


| Basic Information | |
|---|---|
| Family ID | F067238 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 47 residues |
| Representative Sequence | SSHRKLLSSKAMVVSVAERRDKIPAGTVERGERKRTAAEVSKAD |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.55 % |
| % of genes near scaffold ends (potentially truncated) | 70.63 % |
| % of genes from short scaffolds (< 2000 bps) | 86.51 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.746 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (9.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.603 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.937 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 13.49 |
| PF08388 | GIIM | 7.14 |
| PF02566 | OsmC | 2.38 |
| PF02371 | Transposase_20 | 2.38 |
| PF00202 | Aminotran_3 | 1.59 |
| PF13185 | GAF_2 | 1.59 |
| PF13408 | Zn_ribbon_recom | 0.79 |
| PF03401 | TctC | 0.79 |
| PF00106 | adh_short | 0.79 |
| PF00891 | Methyltransf_2 | 0.79 |
| PF00497 | SBP_bac_3 | 0.79 |
| PF13458 | Peripla_BP_6 | 0.79 |
| PF14833 | NAD_binding_11 | 0.79 |
| PF13602 | ADH_zinc_N_2 | 0.79 |
| PF01209 | Ubie_methyltran | 0.79 |
| PF00211 | Guanylate_cyc | 0.79 |
| PF01048 | PNP_UDP_1 | 0.79 |
| PF00589 | Phage_integrase | 0.79 |
| PF00144 | Beta-lactamase | 0.79 |
| PF00248 | Aldo_ket_red | 0.79 |
| PF00672 | HAMP | 0.79 |
| PF01135 | PCMT | 0.79 |
| PF03721 | UDPG_MGDP_dh_N | 0.79 |
| PF02735 | Ku | 0.79 |
| PF13751 | DDE_Tnp_1_6 | 0.79 |
| PF02861 | Clp_N | 0.79 |
| PF07690 | MFS_1 | 0.79 |
| PF09351 | DUF1993 | 0.79 |
| PF04545 | Sigma70_r4 | 0.79 |
| PF01464 | SLT | 0.79 |
| PF02733 | Dak1 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.38 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.38 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.38 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.59 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.79 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.79 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.79 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.79 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.79 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.79 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.79 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.79 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.79 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.79 |
| COG2376 | Dihydroxyacetone kinase | Carbohydrate transport and metabolism [G] | 0.79 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.79 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.79 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.75 % |
| Unclassified | root | N/A | 18.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17093106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1155 | Open in IMG/M |
| 2170459002|FZY7DQ102JT4B1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1041636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 598 | Open in IMG/M |
| 3300000705|JGI12455J11871_104548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300000715|JGI12409J11926_105142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1007719 | Not Available | 1522 | Open in IMG/M |
| 3300001179|JGI12660J13575_103630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300001407|JGI20192J14887_1003436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2265 | Open in IMG/M |
| 3300001593|JGI12635J15846_10371474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300001620|JGI20266J16349_10422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300001622|JGI20252J16333_100351 | Not Available | 949 | Open in IMG/M |
| 3300001636|JGI20236J16297_101475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300001641|JGI20238J16299_100484 | Not Available | 1203 | Open in IMG/M |
| 3300001645|JGI20270J16353_100458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100376664 | Not Available | 1299 | Open in IMG/M |
| 3300003224|JGI26344J46810_1001841 | Not Available | 1454 | Open in IMG/M |
| 3300004067|Ga0055485_10024573 | Not Available | 1203 | Open in IMG/M |
| 3300004071|Ga0055486_10006383 | Not Available | 1623 | Open in IMG/M |
| 3300004465|Ga0068944_1143903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300004468|Ga0068977_1282928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300004471|Ga0068965_1295548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 533 | Open in IMG/M |
| 3300004618|Ga0068963_1407803 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300004633|Ga0066395_10086963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1477 | Open in IMG/M |
| 3300004633|Ga0066395_10611606 | Not Available | 639 | Open in IMG/M |
| 3300004633|Ga0066395_10739661 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005173|Ga0066822_1003393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 829 | Open in IMG/M |
| 3300005332|Ga0066388_103403689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300005332|Ga0066388_104545270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300005332|Ga0066388_104598723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 702 | Open in IMG/M |
| 3300005332|Ga0066388_106926557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 570 | Open in IMG/M |
| 3300005334|Ga0068869_100183335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1642 | Open in IMG/M |
| 3300005337|Ga0070682_100171148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1509 | Open in IMG/M |
| 3300005347|Ga0070668_100497626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1055 | Open in IMG/M |
| 3300005356|Ga0070674_101824708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 552 | Open in IMG/M |
| 3300005435|Ga0070714_100325308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1439 | Open in IMG/M |
| 3300005437|Ga0070710_10441216 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005439|Ga0070711_100650523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300005439|Ga0070711_101203011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 655 | Open in IMG/M |
| 3300005439|Ga0070711_101327753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300005445|Ga0070708_100888768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 837 | Open in IMG/M |
| 3300005468|Ga0070707_100662496 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005468|Ga0070707_101095223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 762 | Open in IMG/M |
| 3300005536|Ga0070697_100964097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 758 | Open in IMG/M |
| 3300005544|Ga0070686_100019878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3967 | Open in IMG/M |
| 3300005554|Ga0066661_10151345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1419 | Open in IMG/M |
| 3300005556|Ga0066707_10469590 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005561|Ga0066699_10404702 | Not Available | 976 | Open in IMG/M |
| 3300005602|Ga0070762_10136123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1457 | Open in IMG/M |
| 3300005713|Ga0066905_100150212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1676 | Open in IMG/M |
| 3300005719|Ga0068861_100148913 | Not Available | 1918 | Open in IMG/M |
| 3300005764|Ga0066903_102298125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1041 | Open in IMG/M |
| 3300005980|Ga0066798_10025509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1993 | Open in IMG/M |
| 3300006028|Ga0070717_10521088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1075 | Open in IMG/M |
| 3300006041|Ga0075023_100427845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300006046|Ga0066652_100157329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1912 | Open in IMG/M |
| 3300006052|Ga0075029_100157676 | Not Available | 1398 | Open in IMG/M |
| 3300006102|Ga0075015_100044354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2080 | Open in IMG/M |
| 3300006102|Ga0075015_100201960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1059 | Open in IMG/M |
| 3300006102|Ga0075015_100836720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300006354|Ga0075021_10095325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1763 | Open in IMG/M |
| 3300006578|Ga0074059_12066856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300006800|Ga0066660_11402522 | Not Available | 547 | Open in IMG/M |
| 3300006845|Ga0075421_101239441 | Not Available | 829 | Open in IMG/M |
| 3300006846|Ga0075430_100088595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2590 | Open in IMG/M |
| 3300006880|Ga0075429_100160545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1968 | Open in IMG/M |
| 3300006893|Ga0073928_11069744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300006904|Ga0075424_102151530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300007076|Ga0075435_101211616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300009518|Ga0116128_1110142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300009525|Ga0116220_10136851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300009631|Ga0116115_1121937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300009808|Ga0105071_1073144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300009817|Ga0105062_1076146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Ce-a6 | 641 | Open in IMG/M |
| 3300010048|Ga0126373_11632313 | Not Available | 709 | Open in IMG/M |
| 3300010366|Ga0126379_10555973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1228 | Open in IMG/M |
| 3300010373|Ga0134128_12062143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 628 | Open in IMG/M |
| 3300012209|Ga0137379_10249889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1686 | Open in IMG/M |
| 3300012685|Ga0137397_11100856 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012929|Ga0137404_10395046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
| 3300012944|Ga0137410_10203341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1535 | Open in IMG/M |
| 3300012971|Ga0126369_12634597 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300014165|Ga0181523_10077023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2024 | Open in IMG/M |
| 3300015051|Ga0137414_1192535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6377 | Open in IMG/M |
| 3300016319|Ga0182033_10395012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1167 | Open in IMG/M |
| 3300016371|Ga0182034_10160106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300016387|Ga0182040_10047321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2651 | Open in IMG/M |
| 3300016387|Ga0182040_10825331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300016422|Ga0182039_10513144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1037 | Open in IMG/M |
| 3300017931|Ga0187877_1104583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300017937|Ga0187809_10092056 | Not Available | 1009 | Open in IMG/M |
| 3300017972|Ga0187781_10045654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3015 | Open in IMG/M |
| 3300017972|Ga0187781_10289481 | Not Available | 1162 | Open in IMG/M |
| 3300017975|Ga0187782_10030880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3893 | Open in IMG/M |
| 3300018058|Ga0187766_10435987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300019786|Ga0182025_1019645 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300019786|Ga0182025_1208483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2272 | Open in IMG/M |
| 3300020579|Ga0210407_10792575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
| 3300021168|Ga0210406_11309477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300021404|Ga0210389_11529222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300021420|Ga0210394_11772214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300021475|Ga0210392_10361440 | Not Available | 1052 | Open in IMG/M |
| 3300021476|Ga0187846_10283118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300021560|Ga0126371_13427595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 535 | Open in IMG/M |
| 3300022727|Ga0224567_103908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300022731|Ga0224563_1018814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300025905|Ga0207685_10219618 | Not Available | 903 | Open in IMG/M |
| 3300025916|Ga0207663_11501374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300026920|Ga0208575_1001622 | All Organisms → cellular organisms → Bacteria | 2723 | Open in IMG/M |
| 3300027063|Ga0207762_1041923 | Not Available | 680 | Open in IMG/M |
| 3300027842|Ga0209580_10649720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300028536|Ga0137415_10111222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2587 | Open in IMG/M |
| 3300031719|Ga0306917_10281227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1282 | Open in IMG/M |
| 3300031724|Ga0318500_10396425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300031771|Ga0318546_10127527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1697 | Open in IMG/M |
| 3300031879|Ga0306919_11149957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa palsarum | 591 | Open in IMG/M |
| 3300031912|Ga0306921_10031754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5895 | Open in IMG/M |
| 3300031912|Ga0306921_10282410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1944 | Open in IMG/M |
| 3300031941|Ga0310912_10811633 | Not Available | 722 | Open in IMG/M |
| 3300031942|Ga0310916_10268522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1440 | Open in IMG/M |
| 3300031945|Ga0310913_10096585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1993 | Open in IMG/M |
| 3300031954|Ga0306926_10200086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2479 | Open in IMG/M |
| 3300032076|Ga0306924_10021815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6812 | Open in IMG/M |
| 3300032076|Ga0306924_11164430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 836 | Open in IMG/M |
| 3300032516|Ga0315273_10358834 | Not Available | 1970 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.59% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.59% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.59% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.79% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000705 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 | Environmental | Open in IMG/M |
| 3300000715 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001179 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 | Environmental | Open in IMG/M |
| 3300001407 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001620 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 | Environmental | Open in IMG/M |
| 3300001622 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 | Environmental | Open in IMG/M |
| 3300001636 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 | Environmental | Open in IMG/M |
| 3300001641 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 | Environmental | Open in IMG/M |
| 3300001645 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004465 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005173 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022727 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00518790 | 2088090014 | Soil | LISSHRKLLSSKAMVVNVAESRDMIPIGKVDRGERKRTAVEVSKAD |
| E1_02188060 | 2170459002 | Grass Soil | HRKPLRSKAVVASVAETPGQDSGRHGRERRAKRTAAEVSKAV |
| AP72_2010_repI_A10DRAFT_10416363 | 3300000651 | Forest Soil | QVSSHRKLLSSRAMVVSVAERRDLIPAGEVERGERKRTADDVSKAD* |
| JGI12455J11871_1045481 | 3300000705 | Tropical Forest Soil | RKPLSSKAMVVNVAETWDMISAGMVERGERKQTAAEASKAD* |
| JGI12409J11926_1051422 | 3300000715 | Tropical Forest Soil | KPLSSKAMVVNVAERWDMISAGMVERGERKQTAAEASKAD* |
| AP72_2010_repI_A100DRAFT_10077191 | 3300000837 | Forest Soil | FGDQESIPSHRGLLRPKSVVVSVAETPGAIPAGTVERGERKQTAAEVSKAD* |
| JGI12660J13575_1036301 | 3300001179 | Forest Soil | KAMVVNVAESRNKISAGMIERGERKRTADDVSKAD* |
| JGI20192J14887_10034361 | 3300001407 | Arctic Peat Soil | MKEGPEVGNQVLISSHRKLLWSKATVVNVAEKPDKILAGMIERGERKRTAVEVSKAD* |
| JGI12635J15846_103714741 | 3300001593 | Forest Soil | FGFSNQVLISSHRKLLSLRAMVVALRKNRDLIPAGTVGRGERKQTVDDVSKAV* |
| JGI20266J16349_104221 | 3300001620 | Forest Soil | RKLLSSKAMVVNVAETRDMIPAGTIERGERKRTVDEVSKSD* |
| JGI20252J16333_1003512 | 3300001622 | Forest Soil | RKLLLSKAMVVSVAETAGEIPSGKVERGERKQTADDVSKAD* |
| JGI20236J16297_1014751 | 3300001636 | Forest Soil | SKAMVVSVAETAGMIPSGKVERGERKQTADDVSKSD* |
| JGI20238J16299_1004842 | 3300001641 | Forest Soil | AMVVSVAETAGEIPSGKVERGERKQTADDVSKAD* |
| JGI20270J16353_1004582 | 3300001645 | Forest Soil | VQVSSHRELLSSRAMVVSVAERRDMIPAGKVERGERKRTVDEVSKAD* |
| JGIcombinedJ26739_1003766641 | 3300002245 | Forest Soil | MKEAPEAGSQVLASSHRKLLRTKAAVVSVAERRDKIPAGKVERGERKRTVDEVSKAD* |
| JGI26344J46810_10018412 | 3300003224 | Bog Forest Soil | IPSHRKPLWSKAVVVSVAERRDQIPAGTVERGERKRTAAEVSKAD* |
| Ga0055485_100245731 | 3300004067 | Natural And Restored Wetlands | SHRKLLRSKAVVVSVAERRDKIPAGTVERGERKRTAAEVSKAD* |
| Ga0055486_100063832 | 3300004071 | Natural And Restored Wetlands | SHRKLLRSKAVVVSVAETPGKIPAGTVERGERKRTAAEVSKAD* |
| Ga0068944_11439032 | 3300004465 | Peatlands Soil | GNQVLISSHRKLLRSKATVVNVAEKRDVIPSGKVEGGERKRTAVEASKAD* |
| Ga0068977_12829282 | 3300004468 | Peatlands Soil | GNQVLISSHRKLLWSKAMVVSVAETSDEIPAGKVERGERKRTVDEVSKAD* |
| Ga0068965_12955481 | 3300004471 | Peatlands Soil | GNQVLISSHRKLLWSKATVVNVAEKRDVIPSGKVEGGERKRTAVEASKAD* |
| Ga0068963_14078031 | 3300004618 | Peatlands Soil | MKEGPGFGSQVLIPSHRKLLRSNAVVVSVADAGTMILAGKVERGERKRTADEVSKAD* |
| Ga0066395_100869631 | 3300004633 | Tropical Forest Soil | FGFGNQVLIPSHRKLLRLNVVVVSVADAGTMIPAGKVERGERKQTVDEVSKAD* |
| Ga0066395_106116062 | 3300004633 | Tropical Forest Soil | NQVLISSHRKLLRSRAVVVSVAERRDEIPAGKVERGERKRTAAEVSKAV* |
| Ga0066395_107396611 | 3300004633 | Tropical Forest Soil | QVLISNHRKLLWSKARVVNVAEKAGQDPAGMVERGERKRTAAEVSKAA* |
| Ga0066822_10033932 | 3300005173 | Soil | FEVGNQVLISSHRKLLLSKAMVVSVAETAGEIPSGKVERGERKQTADDVSKAD* |
| Ga0066388_1034036892 | 3300005332 | Tropical Forest Soil | QVLISSHRKLLWSKAPVVNVAEKLGTIPSGMVEGGERKRTAGEVSKAV* |
| Ga0066388_1045452702 | 3300005332 | Tropical Forest Soil | EIGSQVQVSSHRKLLSSRAMVVSIAERRDLIPAGEVERGDRKRTVDEVSKAD* |
| Ga0066388_1045987231 | 3300005332 | Tropical Forest Soil | EFGNQVLISSHRKLLRSKAVVVSVAERRDMIPAGMVERGERKQTAAEVSKSD* |
| Ga0066388_1069265571 | 3300005332 | Tropical Forest Soil | QVLISSHRKLLSSKAMVVNVAETWDMIPAGTVERGERKRTVDELSKAV* |
| Ga0068869_1001833351 | 3300005334 | Miscanthus Rhizosphere | KLLRSRAVVVSVAAKLGKSPGGKVERGERKQTVDEVSKAD* |
| Ga0070682_1001711482 | 3300005337 | Corn Rhizosphere | FGNQVLISSHRKLLRSKAVVVSVAETPDEIPAGKVERGERKRTAAEVSKAD* |
| Ga0070668_1004976261 | 3300005347 | Switchgrass Rhizosphere | ISSHRKLLLSKAMVVSVAETAGEIPSGKVERGERKQTADDVSKAD* |
| Ga0070674_1018247082 | 3300005356 | Miscanthus Rhizosphere | ISSHRKLLLSKAMVVSVAETAGHDPVGKVERGERKQTADDVSKSD* |
| Ga0070714_1003253083 | 3300005435 | Agricultural Soil | MKEGPSGFGNQVLISSHCKLLRSKAVVVNVAEKVGTTIPAGMVERGERKRTAAEASKFS* |
| Ga0070710_104412161 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ERLWSKATVVSVADVGAMIPAGKIERGERKRTASEASKAD* |
| Ga0070711_1006505233 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | HRKLLRSKAVVVNVAEKVGTTIPAGMVERGERKRTAAEASKFS* |
| Ga0070711_1012030111 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEDPEFGDQEPISSHRKLLRAKAVVVSVAETPGKISAGTVERGERKRTAAEVSK |
| Ga0070711_1013277531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EFGNQVLISSHRKLLRSNVVVVSVAETPAMIPAGKVERGERKRTVDEVSKAV* |
| Ga0070708_1008887681 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLISSHRKLLSSKAMVVSVAEKSGHPAGKVERGERKRTVDEVLKAD* |
| Ga0070707_1006624963 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEGPEAGSQVQVSSHRELLSSRAMVVSVAERRDLIPAGKVERGERKRTVDEVSKAD* |
| Ga0070707_1010952234 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RKLLSSKAMVVNVAEKRDMISAGKVERGERKRTADEVSKAD* |
| Ga0070697_1009640972 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SHRKLLSSKAMVVNVAETPGKIPAGEVERGERKQTVDEVSKAD* |
| Ga0070686_1000198786 | 3300005544 | Switchgrass Rhizosphere | FGNQVLISSHRKLLRSKAVVVSVAETPDEIPAGTVERGERKRTAAEVSKGD* |
| Ga0066661_101513452 | 3300005554 | Soil | MKEGPEVGNQVLISSRRKLLSSKAMVVNVAEKPDKISAGTVERGERKQTADEVSKAD* |
| Ga0066707_104695902 | 3300005556 | Soil | MKEGFEVGNQVLISSHRKLLLSKAMVVNVAEKRDKIPTGKVERGERKRTAAEVSKAD* |
| Ga0066699_104047022 | 3300005561 | Soil | PISSHRKLLWSKAMVVSVAERRDKILAGMVERGERKRTAAEVSKAD* |
| Ga0070762_101361232 | 3300005602 | Soil | MKEDPEVGNQVLISSHRKLLLSKAMVVSVAETAGEIPSGKVERGERKQTADDVSKAD* |
| Ga0066905_1001502121 | 3300005713 | Tropical Forest Soil | LRSKAVVVSVAVKLGPKVQDGKVERGERKRTAAEVSKSD* |
| Ga0068861_1001489132 | 3300005719 | Switchgrass Rhizosphere | SHRKLLRSKAVVVSVAETPDEIPAGKVERGERKRTAAEVSKAD* |
| Ga0066903_1022981253 | 3300005764 | Tropical Forest Soil | MKEGPLGGNQVLISSHRKLLRLNAVVVSVAETLTMIPAGKVERGERKQTVDEVSKAD* |
| Ga0066798_100255092 | 3300005980 | Soil | VPISSRRKLLSSKAMVVNVAETRDKIPTGTIERGERKRTAVEVSKSD* |
| Ga0070717_105210882 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EFGDQEPISSHRKLLRAKAVVVSVAERRDKISAGTVERGERKRTAAEVSKAD* |
| Ga0075023_1004278452 | 3300006041 | Watersheds | FGNQVLISSHRKLLSSKATVVNVAERRDMILAGMVERGERKRTAAEASKSD* |
| Ga0066652_1001573292 | 3300006046 | Soil | ISSHRKLLSSKAMVVSVAETPGQDSGGTVERGERKRTAAEVSKAD* |
| Ga0075029_1001576761 | 3300006052 | Watersheds | SSHRKLLSSKAMVVSVAERRDKIPAGTVERGERKRTAAEVSKAD* |
| Ga0075015_1000443543 | 3300006102 | Watersheds | QVLISSHRKLLWSKAVVVSVAETPGKIPAGKVERGERKRTAAEVSKAD* |
| Ga0075015_1002019603 | 3300006102 | Watersheds | MKEGPGFGSQVLIPSHRKLLRSKAVVVSVADAGTMILAGKVERGERKRTADEVSKAD* |
| Ga0075015_1008367202 | 3300006102 | Watersheds | VSSHRKLLWSKAMVVSVAENRNEIPAGKIERGERKQTVGEVSKAD* |
| Ga0075021_100953251 | 3300006354 | Watersheds | RKLLSSKATVVNVAETRDMISAGMVERGERKRTAAEASKSD* |
| Ga0074059_120668562 | 3300006578 | Soil | EPISSHRKLLWSKAVVVSVAERRDEIPAGTVERGERKRTAAEVSKAD* |
| Ga0066660_114025221 | 3300006800 | Soil | LLSSRAMVVSVAETRDLIPAGKVERGERKRTANEVSKAD* |
| Ga0075421_1012394412 | 3300006845 | Populus Rhizosphere | SRCKLLRSKAVVVSVAVKVRTSSPAGEIEGGERKRTAAEASKAD* |
| Ga0075430_1000885954 | 3300006846 | Populus Rhizosphere | GDQEPISSHRKLLRSKAVVVSIAETPDEIPAGTVERDERKRTAAEVSKSD* |
| Ga0075429_1001605451 | 3300006880 | Populus Rhizosphere | MKEGPEVGSQVQVSSHRELLSSRAMVVSVAETRDLIPAGKVERGERKRTADDVSKAD* |
| Ga0073928_110697441 | 3300006893 | Iron-Sulfur Acid Spring | LLWSKAMVVSVAENRNEIPAGKIERGERKQTVGEVSKAD* |
| Ga0075424_1021515302 | 3300006904 | Populus Rhizosphere | DQEPISSHRKLLRAKAVVVSVAERRDKIPAGTVERGERKRTAAEVSKAD* |
| Ga0075435_1012116162 | 3300007076 | Populus Rhizosphere | MKEGPSSFGDQEPISSHRKLLRPKAVVVSVAERRDKISAGTVERDERKRTAAEVSKAD* |
| Ga0116128_11101421 | 3300009518 | Peatland | VLVSSHRKLLWSKATVVSVAENRNEIPAGKIERGERKRTVGEVSKAD* |
| Ga0116220_101368512 | 3300009525 | Peatlands Soil | VLVSSHRKLLWSKAMVVSVAENRNEIPAGKIERGERKQTVGEVSKSD* |
| Ga0116115_11219371 | 3300009631 | Peatland | VLVSSHRKLLWSKATAVSVAENRNEIPAGKIERGERKRTVGEVSKAD* |
| Ga0105071_10731442 | 3300009808 | Groundwater Sand | MLVSVAEKPGQRFPAGTVEKGERKQTADEVSKAD* |
| Ga0105062_10761462 | 3300009817 | Groundwater Sand | VPIPSHRKLLRSKAVVVSVAENARTMIPAGMVERGERKRTAAEVSKAD* |
| Ga0126373_116323131 | 3300010048 | Tropical Forest Soil | VPFEAGSEVQVSSHRKLLLLRAMVVRLRKRRDLIPAGKVERSERKQTADEVSKAD* |
| Ga0126379_105559733 | 3300010366 | Tropical Forest Soil | CKLLRSKAVVVSVAVKLGPKVQDGKVERGERKRTAAEVSKSD* |
| Ga0134128_120621431 | 3300010373 | Terrestrial Soil | VLISSHRKLLSSKAMVVSVAETLGQDSGTGKVERGERKRTVDE |
| Ga0136449_1001100791 | 3300010379 | Peatlands Soil | MVVNVAEKVGTMIPAGKIERGERKQTASEASKSD* |
| Ga0137379_102498891 | 3300012209 | Vadose Zone Soil | VLTLSHHKLLSSKAMVVTLRKRRDKIPAGKVERGERKQTVDEV |
| Ga0137397_111008561 | 3300012685 | Vadose Zone Soil | LISSHRKLLSSKAMVVNVAESRDMIPIGKVDRGERKRTAVEVSKAD* |
| Ga0137404_103950462 | 3300012929 | Vadose Zone Soil | MLLSSKAMVVNVAESRDMIPIGKVDRGERKRTAVEVSKAD* |
| Ga0137410_102033413 | 3300012944 | Vadose Zone Soil | LISSHRKLLSSKAMVVNVAESRDMIPIGKVDSGERKRTAVEVSKAD* |
| Ga0126369_126345972 | 3300012971 | Tropical Forest Soil | LLSPKATVVNVAEASGIGYRHGMVERGERKRTAAEASKAD* |
| Ga0181523_100770232 | 3300014165 | Bog | PFEVGNQVLVSSHRKLLWSKATVVSVAENRNEIPAGKIERGERKRTVGEVSKAD* |
| Ga0137414_11925358 | 3300015051 | Vadose Zone Soil | VLIPSHRKLLSFKSGMVVSVAETPDEIPAGKVERGERKRTVDEVSKAIGRCQTGG* |
| Ga0182033_103950121 | 3300016319 | Soil | SHRKLLRSKAVVVSVAETSGHDPPAGMVERGKRKRTAAEVSKSD |
| Ga0182034_101601062 | 3300016371 | Soil | VQVSSHRKLLRAKAVVVSVAETPGPDSAGTVERGERKRTAAEVSKAD |
| Ga0182040_100473211 | 3300016387 | Soil | NQVLISSHRKLLRSKAVVVSVAETSGHDPPAGMVERGKRKRTAAEVSKSD |
| Ga0182040_108253311 | 3300016387 | Soil | SKLLLSKATVVSVAERRDRIPAGTVERGERKRTADEVSKRD |
| Ga0182039_105131441 | 3300016422 | Soil | LLSSKAMVVSVAEKSGRDPVRHGMVERGERKRTTAEVSKSA |
| Ga0187877_11045832 | 3300017931 | Peatland | VLVSSHRKLLWSKATVVSVAENRNEIPAGKIERGERKRTVGEVSKAD |
| Ga0187809_100920561 | 3300017937 | Freshwater Sediment | SSHRKLLWSKAMVVSVAENRNEIPAGKIERGERKQTVGEVSKAD |
| Ga0187854_101812281 | 3300017938 | Peatland | WSKAMVVSVAENRNEIPAGKIERGERKRTVGEVSKAD |
| Ga0187781_100456543 | 3300017972 | Tropical Peatland | GVGNQVLISSHRKLLRSKAVVVSVAERRDEIPAGKVERGERKRTAAEVSKTD |
| Ga0187781_102894813 | 3300017972 | Tropical Peatland | VLISSHRKLLWSKAMVVSVAESRDLIPSGKVERGERKRSIDEVS |
| Ga0187782_100308803 | 3300017975 | Tropical Peatland | VLISSHRKLLRSKAVVVSVAERRDEIPAGKVERGERKRTAAEVSKTD |
| Ga0187766_104359873 | 3300018058 | Tropical Peatland | ISSHRKLLWSKTTVVNVAESRDMISPGTVERGERKRTAAEASK |
| Ga0182025_10196452 | 3300019786 | Permafrost | VLVSSHRKLLWSKATVVSVAENRNEIPAGKIVRGERKRTVGEVSKA |
| Ga0182025_12084831 | 3300019786 | Permafrost | MTLRGRQSVLVSSHRKLLWSKATVVSVAENRNEIPAGKIERGERKRTVGEVSKAD |
| Ga0210407_107925752 | 3300020579 | Soil | LATCCATTFEVGNQVLISSHCKLLSSKAMVVSVAERREEIPAGTVERGERKQTVDEVSKALR |
| Ga0210406_113094772 | 3300021168 | Soil | RKLLRAKAVVVSVAETPGQDFGRHGRERRTAAEVSKAD |
| Ga0210389_115292221 | 3300021404 | Soil | VLISSHRKLLSSKATVVNVAEKSGWIWTGVIEGGERKRTADEVSKGD |
| Ga0210394_117722141 | 3300021420 | Soil | NQWLISSHCKLLSSKAMVVSVAERREEIPAGTVERGERKQTVDEVSKALR |
| Ga0210392_103614401 | 3300021475 | Soil | RGRQSGLISSHRKLLSSKAMVVNVAEKVGTGPTGKVERGERKRTAAEVSKSD |
| Ga0187846_102831182 | 3300021476 | Biofilm | VSSHRKLLSSRAMVVSVAETSDLIPAGKVERGERKRTADEVSKAD |
| Ga0126371_134275951 | 3300021560 | Tropical Forest Soil | KATVVNVAEASGIGFRHGMVERGERKRTAAEASKAD |
| Ga0224567_1039081 | 3300022727 | Plant Litter | LVSSHRKLLWSKATVVSVAENRNEIPAGKIERGERKRTVGEVSKAD |
| Ga0224563_10188141 | 3300022731 | Soil | FEVGNQVLVSSHRKLLWSKATVVSVAENRNEIPAGKIERGERKRTVGEVSKAD |
| Ga0207685_102196182 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNSSHRKLLSSKAMVVSVAETPGQDSGTGKVERGERKRTVDEVSKAD |
| Ga0207663_115013741 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HRKLLRSKAVVVNVAEKVGTTIPAGMVERGERKRTAAEASKFS |
| Ga0208575_10016225 | 3300026920 | Soil | VLISSHRKLLSSKAMVGALRKRRDEIPAGKVERGERKQTVDEVSKAD |
| Ga0207762_10419231 | 3300027063 | Tropical Forest Soil | SHRKLLWSKAMVVSVAESWDMIPSGKVERGERKRSIGEVSKAD |
| Ga0209580_106497202 | 3300027842 | Surface Soil | KLLRPKSVVVSVAERRDKIPAGTVERGERKQTADEVSKAD |
| Ga0137415_101112222 | 3300028536 | Vadose Zone Soil | VLISSHRKLLWSKATVVNVAEKSEQISVGVIERGERKRTAVEVSKAD |
| Ga0306917_102812273 | 3300031719 | Soil | VLISSPRKLLSSKATVVNVAEKRDMISTGVVEGGERKRTAAEVSKAD |
| Ga0318500_103964252 | 3300031724 | Soil | QVLISSHRKLLRSKAVVVSVAETSGHDPPAGMVERGKRKRTAAEVSKSD |
| Ga0318546_101275271 | 3300031771 | Soil | VLISSYRKLLLSKAMVVNIAKTSGQDSDNERGERKQTAAEVSKAD |
| Ga0306919_111499571 | 3300031879 | Soil | VLIPSHRKPLRSKAVVVSVADTAGTMILAGTVEKGERKRTADEVSKGD |
| Ga0306921_100317541 | 3300031912 | Soil | RCKLLSSTAMVVSVAVNVGRISRAGKVERGERKRTVDELSKAV |
| Ga0306921_102824101 | 3300031912 | Soil | GDQEPISSHRKLLRAKAVVVSVAETPGPDSAGTVERGERKRTAAEVSKAD |
| Ga0310912_108116332 | 3300031941 | Soil | SHRKLLRSKAVVVSVADQDKILAGKVERGERKRTAAEVSKAD |
| Ga0310916_102685221 | 3300031942 | Soil | KLLRSKAVVVSVAETSGHDPPAGMVERGKRKRTAAEVSKSD |
| Ga0310913_100965853 | 3300031945 | Soil | KLLRAKAVVVSVAETPGPDSAGTVERGERKRTAAEVSKAD |
| Ga0306926_102000861 | 3300031954 | Soil | VQVSSHRELLSSRAMVVSVAETSGLIPAGTVERGERKRTADEVSKAD |
| Ga0306924_100218151 | 3300032076 | Soil | QEPISSHRKLLRAKAVVVSVAETPGPDSAGTVERGERKRTAAEVSKAD |
| Ga0306924_111644301 | 3300032076 | Soil | KAVVVSVAVKLGPKVQDGKVERGERKRTAAEVSKSD |
| Ga0315273_103588343 | 3300032516 | Sediment | KLLLSKATVVNVAENAGPMSPAGMIERGERKRTVDEVSKAFR |
| ⦗Top⦘ |