


| Basic Information | |
|---|---|
| Family ID | F067484 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PVVSEDNIEKIRNRLAVAPPGTPFKMNVLRAGKVIELTGTTQ |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.60 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 86.40 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.600 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.200 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 22.86% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00487 | FA_desaturase | 6.40 |
| PF00497 | SBP_bac_3 | 3.20 |
| PF13091 | PLDc_2 | 3.20 |
| PF00923 | TAL_FSA | 3.20 |
| PF04397 | LytTR | 3.20 |
| PF04392 | ABC_sub_bind | 2.40 |
| PF02743 | dCache_1 | 2.40 |
| PF01982 | CTP-dep_RFKase | 2.40 |
| PF01266 | DAO | 2.40 |
| PF02699 | YajC | 1.60 |
| PF01850 | PIN | 1.60 |
| PF00296 | Bac_luciferase | 1.60 |
| PF02310 | B12-binding | 1.60 |
| PF08240 | ADH_N | 1.60 |
| PF00884 | Sulfatase | 1.60 |
| PF13378 | MR_MLE_C | 1.60 |
| PF07885 | Ion_trans_2 | 1.60 |
| PF01925 | TauE | 0.80 |
| PF00072 | Response_reg | 0.80 |
| PF13191 | AAA_16 | 0.80 |
| PF00106 | adh_short | 0.80 |
| PF00196 | GerE | 0.80 |
| PF00873 | ACR_tran | 0.80 |
| PF00034 | Cytochrom_C | 0.80 |
| PF02775 | TPP_enzyme_C | 0.80 |
| PF13387 | DUF4105 | 0.80 |
| PF07992 | Pyr_redox_2 | 0.80 |
| PF04333 | MlaA | 0.80 |
| PF11249 | DUF3047 | 0.80 |
| PF05163 | DinB | 0.80 |
| PF02673 | BacA | 0.80 |
| PF04989 | CmcI | 0.80 |
| PF00675 | Peptidase_M16 | 0.80 |
| PF01594 | AI-2E_transport | 0.80 |
| PF13436 | Gly-zipper_OmpA | 0.80 |
| PF02932 | Neur_chan_memb | 0.80 |
| PF10282 | Lactonase | 0.80 |
| PF13683 | rve_3 | 0.80 |
| PF00484 | Pro_CA | 0.80 |
| PF02746 | MR_MLE_N | 0.80 |
| PF06863 | DUF1254 | 0.80 |
| PF13231 | PMT_2 | 0.80 |
| PF13193 | AMP-binding_C | 0.80 |
| PF12867 | DinB_2 | 0.80 |
| PF00089 | Trypsin | 0.80 |
| PF02515 | CoA_transf_3 | 0.80 |
| PF05425 | CopD | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 6.40 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 6.40 |
| COG1339 | Archaeal CTP-dependent riboflavin kinase | Coenzyme transport and metabolism [H] | 4.80 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 3.20 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 2.40 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.40 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 1.60 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.60 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.60 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.80 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.80 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.80 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.80 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.80 |
| COG2853 | Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 0.80 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.60 % |
| Unclassified | root | N/A | 6.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105574924 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1023 | Open in IMG/M |
| 3300000789|JGI1027J11758_12684523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 650 | Open in IMG/M |
| 3300002560|JGI25383J37093_10013603 | All Organisms → cellular organisms → Bacteria | 2692 | Open in IMG/M |
| 3300002561|JGI25384J37096_10069307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1298 | Open in IMG/M |
| 3300004157|Ga0062590_100620602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
| 3300004268|Ga0066398_10059925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300004480|Ga0062592_100991708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
| 3300005332|Ga0066388_101008361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1396 | Open in IMG/M |
| 3300005434|Ga0070709_10231788 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300005440|Ga0070705_100073884 | Not Available | 2070 | Open in IMG/M |
| 3300005441|Ga0070700_100717018 | Not Available | 797 | Open in IMG/M |
| 3300005451|Ga0066681_10599086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300005467|Ga0070706_101765168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| 3300005518|Ga0070699_101234026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 686 | Open in IMG/M |
| 3300005536|Ga0070697_100005506 | All Organisms → cellular organisms → Bacteria | 9762 | Open in IMG/M |
| 3300005536|Ga0070697_100616088 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005586|Ga0066691_10855445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300005764|Ga0066903_106043139 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005764|Ga0066903_107427447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 566 | Open in IMG/M |
| 3300005764|Ga0066903_108404450 | Not Available | 527 | Open in IMG/M |
| 3300005841|Ga0068863_100116436 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300006032|Ga0066696_10731218 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300006854|Ga0075425_100033927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5677 | Open in IMG/M |
| 3300006969|Ga0075419_10022894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3865 | Open in IMG/M |
| 3300007076|Ga0075435_101371344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300007255|Ga0099791_10059717 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300007255|Ga0099791_10493136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300009089|Ga0099828_11751637 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300009094|Ga0111539_11352121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 826 | Open in IMG/M |
| 3300009100|Ga0075418_12369538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300009147|Ga0114129_10351975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1951 | Open in IMG/M |
| 3300009553|Ga0105249_13259179 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009792|Ga0126374_11279520 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010043|Ga0126380_10731079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 800 | Open in IMG/M |
| 3300010046|Ga0126384_10083941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2304 | Open in IMG/M |
| 3300010046|Ga0126384_10395269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1166 | Open in IMG/M |
| 3300010304|Ga0134088_10367650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 699 | Open in IMG/M |
| 3300010304|Ga0134088_10610825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 543 | Open in IMG/M |
| 3300010322|Ga0134084_10245064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 645 | Open in IMG/M |
| 3300010323|Ga0134086_10444072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 528 | Open in IMG/M |
| 3300010323|Ga0134086_10477114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
| 3300010336|Ga0134071_10085773 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300010336|Ga0134071_10171713 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300010359|Ga0126376_11074199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 811 | Open in IMG/M |
| 3300010359|Ga0126376_12837239 | Not Available | 534 | Open in IMG/M |
| 3300010362|Ga0126377_11532518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300010397|Ga0134124_10793177 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300010398|Ga0126383_10324626 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300010398|Ga0126383_13286691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300010401|Ga0134121_11954860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
| 3300011269|Ga0137392_10438011 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300012360|Ga0137375_11040025 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
| 3300012362|Ga0137361_10861931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 822 | Open in IMG/M |
| 3300012373|Ga0134042_1090317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
| 3300012582|Ga0137358_10698593 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012675|Ga0137337_1051329 | Not Available | 647 | Open in IMG/M |
| 3300012685|Ga0137397_10084191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2316 | Open in IMG/M |
| 3300012907|Ga0157283_10329685 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012916|Ga0157310_10229448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300012930|Ga0137407_10491755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1145 | Open in IMG/M |
| 3300012930|Ga0137407_10699170 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
| 3300012948|Ga0126375_10102369 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1700 | Open in IMG/M |
| 3300012948|Ga0126375_11209677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15 | 629 | Open in IMG/M |
| 3300012948|Ga0126375_11775747 | Not Available | 537 | Open in IMG/M |
| 3300012976|Ga0134076_10109299 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300014318|Ga0075351_1026140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300014968|Ga0157379_11509498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300015371|Ga0132258_11059669 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300015373|Ga0132257_103887158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300015374|Ga0132255_100862518 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300016319|Ga0182033_11816239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300016445|Ga0182038_11979915 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300017939|Ga0187775_10163274 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300018082|Ga0184639_10653569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
| 3300018469|Ga0190270_12734237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300019997|Ga0193711_1029985 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 682 | Open in IMG/M |
| 3300020150|Ga0187768_1014719 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300020170|Ga0179594_10310453 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 597 | Open in IMG/M |
| 3300021432|Ga0210384_10062144 | All Organisms → cellular organisms → Bacteria | 3373 | Open in IMG/M |
| 3300021560|Ga0126371_10887274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1036 | Open in IMG/M |
| 3300025910|Ga0207684_10004737 | All Organisms → cellular organisms → Bacteria | 12757 | Open in IMG/M |
| 3300025910|Ga0207684_10912950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300025922|Ga0207646_10265817 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300026088|Ga0207641_12524134 | Not Available | 512 | Open in IMG/M |
| 3300026089|Ga0207648_11106568 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300026296|Ga0209235_1016003 | All Organisms → cellular organisms → Bacteria | 4082 | Open in IMG/M |
| 3300026313|Ga0209761_1270617 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 621 | Open in IMG/M |
| 3300026369|Ga0257152_1001404 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300026469|Ga0257169_1057678 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300026515|Ga0257158_1004930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
| 3300026524|Ga0209690_1151993 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 846 | Open in IMG/M |
| 3300026536|Ga0209058_1322068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 533 | Open in IMG/M |
| 3300026547|Ga0209156_10119857 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300027395|Ga0209996_1004042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1859 | Open in IMG/M |
| 3300027617|Ga0210002_1031679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
| 3300027671|Ga0209588_1194133 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027846|Ga0209180_10225276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1080 | Open in IMG/M |
| 3300027846|Ga0209180_10797958 | Not Available | 506 | Open in IMG/M |
| 3300027907|Ga0207428_10056939 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
| 3300028381|Ga0268264_11963882 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300030006|Ga0299907_10791130 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031640|Ga0318555_10165677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1186 | Open in IMG/M |
| 3300031679|Ga0318561_10479678 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031720|Ga0307469_10080252 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300031720|Ga0307469_10261350 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300031720|Ga0307469_10612321 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300031720|Ga0307469_11879986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300031740|Ga0307468_101072031 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031764|Ga0318535_10097254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1286 | Open in IMG/M |
| 3300031770|Ga0318521_10430325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 789 | Open in IMG/M |
| 3300031781|Ga0318547_10043356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2387 | Open in IMG/M |
| 3300031781|Ga0318547_10444929 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 798 | Open in IMG/M |
| 3300031820|Ga0307473_10814034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 667 | Open in IMG/M |
| 3300031892|Ga0310893_10327413 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032174|Ga0307470_10181545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300032174|Ga0307470_10323279 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300032174|Ga0307470_11535521 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032180|Ga0307471_100313061 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300032180|Ga0307471_101286549 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300032180|Ga0307471_104331691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300032205|Ga0307472_100784615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 868 | Open in IMG/M |
| 3300032401|Ga0315275_10181229 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
| 3300033004|Ga0335084_12431241 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300033502|Ga0326731_1058374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
| 3300034147|Ga0364925_0327615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 575 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.20% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.60% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.60% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.80% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.80% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1055749241 | 3300000364 | Soil | ILSVDGIPVVSEDNIEKIRDKLAALSRGTPFKMNVLRDGRVIDLTGVTE* |
| JGI1027J11758_126845231 | 3300000789 | Soil | IEKIRDKLAALSRGTPFKMNVLRDGRVIDLTGVTE* |
| JGI25383J37093_100136031 | 3300002560 | Grasslands Soil | VSEDNIEKIRNRLAGAPLGTPFKMSVLRAGKVIELTGTTQ* |
| JGI25384J37096_100693071 | 3300002561 | Grasslands Soil | SVDGIPVVSEDNIEKIRNMLASAPLGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0062590_1006206022 | 3300004157 | Soil | LSEDNIEKIRNTLAARTPGSSFKMSVLRAGKVIELTGTR* |
| Ga0066398_100599252 | 3300004268 | Tropical Forest Soil | IPVVSEDNIEKIRNKLAGAPVGTPFKASVLRAGKVIELSGTSQ* |
| Ga0062592_1009917081 | 3300004480 | Soil | LSVDDIPVVSEDNIEQIRNKLAGVPRGTPFTMNVLRAGKILVLTGRTQGASR* |
| Ga0066388_1010083612 | 3300005332 | Tropical Forest Soil | SVAGIPVESEDNIEKIRNALVGVSPGASFTMKVLRGGKVIELTGKAQ* |
| Ga0070709_102317883 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSEENIEKIRNQLADAAPGTPFKMSVLRAGKVIELTGTTQ* |
| Ga0070705_1000738844 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IILSVDDIPVVSEDNIEQIRNKLAGVPRGTPFKMNVLRAGKVLVLTGTTEGASR* |
| Ga0070700_1007170181 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSEDNIEQIRNKLAGVPRGTPFKMNVLRAGKILVLTGTTQGASR* |
| Ga0066681_105990862 | 3300005451 | Soil | GIPVVSEDNIEKIRNRLAGAPLGTPFKMNVLRAGKVVELTGTTQ* |
| Ga0070706_1017651681 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVSEDNIEKIRNRLAAAPLGIPFKMNVLRAGKVIELTGTSQ* |
| Ga0070699_1012340261 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ALGGDVILSVDGIPVVSEDNIEKIRNRLAGAPLGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0070697_10000550610 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEENIEKIRNTLATLASVAPGAAVKMNVLRAGKIIELTGTSR* |
| Ga0070697_1006160882 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NIEKIRNKLASVPGGTPFTISVLRAGKVIELAGKTKGSVVDF* |
| Ga0066691_108554452 | 3300005586 | Soil | NIEKIRNRLAGAPLGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0066903_1060431392 | 3300005764 | Tropical Forest Soil | SEDNIEKIRNRLAGAAPGTPFKMNVLRAGKVIALQGAAQ* |
| Ga0066903_1074274472 | 3300005764 | Tropical Forest Soil | DGIPVVSEDNIEKIRSKLAGAPAGTPFKVSVLRAGKVIELTGTAQ* |
| Ga0066903_1084044501 | 3300005764 | Tropical Forest Soil | ILSVEGISAVSEDNIEKIREKLAKAPVGTPFSMTVLRGGKVLELKGSSQ* |
| Ga0068863_1001164363 | 3300005841 | Switchgrass Rhizosphere | ILSVQGIPIVSEENIEKVRNTLAEVAPGTPIRMHVLRGGKIIELTGTAQ* |
| Ga0066696_107312181 | 3300006032 | Soil | GREMALGGDIIRSVDGIPVVSEDNIEKIRNRLAGAPLGTPFKMSVLRAGKVIELTGTTQ* |
| Ga0075425_1000339271 | 3300006854 | Populus Rhizosphere | DIILSVDDIPVVSEENIEKIRNKLAGATPGARFKMSVLRAGKVIELTGPSQ* |
| Ga0075419_100228948 | 3300006969 | Populus Rhizosphere | VSEDNIEKIRNALAGVAPGAEFKMSVLRAGKVIELTGTAD* |
| Ga0075435_1013713442 | 3300007076 | Populus Rhizosphere | VVSEENIEKIRNTLAGLPPGAPFKMNVLRAGKVIELAGTSQ* |
| Ga0099791_100597171 | 3300007255 | Vadose Zone Soil | DIILSVGGIPVVSEDNIEQIRNRLAGTPLGTPFKLNVLRAGKVIELTGTTQ* |
| Ga0099791_104931361 | 3300007255 | Vadose Zone Soil | PVGGDIIISVEDIPVVSEENIEKIRNKLAGSAPGSTFKMIVLRAGKVLELTGTSQ* |
| Ga0099828_117516371 | 3300009089 | Vadose Zone Soil | GDIILSVDGIPVVSEDNIEKIRNRLAGAPPGTPLKMKVLRAGKVIELTSTTQ* |
| Ga0111539_113521211 | 3300009094 | Populus Rhizosphere | VVSEDNIEKIRNYLAATPPGTMFKMTVLRAGRILELTGTTSQIRGD* |
| Ga0075418_123695382 | 3300009100 | Populus Rhizosphere | EDNIEQIRNRLPSIAPGAAFKMSVLRAGKVIELTGSAE* |
| Ga0114129_103519753 | 3300009147 | Populus Rhizosphere | EENIEKIRNTLAGLPPGAPFKMNVLRAGKVIELAGTSQ* |
| Ga0105249_132591792 | 3300009553 | Switchgrass Rhizosphere | NKLAGVPRGTPFKMNVLRAGKILVLTGTTQGASR* |
| Ga0126374_112795202 | 3300009792 | Tropical Forest Soil | VSEDNIEKIRTRLAAAPAGTPFKVSVLRAGKVLELAGTSP* |
| Ga0126380_107310792 | 3300010043 | Tropical Forest Soil | EENIEKIRNKLAALPPGTPFKIGVLRAGKLIELAGVAQ* |
| Ga0126384_100839413 | 3300010046 | Tropical Forest Soil | DIILSVDGIPVVSEDNIEKIRNKLAGAPVGTPFKASVLRAGKVIELSGTSQ* |
| Ga0126384_103952693 | 3300010046 | Tropical Forest Soil | DIILSVDGIPVVSEDNIEKIRNKLAGAPVGTPFKVSVLRAGKVIELTGTTQ* |
| Ga0134088_103676501 | 3300010304 | Grasslands Soil | IALGGDIILSVDGIPVVSEDNIEKIRNRLASAPLGTPFKMSVLRAGKVIELTGTPQ* |
| Ga0134088_106108252 | 3300010304 | Grasslands Soil | VVSEDNIEKIRNQLAAVPRGTPFKMNVLRDGRVIDLTGVTE* |
| Ga0134084_102450643 | 3300010322 | Grasslands Soil | ALGGDIILSVDGIPVVSEDNIEKIRNRLAVAPSGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0134086_104440722 | 3300010323 | Grasslands Soil | ILSVDGIPVVSEDNIEKIRNRLAGAPLGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0134086_104771142 | 3300010323 | Grasslands Soil | LSVDGIPVVSEDNIEKIRNRLAGAPLGTPFKMSVLRAGKVIELTGTTQ* |
| Ga0134071_100857734 | 3300010336 | Grasslands Soil | PVVSEDNIEKIRNRLAVAPPGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0134071_101717132 | 3300010336 | Grasslands Soil | LSVDGIPVVSEDNIEKIRNRLAGAPLGALFKMNVLRAGKVIELTSTAQ* |
| Ga0126376_110741993 | 3300010359 | Tropical Forest Soil | IPVVSEDNIEKIRNKLAGAPAGTPFKVSVLRAGKVIELTGTAQ* |
| Ga0126376_128372391 | 3300010359 | Tropical Forest Soil | IEKIRSRLAEIPVGTPFKMAVLRAGKVVELTGTAQ* |
| Ga0126377_115325182 | 3300010362 | Tropical Forest Soil | EQIRNRLAAVTPGAPIKMSVLRAGKVIELTGTSQ* |
| Ga0134124_107931771 | 3300010397 | Terrestrial Soil | GGDIILSIDDIPVVSEDNIEQIRNKLAGVPRGTPFKMNVLRAGKILVLTGTTQGASR* |
| Ga0126383_103246263 | 3300010398 | Tropical Forest Soil | DDIPVVSEDNIEQIRNKLARAPVGTPFKVTVLRAGKIIELSGTTP* |
| Ga0126383_132866911 | 3300010398 | Tropical Forest Soil | ILTVSGIPIVSEDNIEKVRTTLAAAPPGSPFKMTVLRGGKVIELTGTAQ* |
| Ga0134121_119548601 | 3300010401 | Terrestrial Soil | ILSVDDIPVVSEDNIEQIRNKLAGVPRGTPFKMSVLRAGKALVLTGTTQGASR* |
| Ga0137392_104380111 | 3300011269 | Vadose Zone Soil | DNIEKIRNRLASAPLGTPFKMSVLRAGKVIELTGTTQ* |
| Ga0137375_110400251 | 3300012360 | Vadose Zone Soil | LSVEDIPVVSEDNIEKIRKRLAAAPLGTPFKMNVLRAGKIIELTGTSQ* |
| Ga0137361_108619312 | 3300012362 | Vadose Zone Soil | IPVVSEDNIEKIRNRLAGAPLGTPFKMNVLRAGKVIELTGTTE* |
| Ga0134042_10903173 | 3300012373 | Grasslands Soil | VDGIPVVSEDNIEKIRNRLAVAPPGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0137358_106985933 | 3300012582 | Vadose Zone Soil | VVSEESIEKIRNRLGGAAPRSTIKMSVLRARKLIELTGTSQ* |
| Ga0137337_10513291 | 3300012675 | Soil | NIEKIRNRLAAAPPGTPFKVTALRAGKVVELTGKAQQ* |
| Ga0137397_100841914 | 3300012685 | Vadose Zone Soil | LSVDGSPVVSEDNIEQIRNRLASGAPGAPFKMSVLRAGKVIDLSGTME* |
| Ga0157283_103296852 | 3300012907 | Soil | SVDDIPVVSEENIEQIRNNLAGVPRGTPFKMNVLRAGKVLVLTGTTQGASR* |
| Ga0157310_102294481 | 3300012916 | Soil | LSVDGIPVLSEDNIEKIRNTLAARAPGSSFKMSVLRAGKVIELTGTR* |
| Ga0137407_104917551 | 3300012930 | Vadose Zone Soil | LSVEDIPVVSEENIEKIRNTLADVAPGTPVKMNVLRAGKVIELTGTSR* |
| Ga0137407_106991702 | 3300012930 | Vadose Zone Soil | PVVSEENIEKIRNKLAGSAPGSRFKMIVLRAGKVLELTGTSQ* |
| Ga0126375_101023691 | 3300012948 | Tropical Forest Soil | GDVILSVEGIPVVSEENIEKIRNKLAGLPPGTPFKISVLRAGKLIELAGVAQ* |
| Ga0126375_112096773 | 3300012948 | Tropical Forest Soil | SEENIEKIRNKLAGAPPGTPFKVSVLRAGKIIELTGTSQ* |
| Ga0126375_117757471 | 3300012948 | Tropical Forest Soil | EKVRTTLAAAPPGSPFKMTVLRGGKVIELTGTAQ* |
| Ga0134076_101092991 | 3300012976 | Grasslands Soil | EKIRNRLAVAPPGTPFKMNVLRAGKVIELTGTTQ* |
| Ga0075351_10261403 | 3300014318 | Natural And Restored Wetlands | AGGDIILSVDGIPLVSEDHIEQVRNRLAAAPPGTPFKMSVLRGGKLIELAGTAP* |
| Ga0157379_115094981 | 3300014968 | Switchgrass Rhizosphere | QGIPIVSEENIEKVRNTLAEVAPGTPIRMHVLRGGKIIELTGTAQ* |
| Ga0132258_110596691 | 3300015371 | Arabidopsis Rhizosphere | SVDGIPVMSEDNIEKIRNRLVDMPLGTPFKMNVLRTGKIIELTGTTQ* |
| Ga0132257_1038871582 | 3300015373 | Arabidopsis Rhizosphere | GGDIILSVDDIPVVSEESIEKIRNKLAAPRSTIKMSVLRAGKVIELAGTNQ* |
| Ga0132255_1008625183 | 3300015374 | Arabidopsis Rhizosphere | IDDIPVVSEDNIEQIRNKLAGVPRGTPFKMNVLRAGKVLVLTGTTQGASR* |
| Ga0182033_118162392 | 3300016319 | Soil | VSEDNIEKIRNTLVGVPPGGSFTMKVLRAGKVIELTGKAQ |
| Ga0182038_119799151 | 3300016445 | Soil | GDIILSVDGIPVTSEDNIEKIRTRLASAPLGTPFKMNVLRAGKVIELTGTSQ |
| Ga0187775_101632741 | 3300017939 | Tropical Peatland | NIEKIRNTLAAVPVGKPFKVSVLRAGKLIELTGTAE |
| Ga0184639_106535691 | 3300018082 | Groundwater Sediment | NIEKIRNRLAAEPPGSTFKMKVLRAGKVIELTGRTQ |
| Ga0190270_127342372 | 3300018469 | Soil | VVSEENIEKIRNRLAGGAPGTPFKMSVLRAGRVIDLTGQLQ |
| Ga0193711_10299851 | 3300019997 | Soil | KEVALGGDIILSVEDIPVVSEDDIEQIRNRLAGGAPGAPFKLSVLRAGKILELTGTSR |
| Ga0187768_10147193 | 3300020150 | Tropical Peatland | LGGDIILSVDGIPVRSEDDIEKVRVKLATTPTGTPFKMSVLRAGKIVELTGTSP |
| Ga0179594_103104531 | 3300020170 | Vadose Zone Soil | DNIEKIRNRLAVAPPGTPFKMNVLRAGKVIELTGTTQ |
| Ga0210384_100621444 | 3300021432 | Soil | DIILSVEDIPVVSEENIEKIRNVLAGLAPGAAFKMSVLRAGKIIELTGTSH |
| Ga0126371_108872742 | 3300021560 | Tropical Forest Soil | SEDNIEKIRAKLASPPLGSPFKVTVLRAGKVVELTGTTP |
| Ga0207684_100047372 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEENIEKVRNTLATLASVAPGAAVKMNVLRAGKIIELTGTSR |
| Ga0207684_109129502 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IALGGDIILSVDGIPVVSEDNIEQIRNRLAGVPRGTPFKMEVLRAGKIIMLTGTTQGAK |
| Ga0207646_102658173 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EENIEKIRNQPADAAPGTPFKMSVLRAGKVIELTGTTQ |
| Ga0207641_125241341 | 3300026088 | Switchgrass Rhizosphere | GKEIPVGGDIILSDQGIPIVSEENIEKVRNTLAEVAPGTPIRMHVLRGGKIIELTGTAQ |
| Ga0207648_111065683 | 3300026089 | Miscanthus Rhizosphere | PVVSEANIEKIRNRLAGVAPGASFKMTVLRSGKIIVLTGTSD |
| Ga0209235_10160031 | 3300026296 | Grasslands Soil | REMALGGDIILSVDGIPVVSEDNIEKIRNRLAGAPLGTPFKMSVLRAGKVIELTGTTQ |
| Ga0209761_12706171 | 3300026313 | Grasslands Soil | EDNIEKIRNRLASAPLGTPFKMSVLRAGKVIELTGTPQ |
| Ga0257152_10014044 | 3300026369 | Soil | GDIILSVDGIPVVSEDNIEQIRNRLASGAPGAPFKMSVLRAGKVIDLSGTME |
| Ga0257169_10576782 | 3300026469 | Soil | VDGIPVVSEDNIEQIRNRLASGAPGAPFKMSVLRAGKVIDLSGTME |
| Ga0257158_10049304 | 3300026515 | Soil | EDISVVSEENIEKIRNMLAGLATGAPFKMSVLRAGKVIELTGTSQ |
| Ga0209690_11519932 | 3300026524 | Soil | VDGIPVVSEDNIEKIRNRLAVAPPGTPFKMNVLRAGKVIELTGTTQ |
| Ga0209058_13220682 | 3300026536 | Soil | VDGIPVVSEDNIEKIRNRLASAPLGTPFKMSVLRAGKVIELTGTPQ |
| Ga0209156_101198572 | 3300026547 | Soil | LGGDIILSVDGIPVVSEDNIEKIRNRLAGAPLGTPFKMNVLRAGKVIELTGTTQ |
| Ga0209996_10040422 | 3300027395 | Arabidopsis Thaliana Rhizosphere | PVGGDIILSVEDIPVVSEENIEKIRNTLAAVTPGAPFKMNVLRAGKVIELTGTSQ |
| Ga0210002_10316792 | 3300027617 | Arabidopsis Thaliana Rhizosphere | SEENIEKIRNTLAARTPGSSFKMSVLRAGKVIELTGTR |
| Ga0209588_11941331 | 3300027671 | Vadose Zone Soil | GIPVVSEDNIEQIRNRLASGAPGAPFKMSVLRADKVIDLSGTME |
| Ga0209180_102252763 | 3300027846 | Vadose Zone Soil | IPVVSEDNIERIRNTLVGVAPGAPFKMNVLRAGKVIELTGTSQ |
| Ga0209180_107979581 | 3300027846 | Vadose Zone Soil | IEKIRNRLAGAPPGAPFKMSVLRAGRIIELTSTTQ |
| Ga0207428_100569396 | 3300027907 | Populus Rhizosphere | SESNIEKIRNRLAGVAPGASFKMSVLRAGKVIQLTGTSD |
| Ga0268264_119638821 | 3300028381 | Switchgrass Rhizosphere | NIEQIRNKLAGVPRGTPFKMNVLRAGKVLVLTGTTQGASR |
| Ga0299907_107911302 | 3300030006 | Soil | VSEDNIEKIRNRLAGAAPGAPFKMNVLLAGRVIELTGTSQ |
| Ga0318555_101656771 | 3300031640 | Soil | IEKIRNKLASVPAGTPFKISVLRGGKVIELAGKTKGELVKF |
| Ga0318561_104796782 | 3300031679 | Soil | ILSVDGIPVTSEDNIEKIRTRLASAPLGTPFKMNVLRAGKVIELTGTSQ |
| Ga0307469_100802521 | 3300031720 | Hardwood Forest Soil | NIEKVRNTLARLASVAPGAAVKMNVLRAGKIIELTGTSR |
| Ga0307469_102613501 | 3300031720 | Hardwood Forest Soil | DIILSVEGIPVVSEDNIEKIRNTLVGMAPGAPFKMNVLRAGKVIELTGTSQ |
| Ga0307469_106123211 | 3300031720 | Hardwood Forest Soil | IPVVSEENIEKIRNKLAGAAKGAMFKMSVLRAGKIIELAGTSQ |
| Ga0307469_118799861 | 3300031720 | Hardwood Forest Soil | LSVEDIPVVSEENIEKIRNVLAGLAPGAAFKMSVLRAGKIIELTGTSH |
| Ga0307468_1010720311 | 3300031740 | Hardwood Forest Soil | EDIPVVSEENIEKIRNKLVGSAPGSTFKMVVLRAGKVLELTGTSQ |
| Ga0318535_100972542 | 3300031764 | Soil | IILSVDGIPVVSEDNIEKIRNKLASVPAGTPFKISVLRGGKVIELAGKTKGELVKF |
| Ga0318521_104303252 | 3300031770 | Soil | SEDNIEKIRNKLASVPAGTPFKISVLRGGKVIELAGKTKGELVKF |
| Ga0318547_100433561 | 3300031781 | Soil | IRNKLASVPAGTPFKISVLRGGKVIELAGKTKGELVKF |
| Ga0318547_104449291 | 3300031781 | Soil | VEDIPVVSEDNIEKIRNTLVGVPPGGSFTMKVLRAGKVIELTGKAQ |
| Ga0307473_108140341 | 3300031820 | Hardwood Forest Soil | PVVSEDNIEKIRTKLASMPAGAVFKMSVLRAGKILELSGTSQ |
| Ga0310893_103274132 | 3300031892 | Soil | IEKIRNRLVGVAPGATFKMNVLRGGKVIELTGTSQ |
| Ga0307470_101815453 | 3300032174 | Hardwood Forest Soil | AGGDVILSVDGIPVVSEDSIEQVRNRLAAAPSGTPFRMSVLRSGKVVDLTGTAP |
| Ga0307470_103232793 | 3300032174 | Hardwood Forest Soil | LSVDDIPVVSEENIEKIRNRLAGATPGARFKMSVLRAGKVIELTGPSQ |
| Ga0307470_115355211 | 3300032174 | Hardwood Forest Soil | GDIILSVEGIPVVSEDNIEKVRNTLVGVAPGAPFKMSVLRAGKVIELTGTSQ |
| Ga0307471_1003130613 | 3300032180 | Hardwood Forest Soil | GDIILSVEEIPVVSEENIEKIRNKLAGSAPGSTFKMIVLRAGKVLELTGTSQ |
| Ga0307471_1012865491 | 3300032180 | Hardwood Forest Soil | NIEKIRNRLAGAPLGTPFKMNVLRAGKVIELTGTAQ |
| Ga0307471_1043316911 | 3300032180 | Hardwood Forest Soil | EDNIEKIRNVLVGKAPGASFKMSVLRAGKVIELTGTSQ |
| Ga0307472_1007846153 | 3300032205 | Hardwood Forest Soil | EDNIEKIRNRLASVPAGTSFKIIVLRGGKVIELAGKTKGEVVKF |
| Ga0315275_101812294 | 3300032401 | Sediment | ILSVDGIPVVSEDNIEKIRNKLAGAPPGSSFKVSVLRAGKVIELSGKTFQ |
| Ga0335084_124312412 | 3300033004 | Soil | IPVVSEDNIEKIRNTLASGPPGGSFKMSVLRAGKVLELTGTAE |
| Ga0326731_10583741 | 3300033502 | Peat Soil | LAVDDIPVVSEENIEKIRNRLAGLAPGATVKMSVLRAGKVLELTGKNQ |
| Ga0364925_0327615_430_573 | 3300034147 | Sediment | GAAGIPVLSEDHIEQIRNHLAGGAPGSPFKMSVLRAGKVIELTGVTQ |
| ⦗Top⦘ |