Open in IMG/M |
| 3300021073|Ga0210378_10301807 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025318|Ga0209519_10702409 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025324|Ga0209640_10169813 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300025885|Ga0207653_10405786 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025910|Ga0207684_10491345 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1052 | Open in IMG/M |
| 3300026296|Ga0209235_1040010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2343 | Open in IMG/M |
| 3300026313|Ga0209761_1180935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 956 | Open in IMG/M |
| 3300026326|Ga0209801_1311062 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026328|Ga0209802_1013336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4729 | Open in IMG/M |
| 3300026523|Ga0209808_1055163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1796 | Open in IMG/M |
| 3300026550|Ga0209474_10764655 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026550|Ga0209474_10766532 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027032|Ga0209877_1018394 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027616|Ga0209106_1104268 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300027646|Ga0209466_1082081 | Not Available | 651 | Open in IMG/M |
| 3300027650|Ga0256866_1092207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 815 | Open in IMG/M |
| 3300027862|Ga0209701_10563077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 610 | Open in IMG/M |
| 3300027875|Ga0209283_10751856 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10119329 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300028536|Ga0137415_10388105 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300030006|Ga0299907_10182208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1735 | Open in IMG/M |
| 3300030006|Ga0299907_10594095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 862 | Open in IMG/M |
| 3300030620|Ga0302046_10045314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3581 | Open in IMG/M |
| 3300031548|Ga0307408_100123704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2008 | Open in IMG/M |
| 3300031720|Ga0307469_11237653 | Not Available | 707 | Open in IMG/M |
| 3300031720|Ga0307469_11842249 | Not Available | 585 | Open in IMG/M |
| 3300032005|Ga0307411_10633757 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300032005|Ga0307411_12102811 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032261|Ga0306920_100404621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2030 | Open in IMG/M |
| 3300032261|Ga0306920_100489241 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1826 | Open in IMG/M |
| 3300034178|Ga0364934_0251545 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.80% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.60% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.80% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.80% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.80% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26623_100760621 | 3300002122 | Soil | VTAAVPDGLDPRIQTREIVFEADVSVVTPFLKLATVSRGGAGHMT |
| Ga0066388_1033204153 | 3300005332 | Tropical Forest Soil | MTSGPEGLDPRIETREIVFDADVSLVTPFLKVATVSRGGSGHMTF |
| Ga0066388_1051148352 | 3300005332 | Tropical Forest Soil | MSAGPEGLDPTIQTREIVFDADVSMVTPFLKLATVSRGNAGHMTFACDEGPSLGGLG |
| Ga0070708_1014422382 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQEPEGLDPTIQTRDIAFEADVQSVTPFLKLATVSHNGAA |
| Ga0066682_108870072 | 3300005450 | Soil | VSAAPEGLNPKIETREIVFDASVDLVTPFLKLATVSRGGAGHMTFASD |
| Ga0070707_1009523093 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTPEGLDPTVRSREIVFEADVEGVTPFLKVATVHRNGAGHMTFA |
| Ga0070698_10000846511 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTVPDGLDPTIQTREIVFDADVSLVTPFLKLATVSRGGAGHMTFASDEGPT |
| Ga0070741_104417991 | 3300005529 | Surface Soil | MTTTPEGLDPQIRTREIVFEADVRGVTPFLKLATVSRNGTGHMT |
| Ga0066702_105596221 | 3300005575 | Soil | MSKIPAGLDPTITRREIVFEADVASVTPFLKVATV |
| Ga0068857_1014037271 | 3300005577 | Corn Rhizosphere | MTTEPEGLDPQIRTREIVFEADVDLVTPFLKLATVSRGGTGHMTFASDEGPNLG |
| Ga0066706_103744561 | 3300005598 | Soil | MSPEPQGLDPTITRREIVFEADVASVTPFLKIATTHRNNTGHMTFACDEGPSLG |
| Ga0066903_1063171552 | 3300005764 | Tropical Forest Soil | MAQPPEGLDPTIQRREIAFEADVQSVTPFLKLATVSLNGAAHHTFACDEGP |
| Ga0066903_1066672872 | 3300005764 | Tropical Forest Soil | MSTLPSGLDPTVQTREVVFDADVSLVTPFLKLATVSRGG |
| Ga0066903_1087935621 | 3300005764 | Tropical Forest Soil | MSMTPEGLDPSIRTREIVFEADVSSVTPFLKLATVSRGGSGHMTFACDE |
| Ga0081538_101289232 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MATAQTPEGLNPQVTSREVVFEADVKALTPMLKVATVSRQGGKDHYTFACDEGSSLGGL |
| Ga0066651_107384211 | 3300006031 | Soil | MSPDPEGLDPTITRREIVFEADVTSVTPFLKIATAHR |
| Ga0066652_1012231353 | 3300006046 | Soil | MSPDPEGLDPTITRREIVFEADVTSVTPFLKIATAHRNNTGHMTFACDEGPSL |
| Ga0075024_1006121042 | 3300006047 | Watersheds | MTTPEGLDPKIQTREIVFDADVTAVTPFLKLATVHRNGAGHMTFACDEG |
| Ga0075417_106317141 | 3300006049 | Populus Rhizosphere | MGETPEGLDPTIRTRDIVFEADVESVTPFLKLATVSHNGKAHHTFACD |
| Ga0075432_103761582 | 3300006058 | Populus Rhizosphere | VSRAPEGLDPAVQSREIVFEADVTSVTPFLKLATVSRG |
| Ga0066659_108160371 | 3300006797 | Soil | MTHVPEGLDPTIQSRDIVFEADVQSVTPFLKLATVSHNGSAHKTFAC |
| Ga0075428_1003573385 | 3300006844 | Populus Rhizosphere | VSRAPEGLDPAVQSREIVFEADVTSVTPFLKLATVSRGGSGHMSFLSDEGPNLGGLGS |
| Ga0075425_1005399984 | 3300006854 | Populus Rhizosphere | MDRVPEGLDPTVQSREITFEADVTSVTPFLKLATV |
| Ga0075425_1013805533 | 3300006854 | Populus Rhizosphere | MARVPEGLDPTIATREITFEADVTSVTPFLKVATVDRGGTGHMTFASDEGPNLGG |
| Ga0075434_1025354641 | 3300006871 | Populus Rhizosphere | MTSIPEGLNPKIETREIVFEADVNLVTPFLKLATV |
| Ga0079218_133212382 | 3300007004 | Agricultural Soil | MSPDPEGLDPSITRREIVFEADVMSVTPFLKVATASRNDSGH |
| Ga0075435_1005973233 | 3300007076 | Populus Rhizosphere | MTRDPEGLDPTVRSRDILFEADVHSVTPFLKLATVSHNGTAHKTFACDEG |
| Ga0066710_1047571932 | 3300009012 | Grasslands Soil | MATVPDGLNPRIQTREIVFDADVNLVTPFLKLATVSRGG |
| Ga0099829_102969405 | 3300009038 | Vadose Zone Soil | MPEGLDPKVQTREIVFDADVSLVTPFLKLATVSRSGAGH |
| Ga0099829_116091252 | 3300009038 | Vadose Zone Soil | MTTVPQGLDPNIQTREIVFDADVNLVTPFLKLATVSRGGSGHMTFA |
| Ga0099830_110069772 | 3300009088 | Vadose Zone Soil | MNRVPEGLDPAIAQREIVFEADVTSVTPFLKLATVSRDGKDHMSFACDE |
| Ga0099830_112668361 | 3300009088 | Vadose Zone Soil | MTTPEGLDSTIRSREIVFEADVEGVTPFLKVATVHHNGAGHMTFACDEGPSLGGQ |
| Ga0099828_102370074 | 3300009089 | Vadose Zone Soil | MNRVPEGLDPAIAQREIVFEADVTSITPFLKLATVSRDGKDHMSFACDEGPNLGGLG |
| Ga0099828_119993881 | 3300009089 | Vadose Zone Soil | MTREPEGLDPTIQSREILFEADVQSVTPFLKVATVSHNGAAHKTFACDEG |
| Ga0099827_103652541 | 3300009090 | Vadose Zone Soil | MTTVPEGLDPQIQTREIVFDADVSMVTPFLKMATVSRGGS |
| Ga0099792_108355002 | 3300009143 | Vadose Zone Soil | MATVPEGLNPKIETREIVFDADVNLVTPYLKLATVSRGDSGHMTFASDEGPNLGG |
| Ga0114129_133530171 | 3300009147 | Populus Rhizosphere | MDRVPEGLDAAVQSREITFEADVTSVTPFLKLATV |
| Ga0105059_10459001 | 3300009795 | Groundwater Sand | MTTTPEGLDPKIQTREIVFDADVSLVTPFLKLATVSRGGAVT* |
| Ga0105089_11012561 | 3300009809 | Groundwater Sand | VTTGPEGLDPKIQTREIVFDADVSLVTPFLKLATVSRGGAGHMTFASDEGPTLGG |
| Ga0105088_10236133 | 3300009810 | Groundwater Sand | MTTVPQGLDPNIQTREIVFDADVNLVTPFLKLATVSRGGTGHMTFASDEGP |
| Ga0105062_10896691 | 3300009817 | Groundwater Sand | MTTVPQGLDPNIQTREIVFDADVNLVTPFLKLATVSR |
| Ga0105087_10511713 | 3300009819 | Groundwater Sand | MTTVPQGLDPNIQTREIVFDADVNLVTPFLKLATVSRGGTGHMTFASDE |
| Ga0105064_11183841 | 3300009821 | Groundwater Sand | MTTPEGLEPTIRSREIVFEADVEGVTPFLKVATVHRNGAGHMT |
| Ga0105058_11485792 | 3300009837 | Groundwater Sand | VTTGPEGLDPKIQTREIVFDADVSLVTPFLKLATVSRGGAGHM |
| Ga0105074_10662993 | 3300010029 | Groundwater Sand | MTTVPQGLDPNIQTREIVFDADVNLVTPFLKLATVSRGGTGHMTFASDEGPNLG |
| Ga0126380_112653333 | 3300010043 | Tropical Forest Soil | MTTVPEGLDPTIVTREIVFDADVSLVTPFLKLATVSRGGQG |
| Ga0126380_119865411 | 3300010043 | Tropical Forest Soil | MAQDPEGLHPTIRTRDIVFAADVQSVTPFLKLATVSHGGTAHHTFACDEGPS |
| Ga0126380_120105891 | 3300010043 | Tropical Forest Soil | MSTLPSGLDPTVQTREIVFDADVSLVTPFLKLATVSR |
| Ga0126382_104775824 | 3300010047 | Tropical Forest Soil | MSTVPEGLDPKIQTREIVFDADVSLVTPFLKLATV |
| Ga0126382_114226673 | 3300010047 | Tropical Forest Soil | MSTLPSGLDPTVRTREIVFDADVSLVTPFLKLATVSRGGEG |
| Ga0126370_103834452 | 3300010358 | Tropical Forest Soil | MKGIDMTTAPDGLDPTIQTRQIVFEADVSLVTPFLKL |
| Ga0126376_106336643 | 3300010359 | Tropical Forest Soil | MAGEPEGLDPTIHTRDIVFEADVQSVTPFLKLATVSHNGTAHKTFAC |
| Ga0126376_132886182 | 3300010359 | Tropical Forest Soil | VNREPEGLDPTVRGREIVFEADVTSVTPFLKLATVSRGGSGHM |
| Ga0126377_107404701 | 3300010362 | Tropical Forest Soil | MATPEGLNPEIRTREMVFEADVQAVTPFLKLATVSRNGEGHMTFACDEGPSLGGLGSA |
| Ga0126377_114053492 | 3300010362 | Tropical Forest Soil | MPQLPEGLDPTIQRREIVFEADVASVTPFLKLATVSHNGAAHKTFACDEGPNLGGLGS |
| Ga0126377_118285832 | 3300010362 | Tropical Forest Soil | MAIPDGLNPRIETREIVFDADVSMVTPFLKLATVSRGGSGAMTFASDEGPSLGGLGSA |
| Ga0126377_129402271 | 3300010362 | Tropical Forest Soil | MSTLPSGLDPTVQTREIVFDADVSLVTPFLKLATVSRGG |
| Ga0126379_113152171 | 3300010366 | Tropical Forest Soil | MAGEPEGLDPTIHTRDIVFEADVQSVTPFLKLATVSHNGTAHKTFACDEGPSL |
| Ga0137391_109566022 | 3300011270 | Vadose Zone Soil | MAQEPEGLDPTIKTHEIAFEADVQSVTPFLKLATVSHNGTAHETFACDEGP |
| Ga0137388_101584365 | 3300012189 | Vadose Zone Soil | MTRDPEGLDPTIRTREILFEADFQSVTPFLKVATVSHNGAAHKTFACDEGPSLGGL |
| Ga0137388_101956436 | 3300012189 | Vadose Zone Soil | MATLPQGLDPKIQTREIVFDAEVSLVTPFLKLATVSRGG |
| Ga0137388_112167651 | 3300012189 | Vadose Zone Soil | MSQGPEGLDPTIRSREIVFEADVRSVTPFLRLATVSH |
| Ga0137399_107246221 | 3300012203 | Vadose Zone Soil | MPRLPEGLDPSITTRQITFEADVTSVTPFLKLATVSREGASPQSFACDEGPSLG |
| Ga0137367_111167732 | 3300012353 | Vadose Zone Soil | MAPGPEGLDPTIHTREIAFEADVQSVTPFLKLATVSHNGTA |
| Ga0137369_110587191 | 3300012355 | Vadose Zone Soil | MATVPDGLNPRIETREIVFDADVNLVTPFLKLATVSRGGTGHMTFASDEGPNL |
| Ga0137373_102205172 | 3300012532 | Vadose Zone Soil | MAQLPEGLDPTIQSREIVFEADVHSVTPFLKLATVSHNGTAHKTFACDEGPSLGGLG* |
| Ga0137397_111218111 | 3300012685 | Vadose Zone Soil | VREEAVMSTPEGLDPKVQTREIVFEADVEGVTPFLKLATVHLNGAGHMTFACDEGPSL |
| Ga0137396_100341972 | 3300012918 | Vadose Zone Soil | MTSVPEGLNPKIETRAIVFEADVNLVTPFLKLATVSRGGSGPMTFASDEGPSPGTGTC* |
| Ga0137396_102229321 | 3300012918 | Vadose Zone Soil | MTSVPEGLNPKIETREIVFEADVNLVTPFLKLATVSRGGSGPMTFASDEGPGPGTGTC* |
| Ga0137394_102055506 | 3300012922 | Vadose Zone Soil | VSAEPEGLNPRIETREIVFDASVDLVTPFLKLATVSRGG |
| Ga0137359_104140851 | 3300012923 | Vadose Zone Soil | MAHVPEGLDSTIQSRDIVFEADVQSVTPFLKLATVEPQWQCT* |
| Ga0137359_112225082 | 3300012923 | Vadose Zone Soil | MRREPEGLDPTIQSREILFEADVQSVTPFLKLATVSHNGAAHKTFACDE |
| Ga0137404_103966341 | 3300012929 | Vadose Zone Soil | MTTAPEGLDPTIQSREIVFDAEVDLVSPFLKLATVSRDGAGHMT |
| Ga0126375_110412001 | 3300012948 | Tropical Forest Soil | MNRVPEGLDPTIATREITFEADVTSVTPFLKVATVNRGGTGHMTFASDEGPNLGG |
| Ga0126369_100662681 | 3300012971 | Tropical Forest Soil | MKGIDMTTAPDGLDPTIQTRQIVFEADVSLVTPFLKLATVSRGGGGHMTFASDEGPNLGG |
| Ga0134077_100901312 | 3300012972 | Grasslands Soil | MSATPEGLDPSITRREIVFEADVTSVTPFLKVATVSRAGTGHMTFACDEGPNLGGLGS |
| Ga0134077_105866342 | 3300012972 | Grasslands Soil | VSAAPEGLNPKVETREIVFDASVDLVTPFLKLATVSRGGAGHMTFA |
| Ga0134110_103837261 | 3300012975 | Grasslands Soil | MTSIPEGLNPKIETCEIVFEADVNLVTPFLKLATVRRGGSGHMTFASDEGPSLGGLG |
| Ga0134075_102862493 | 3300014154 | Grasslands Soil | MTTVPQGLDPNIQTREIVFEADVNLVTPFLKLATV |
| Ga0134075_105285012 | 3300014154 | Grasslands Soil | VEVDYHAALSTLEEAIVSTHTPEGLDPTIRRREIVFEADVTSVTPFLKLATTSRGGSGHMTFACDEGPSLG |
| Ga0075312_10578933 | 3300014254 | Natural And Restored Wetlands | MTTLPEGLDPTIRTREIVFEADVSLVTPFLKLATVSRGGAGHMTF |
| Ga0075301_10762252 | 3300014262 | Natural And Restored Wetlands | MAGTPEGLDPTIRTRDILFEADVQSVTPFLKLATVSHNGKGHHTFACDEG |
| Ga0180066_11132632 | 3300014873 | Soil | MTTVPDGLDPKIQTREIVFEADVSLVTPFLKLATVSRGGAGHMTFASDE |
| Ga0180094_11648332 | 3300014881 | Soil | MTTTPEGLDPKIQTREIVFDADVNLVTPFLKLATVSRGGAGHMTFA |
| Ga0137418_100410995 | 3300015241 | Vadose Zone Soil | MTSVPEGLNPKIETREIVFEADVNLVTPFLKLATVSRGGSGPMTFASDEGPSPGTGTC* |
| Ga0137418_108890703 | 3300015241 | Vadose Zone Soil | MSVVPDGLNPKIETREIVFDASVDLVTPFLKLATVSRGG |
| Ga0137403_100321979 | 3300015264 | Vadose Zone Soil | MTTAPEGLDPTIGSREIVFDAEVDLVSPFLKLATVSRDGAGHMTFASDEGPNLGPHARR |
| Ga0134083_100229421 | 3300017659 | Grasslands Soil | MSATPEGLDPSITRREIVFEADVTSVTPFLKVATVSRAGTGHMTFACDEGPNLGGL |
| Ga0134083_104873791 | 3300017659 | Grasslands Soil | MTSIPEGLNPKIETREIVFEADVNRVTPFLKLATVSRGGSGPMTFASDEGPSL |
| Ga0184615_103279781 | 3300018059 | Groundwater Sediment | VRNDKGAATTSIPEGLDPQIKTREIVFDADVSGVTPFLKLATVSRQG |
| Ga0184612_106264022 | 3300018078 | Groundwater Sediment | MTTVPQGLDLNIQTREIVFDADVNLVTPFLKLATVSRGGTGHMTFASDEGPN |
| Ga0187892_102160653 | 3300019458 | Bio-Ooze | MTAPEGLDPTIHTREIVFDAEVDLVSPFLKLATVSRGGAGH |
| Ga0137408_13735425 | 3300019789 | Vadose Zone Soil | MSAVPEGLNPKIETREIVFDASVDLVTPFLKLATVSRGGTRAT |
| Ga0206224_10112003 | 3300021051 | Deep Subsurface Sediment | MTSVPEGLDPKVQTREIVFDADVSLATPFLKVATVSRGGAGHMTFASDEGPSLGGLG |
| Ga0210378_103018072 | 3300021073 | Groundwater Sediment | MATVPDGLNPRIEPREIVFDADVNLVTPFLKLATVSRGGSGHMTFA |
| Ga0209519_107024092 | 3300025318 | Soil | VTAAVPDGLDPRIQTREIVFEADVSVVTPFLKLATVSRGGA |
| Ga0209640_101698135 | 3300025324 | Soil | VTAAVPDGLDPRIQTRDIVFEADVSVVTPLLKLATVSRGGAGHMTFASDEGPSLGGL |
| Ga0207653_104057862 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSIPEGLNPKIETREIVFEADVNLVTPFLKLATVSRGGSGPMTFASDEGPSL |
| Ga0207684_104913451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHVPEGLDPTIQSRDIVFEADVQSVTPFLKLATVSHNGS |
| Ga0209235_10400101 | 3300026296 | Grasslands Soil | MATVPEGLNPKVETREIVFDADVSLVTPFLKLATVSRGGSGHMTFASD |
| Ga0209761_11809351 | 3300026313 | Grasslands Soil | MTTVPQGLDPNTQTREIVFEADVNLVTPFLKLATVSRGGTGHMTFAS |
| Ga0209801_13110622 | 3300026326 | Soil | MSATPEGLDPTITRREIVFEADVTSVTPFLKVATVSRAGT |
| Ga0209802_10133367 | 3300026328 | Soil | MTSIPEGLNPKIETREIVFEADVNLVTPFLKLATVSRGGSGPMT |
| Ga0209808_10551631 | 3300026523 | Soil | MATLPEGLDPTIQRREIVFEADVTSVTPFLKLATVSHNGTAHK |
| Ga0209474_107646551 | 3300026550 | Soil | MSKIPAGLDPTITRSEIVFEADVASVTPFLKVATVSRDGEGHMTF |
| Ga0209474_107665321 | 3300026550 | Soil | MTSIPEGLNPKIETREIVFEADVNLVTPFLKLATVSRGGSGPMTFA |
| Ga0209877_10183943 | 3300027032 | Groundwater Sand | MTTVPDGLDPKIQTREIVFEADVSLVTPFLKLATVSRGGAGHMTF |
| Ga0209106_11042682 | 3300027616 | Forest Soil | MTSVPEGLNPKIETREIVFEADVNLVTPFLKLATV |
| Ga0209466_10820812 | 3300027646 | Tropical Forest Soil | MAQLPEGLDPTIQRREIVFEADVASVTPFLKLATVSHNGTAH |
| Ga0256866_10922071 | 3300027650 | Soil | MPTPEGLDPSIRSREIVFEADVTGVTPFLKLATAHRN |
| Ga0209701_105630771 | 3300027862 | Vadose Zone Soil | MNRVPEGLDPAIAQREIVFEADVTSVTPFLKLATVSRDGK |
| Ga0209283_107518562 | 3300027875 | Vadose Zone Soil | MTTPEGLDPTIRSREIVFEADVRGVTPFLKVATVHRGGTGHMTFACDEGPALGGLG |
| (restricted) Ga0233417_101193291 | 3300028043 | Sediment | MAPGPEGLDPTIRTREISFEADVQSVTPFLKLATVSHNGTAHKTFACDEGPALGGLGS |
| Ga0137415_103881053 | 3300028536 | Vadose Zone Soil | MTSVPEGLNPKIETREIVFEADVNLVTPFLKLATVSRGGSGPMTFASDEGPGPGTGTC |
| Ga0299907_101822085 | 3300030006 | Soil | MPTPEGLDPSIRSREIVFEADVTGVTPFLKLATAHRNG |
| Ga0299907_105940951 | 3300030006 | Soil | MTPVPEGLDPSIHTREIVFEADVDLVTPFLKLATVSRGGRGHLTFASDEGPSLGGL |
| Ga0302046_100453147 | 3300030620 | Soil | MASVPEGLDPRIQTREIVFEADVDLVTPFLKLATVSRGGSGHMTF |
| Ga0307408_1001237041 | 3300031548 | Rhizosphere | MSRTPEGLDPGIQTREIVFEADVSLVTPFLKLATVSRGGQ |
| Ga0307469_112376531 | 3300031720 | Hardwood Forest Soil | MTQGPSGLDPTIQSREIAFEADVQSVTPFLKLATVSHNGTAHKTFACDEGPS |
| Ga0307469_118422492 | 3300031720 | Hardwood Forest Soil | MPTPEGLDPTIKTREIVFEADVSSVTPFLKLATVSRGGGGHMTFASDEGPSLGG |
| Ga0307411_106337573 | 3300032005 | Rhizosphere | MDRTPEGLDPSISSREITFEADVSAVTPFLKVAIVHRNGRGHMTFACDEGPTLGG |
| Ga0307411_121028112 | 3300032005 | Rhizosphere | MSRTPEGLDPGIQTREIVFEADVSLVTPFLKLATVSRGGQGHLTFASDE |
| Ga0306920_1004046214 | 3300032261 | Soil | MTTAPDGLDPTIQTRQIVFEADVSLVTPFLKLATVSRSGGGHM |
| Ga0306920_1004892414 | 3300032261 | Soil | MNRGTESRVPEGLDPAVQSREIPFEADVTSVTPFLKLAAVSRGGS |
| Ga0364934_0251545_524_670 | 3300034178 | Sediment | MTTVPEGLDPKIQTREIVFDADVSLVTPFLKLATVSRGGAGHMTFASDE |
| ⦗Top⦘ |