


| Basic Information | |
|---|---|
| Family ID | F067491 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MLTFAISVAIMLAVVGGSVQWAVRAERRRNLGEDGHARHH |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.40 % |
| % of genes near scaffold ends (potentially truncated) | 13.60 % |
| % of genes from short scaffolds (< 2000 bps) | 86.40 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (28.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00909 | Ammonium_transp | 60.80 |
| PF00795 | CN_hydrolase | 1.60 |
| PF13727 | CoA_binding_3 | 0.80 |
| PF04085 | MreC | 0.80 |
| PF00120 | Gln-synt_C | 0.80 |
| PF03070 | TENA_THI-4 | 0.80 |
| PF13556 | HTH_30 | 0.80 |
| PF00999 | Na_H_Exchanger | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 60.80 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.80 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 0.80 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.80 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.80 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.20 % |
| Unclassified | root | N/A | 28.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 28.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.80% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 12.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.40% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005506 | Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25407J50210_100767194 | 3300003373 | Tabebuia Heterophylla Rhizosphere | RWGGDAMLTFAIAVAIMFAVVGASVRWAARAERRRHLREEADAGHH* |
| Ga0070676_115977962 | 3300005328 | Miscanthus Rhizosphere | MLSLIVAVLIMLAVVGGSVQWAVRAQRRRNPVEEGHARDHR* |
| Ga0068867_1022869672 | 3300005459 | Miscanthus Rhizosphere | MLSLLVAVALMLAVVGGSVQWAVRAQRRRNPVEEGHARDHR* |
| Ga0068912_108387642 | 3300005506 | Soil | MLSFAISVLILIAVVGGSIQWAVRAQRRRDTQGRGHAGHH* |
| Ga0068912_108779762 | 3300005506 | Soil | MLTLAISLAVMLAVVGGAVKWAVRAERRRVLGGEGHAGDH* |
| Ga0068861_1006214204 | 3300005719 | Switchgrass Rhizosphere | MSVALMLAVVGGSMHWAVRKERRRKDSQEAANARHH* |
| Ga0081455_100795406 | 3300005937 | Tabebuia Heterophylla Rhizosphere | SGDDAMLTLVISVAIMFAVVGASVRWATHAERRRNLREEADAGHH* |
| Ga0081538_100025568 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLTFAISLVIMLVVVGASVQWAVRADRRNLEREADARDH* |
| Ga0081538_100345062 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLTFLISVAIMLAVVGGCVKWAVRAERRRNLLEEPDGRHH* |
| Ga0081538_100672772 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MLTFAIAVAIMFAVVGASVRWAARAERRRHLREEADAGHH* |
| Ga0081539_100966802 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MMSLLVAVALMLAVVTASVQWAVRAERRRNPGEEGHARDHR* |
| Ga0075421_1017346282 | 3300006845 | Populus Rhizosphere | MLSFAIALAIMLAVVGASVKWAVRAQRRRDLGEEGHASHH* |
| Ga0079217_102600482 | 3300006876 | Agricultural Soil | MLSFAISVAIMIAVVGASVQWAVRAERRRNTREEGHARHH* |
| Ga0068865_1012478731 | 3300006881 | Miscanthus Rhizosphere | SFAMSVALMLAVVGGSMHWAVRKERRRKDSQEAANARHH* |
| Ga0079215_101378562 | 3300006894 | Agricultural Soil | MLTFLASVLIMLAVVGGSLQWAVREQRRRNLREEGHARHH* |
| Ga0079216_112688671 | 3300006918 | Agricultural Soil | GAAQVIELAVAVAIMLAVVGGSVQWAVRAERRRNPREEGHARHH* |
| Ga0079218_126680602 | 3300007004 | Agricultural Soil | MLTFAISVAIMLAVVGASVQWAVRAERRRDLREDGHARHH* |
| Ga0079218_134353302 | 3300007004 | Agricultural Soil | MLSFAISVAIMLAVVYGSVQWAVRAERRRDLEEEGHARHH* |
| Ga0105245_121994661 | 3300009098 | Miscanthus Rhizosphere | MLSLIVAVLIMLAVVGGSVQWAVRAQRRRDILEEGHARDHR* |
| Ga0111538_117777212 | 3300009156 | Populus Rhizosphere | VLSFAMSVALMLAVVGGSMHWAVRKERRRKDSQEAANARHH* |
| Ga0126307_100272517 | 3300009789 | Serpentine Soil | VLSLIVSLVLMLAVVGGSVQWAVRAQRRRNPVEEGHARDHR* |
| Ga0126307_100630285 | 3300009789 | Serpentine Soil | MLSFLIAVAIMLAVVGASVQWAVRTERRRNLREDGNARDH* |
| Ga0126307_101000572 | 3300009789 | Serpentine Soil | MLTFAISVAIMLAVIGGSVQWAVRAERRRDLEEDGNARHH* |
| Ga0126307_101055792 | 3300009789 | Serpentine Soil | MLTFAISVAIMLAVVGGSVKWAVREQRRRNLLEESDAPHH* |
| Ga0126307_101928152 | 3300009789 | Serpentine Soil | MLTFAISVAIMLAVVGASVQWAVRAERRRDLREDGNARDH* |
| Ga0126307_104480364 | 3300009789 | Serpentine Soil | MLSFVIAVVIMFAVVGGAMKWAVRTERRRILMEEGHAGDH* |
| Ga0126307_106972873 | 3300009789 | Serpentine Soil | MMSFAVAVAIMLAVVGASVQWAVRAERRRNPGEEGHARDHR* |
| Ga0126307_107469762 | 3300009789 | Serpentine Soil | VLTFAISLLILAAVVGGSVQWAVRKERRRNRPEEAGHARHH* |
| Ga0126307_108214232 | 3300009789 | Serpentine Soil | MLSLLIALAIMLVVVGGAMKWAVRAERRRVLTEEGHAGDH* |
| Ga0126313_100053145 | 3300009840 | Serpentine Soil | MLTLAMSLLIMFAVAAAAAQWAQRAERRRNLGKDGHARHH* |
| Ga0126313_100214452 | 3300009840 | Serpentine Soil | MLTFAIALVIMLAVIGVSVQWAVREERRRDLGEDGNARHH* |
| Ga0126313_100402836 | 3300009840 | Serpentine Soil | MLTLVISVAIMLAVVGGSVQWAVRAQRRHNLREEPDARHH* |
| Ga0126313_103878672 | 3300009840 | Serpentine Soil | MLTFAVALAIMFAVVGASVQWAARAERRRNPGEESDARHH* |
| Ga0126313_105658212 | 3300009840 | Serpentine Soil | MLTFAISVAIMLAVVGASVQWAVRAERRRDLREDGNARDR* |
| Ga0126313_106446262 | 3300009840 | Serpentine Soil | VLSFAISLVILAAVVGGSVQWAVRAERRRNRPEEAGHARHH* |
| Ga0126313_106727262 | 3300009840 | Serpentine Soil | MLSLIVSVAILFAVVGGSVQWAVRAERRRNPREEGHARHS* |
| Ga0126313_114355272 | 3300009840 | Serpentine Soil | MLSFAIALCLMLAVVWASTQWAVRAQRRRNPGEEGHARHH* |
| Ga0126305_102981832 | 3300010036 | Serpentine Soil | MLTFAISVAIMLAVVGGSVHWAARAERRRNPSEEGHARHH* |
| Ga0126305_104171222 | 3300010036 | Serpentine Soil | MLTFAISVAIMLAVIGGSVQWAVRAERRRDLEEDGNAR |
| Ga0126305_106370062 | 3300010036 | Serpentine Soil | MLTFAISVAVMLAVVGGSVKWAVREQRRRNLLEESDAPHH* |
| Ga0126315_102797342 | 3300010038 | Serpentine Soil | MLTFAIALVIMLAVIGVSVQWAVRAERRRDLGEDGNARHH* |
| Ga0126315_106749002 | 3300010038 | Serpentine Soil | MLSFAISMLIMLAVVGGSVQWAVRKQRRQNLSEEAAHGRHH* |
| Ga0126309_100275923 | 3300010039 | Serpentine Soil | MLTFAISVAIMLAVVGGSVQWAVRAERRRNLGEDGHARHH* |
| Ga0126308_102685641 | 3300010040 | Serpentine Soil | MLTLAIAVAIMFAVVTASVQWAVRAERRRDLREDGNAGHH* |
| Ga0126308_107390832 | 3300010040 | Serpentine Soil | MLTFAISLAIMLAVVGGSVQWAVRAERRRNLREDGHARHH* |
| Ga0126308_108394513 | 3300010040 | Serpentine Soil | MLTLAIAVAIMLAVVTASVQWAVRAERRRDLREDGNAGHH* |
| Ga0126312_103486444 | 3300010041 | Serpentine Soil | MLTFAIALAIMFAVVGASVKWAVRAERRRDLGEDGNARHH* |
| Ga0126314_104390984 | 3300010042 | Serpentine Soil | MLTFAIALAIMFAVVGASVKWAVRAERRRDFGEDGNARHH* |
| Ga0126314_109835662 | 3300010042 | Serpentine Soil | MLALVIAVAIMLAVVTTSVQWAVRAERRRDLREDGHAGHH* |
| Ga0126310_103715041 | 3300010044 | Serpentine Soil | MLSFAIALCLMLPVVWASTQWAVRAQRRRNPGEEGHARHH* |
| Ga0126310_105403211 | 3300010044 | Serpentine Soil | MLTLAIAVAIMLAVVTASVQWAVRAERRRDLREDGNAGH |
| Ga0126311_102499934 | 3300010045 | Serpentine Soil | MLTLAIAVAIMFAVVTASVQWAVRAERRRDLREDGHAGHH* |
| Ga0126311_112593733 | 3300010045 | Serpentine Soil | MTSFVISLAIMLAVVGASVQWATRAERRRDLKEDGNARHH* |
| Ga0126306_100443222 | 3300010166 | Serpentine Soil | MLTFMISVAIMLTVVAASAQWAVRTERRRNPRKEPDGRHH* |
| Ga0126306_101114232 | 3300010166 | Serpentine Soil | MLTFAIALVIMLAVVGGSVQWAVRAERRRNLGEDGHARHH* |
| Ga0126306_102392642 | 3300010166 | Serpentine Soil | MLSFIVSLILMLAVVGGSMHWAVREQRRRTRPEEPHAGHH* |
| Ga0127502_110545133 | 3300011333 | Soil | VITLTVSVLIMLAVVGGSVQWAVRAERRRNPREEGHARHH* |
| Ga0136631_100699932 | 3300012043 | Polar Desert Sand | MLSFAISLAIMLAVVGGSVQWAVRTERRRNLEEDGHARHH* |
| Ga0136623_100555732 | 3300012045 | Polar Desert Sand | MLTFAISLAIMLAVVGGSVQWAVRAERRRNPGEDGHARHH* |
| Ga0136623_101132432 | 3300012045 | Polar Desert Sand | VLSFAVAVAIMLAVVGASVQWALRKQRRRTLIEEAHARNH* |
| Ga0136634_101046612 | 3300012046 | Polar Desert Sand | MLSFAIALAIMLAVVGGSVQWAVRTERRRNLEEDGHARHH* |
| Ga0136625_10675262 | 3300012091 | Polar Desert Sand | MLSFAISLAIMLAVVGGSVQWAVRAERRRNLKEDGHARHH* |
| Ga0136625_12901622 | 3300012091 | Polar Desert Sand | MLTFAISLAIMLAVVGGCVQWAVRAERRRNPGEDGHARHH* |
| Ga0136632_103720342 | 3300012093 | Polar Desert Sand | LSFAVAVIIMLAVVGASVQWALRKQRRRTLIEEAHARNH* |
| Ga0136618_100758362 | 3300012188 | Polar Desert Sand | LSFAVAVAIMLAVVGASVQWALRKQRRRTLIEEAHARNH* |
| Ga0150985_1090917922 | 3300012212 | Avena Fatua Rhizosphere | MLSLIVSVAIMLAVVGGSIQWAVRAERRRHPREEGHARHS* |
| Ga0150985_1155178112 | 3300012212 | Avena Fatua Rhizosphere | MLTFVLSLVILFAVVGGSVQWALRKERRRTVTEEGHARHH* |
| Ga0150984_1178048633 | 3300012469 | Avena Fatua Rhizosphere | VLTLVVALLIMLAVVWSSLQWAVRAERRRDLRGEGRAGDHR* |
| Ga0136630_11443812 | 3300012529 | Polar Desert Sand | MLTFAISLAIMLAVVGGSVQWAVRAERRRNLKEDGHARHH* |
| Ga0136614_105727763 | 3300012684 | Polar Desert Sand | VLSFAVAVIIMLAVVGASVQWALRKQRRRTLIEEAHARNH* |
| Ga0163163_128351092 | 3300014325 | Switchgrass Rhizosphere | MLSLLVAVALMLAVVGGSVQWAVRAERRRNLGEDGNAGNH* |
| Ga0157380_132153333 | 3300014326 | Switchgrass Rhizosphere | VLIMLAVVGGSLLWAVRKQRRLNPPEEAAHARHH* |
| Ga0180121_101113062 | 3300017695 | Polar Desert Sand | MLSFAIALAIMLAVVGGSVQGAVRTERRRNLEEDGHARHH |
| Ga0183260_101968002 | 3300017787 | Polar Desert Sand | MLSFAISLAIMLAVVGGSVQWAVRAERRRNLKEDGHARHH |
| Ga0183260_102353295 | 3300017787 | Polar Desert Sand | MLTFAISLAIMLAVVGGSVQWAVRAERRRNPGEDGHARHH |
| Ga0183260_106404832 | 3300017787 | Polar Desert Sand | MLSFAIALAIMLAVVGGSGQWAVRTERRRNLEEDGHARHH |
| Ga0136617_108879052 | 3300017789 | Polar Desert Sand | VLSFAVAVAIMLAVVGASVQWALRKQRRRTLIEEAHARNH |
| Ga0184625_100804962 | 3300018081 | Groundwater Sediment | MLTFAIAVAIMLAVVGASVQWAARAERRRNLREEPDARHH |
| Ga0190265_100486862 | 3300018422 | Soil | MMSLIVAVALMLAVLTASAQWAARTERRRNPGEEGHARDHR |
| Ga0190265_105400133 | 3300018422 | Soil | VISLLVSVAIMLAVVGGSVQWAAREQRRRNPGEEGHARHH |
| Ga0190265_105611292 | 3300018422 | Soil | MMSFAISVAIMLAVVGASVQWAVRAERRRNPREEGHARDHR |
| Ga0190265_107052672 | 3300018422 | Soil | MMSLVIAVALMLAVVGGSVQWAVRTERRRNPREEGHARDHR |
| Ga0190265_109790863 | 3300018422 | Soil | MLTFAISVAIMLAVVGGSVQWAVRAERRRELQEDGDAGHH |
| Ga0190265_111877572 | 3300018422 | Soil | MLSFAVSVAIMLAVVGGSLQWAVRAQRRRNPGEEGHARHH |
| Ga0190265_129497491 | 3300018422 | Soil | MMLSFAVSVAVMLAVVGGSLQWAVRAQRRRNPGEEGHARHH |
| Ga0190272_109209802 | 3300018429 | Soil | MMLSFAVSVAIMLAVVGGSLQWAVRAQRRRNPGEEGHARHH |
| Ga0190275_101743785 | 3300018432 | Soil | MLSFAISLAIMLAVVGGSVQWAARTSRRRNLSEDAHARDH |
| Ga0190275_103170772 | 3300018432 | Soil | MLALAISLCLMLAVLGASVQWAVRAERRRNLREDRDARHH |
| Ga0190275_104186552 | 3300018432 | Soil | MLTLAISLCLMLAVLGASVQWAVRAERRRNPREDGDARHH |
| Ga0190275_104474734 | 3300018432 | Soil | MLSFAISLAIMLAVVGGSVQWAVRTERRRNLEEDGHARDH |
| Ga0190275_106151682 | 3300018432 | Soil | MLSFAIALTIMFAVVGGSVQWAVRTERRRNLEEDGYARHH |
| Ga0190268_119830862 | 3300018466 | Soil | VLDLIVSLVIMLAVVGGSVQWAVRAERRRDLGEDGNARHH |
| Ga0190274_107262183 | 3300018476 | Soil | MLSLLVAVALMLAVVGGSVQWAVRAQRRRNPVEEGHARDHR |
| Ga0190274_110311501 | 3300018476 | Soil | RAGEDGHLMLTLAISLCLMLAVLGASVQWAVRAERRRNLREDRDARHH |
| Ga0190274_134997963 | 3300018476 | Soil | EDGQLMLSFVIAVAIMLAVVGGAMKWAVRTERRRVLMEEGHAGDH |
| Ga0190271_106600742 | 3300018481 | Soil | MLSLIVAVLIMLAVVGGSVQWAVRAQRRRDILEEGHARDHR |
| Ga0190264_105123024 | 3300019377 | Soil | VITLTVSILIMLAVVGGSVQWAVRAERRRNPREEGHAGHH |
| Ga0190264_108999253 | 3300019377 | Soil | GEDGHVMLALAISLCLMLAVLGASVQWAVRAERRRNPREDGDARHH |
| Ga0190264_123028831 | 3300019377 | Soil | AARSREGAVMLTFAISLLLMFAVVGASVRWATRAERRRNLGEDGHGRHH |
| Ga0190267_102051062 | 3300019767 | Soil | MLTLAIALAIMLTVVGGSVQWAVRAERRRNPGEDGNAGHH |
| Ga0190267_113177202 | 3300019767 | Soil | MLTLLLAVAIMFAVVTASVQWAVREERRRNLREDGHAGHH |
| Ga0193743_10972672 | 3300019889 | Soil | MLTFVIALALMFAVVGASVQWAVRAERRRNPGEESDARHH |
| Ga0193742_10685662 | 3300021976 | Soil | MLTFAISLAIMIAVVGASVQWAVRAERRRNPGEESDARHH |
| Ga0207706_102182542 | 3300025933 | Corn Rhizosphere | MLSLLVTVALMLAVVGGSVQWAVRAQRRRNPVEEGHARDHR |
| Ga0207675_1013642983 | 3300026118 | Switchgrass Rhizosphere | MLSFAVAVIIMLAVVGGSVQWAVRAQRRRDILEEGHARDHR |
| Ga0209485_12390033 | 3300027691 | Agricultural Soil | GAAQVIELAVAVAIMLAVVGGSVQWAVRAERRRNPREEGHARHH |
| Ga0209382_121949382 | 3300027909 | Populus Rhizosphere | MLSFAIALAIMLAVVGASVKWAVRAQRRRDLGEEGHASHH |
| Ga0247821_100566091 | 3300028596 | Soil | MLALAISLCLMLAVVGASVQWAVRAERRRNLREDGDARHH |
| Ga0247821_101941552 | 3300028596 | Soil | MLSLIVAVLIMLAVVGGSVPWAVRAQRRRDILEEGHARDHR |
| Ga0247821_110656802 | 3300028596 | Soil | MLTFAISVLIMLAVVGGSLLWAVRKQRRLNPSEEAAHARHH |
| Ga0247825_108355643 | 3300028812 | Soil | VVGGDDHGGAAVMLSLLVAVALMLAVVGGSVQWAVRAQRRRNPVEEGHARDHR |
| Ga0247825_110584982 | 3300028812 | Soil | MLALAISLCLMLAVVGASVQWAVRAERRRNPREDGDARHH |
| Ga0307302_106914742 | 3300028814 | Soil | MLTLALSVAIMFAVVWASVQWAVRAERRRNYREGSDARHH |
| Ga0247826_108941402 | 3300030336 | Soil | MLTLAIAVAIMLAVVTASVQWAVRAERRREIGEDGNAGHH |
| Ga0307408_1001405682 | 3300031548 | Rhizosphere | MLTFAISVAIMLAVIGGSVQWAVRAERRRDLEEDGNARHH |
| Ga0307413_112183862 | 3300031824 | Rhizosphere | MLSLVVAIVIMLAVVGGSVQWAVRAERRRNPREEGHARHH |
| Ga0307413_117886011 | 3300031824 | Rhizosphere | MLTFAIALVIMLAVVGGSVQWAVRAERRRELEEGGDARDH |
| Ga0307410_109794241 | 3300031852 | Rhizosphere | MLSFAIALCLMLAVVWASTQWAVRAQRRRTPGEEGHARHH |
| Ga0307407_108375014 | 3300031903 | Rhizosphere | AAQVITLTVSVLIMLAVVGGSVQWAVRAERRRNPREEGHARHH |
| Ga0307409_1006873721 | 3300031995 | Rhizosphere | EDGYVMLSFAIALCLMLAVVWASTQWAVRAQRRRNPGEEGHARHH |
| Ga0307414_113616142 | 3300032004 | Rhizosphere | MLTLVISVAIMLAVVGGSVQWAVRAQRRHNLREEPDARHH |
| Ga0307411_121166102 | 3300032005 | Rhizosphere | VITLTVSVLIMLAVVGGSVQWAVRAERRRNPREEGHARHS |
| Ga0247830_115801421 | 3300033551 | Soil | VLTFAIALAIMFAVVGASVQWAARAERRRNLREEPDARHH |
| Ga0334962_033652_60_182 | 3300034144 | Sub-Biocrust Soil | VLTLAISISIMLAVVGGSVQWAVRAERRRNPREDGNARHH |
| Ga0334913_091781_492_614 | 3300034172 | Sub-Biocrust Soil | MLSFAIAVTIMLAVVGASVQWAVRAERRRNLREDGNARDH |
| ⦗Top⦘ |