


| Basic Information | |
|---|---|
| Family ID | F067217 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPGLLQRFLPREEGFFDLFAKQAANIHAGADALLKMLSHYTGV |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 93.65 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.063 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.889 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.063 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 38.89 |
| PF02517 | Rce1-like | 4.76 |
| PF00296 | Bac_luciferase | 3.97 |
| PF05988 | DUF899 | 3.17 |
| PF00106 | adh_short | 1.59 |
| PF00166 | Cpn10 | 1.59 |
| PF00486 | Trans_reg_C | 0.79 |
| PF05195 | AMP_N | 0.79 |
| PF01476 | LysM | 0.79 |
| PF00890 | FAD_binding_2 | 0.79 |
| PF01471 | PG_binding_1 | 0.79 |
| PF01636 | APH | 0.79 |
| PF00144 | Beta-lactamase | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 38.89 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 4.76 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 4.76 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.97 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 3.17 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.59 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.79 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.79 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.06 % |
| Unclassified | root | N/A | 7.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_102938950 | Not Available | 1044 | Open in IMG/M |
| 3300001471|JGI12712J15308_10182585 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300002558|JGI25385J37094_10133939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10459702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300004479|Ga0062595_102108404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300004635|Ga0062388_101447315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300005330|Ga0070690_100689561 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005334|Ga0068869_101183377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300005454|Ga0066687_10126078 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300005467|Ga0070706_101444504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005518|Ga0070699_100810399 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005541|Ga0070733_10928580 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005560|Ga0066670_10297057 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005576|Ga0066708_10029907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2893 | Open in IMG/M |
| 3300005591|Ga0070761_11103259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300005598|Ga0066706_11004175 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005602|Ga0070762_10434124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300005617|Ga0068859_100402581 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300006032|Ga0066696_10406308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300006034|Ga0066656_10354749 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300006086|Ga0075019_10103049 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300006797|Ga0066659_10620241 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300006800|Ga0066660_11128788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300006914|Ga0075436_100800537 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009038|Ga0099829_10824187 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300009088|Ga0099830_11446156 | Not Available | 572 | Open in IMG/M |
| 3300009089|Ga0099828_10255009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
| 3300009089|Ga0099828_11755475 | Not Available | 545 | Open in IMG/M |
| 3300009089|Ga0099828_11799059 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009176|Ga0105242_10180370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300009792|Ga0126374_10142997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
| 3300010361|Ga0126378_12046437 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010361|Ga0126378_12851944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300010362|Ga0126377_12208312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300011269|Ga0137392_10196178 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300011269|Ga0137392_10932533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300011269|Ga0137392_11028143 | Not Available | 677 | Open in IMG/M |
| 3300011269|Ga0137392_11092907 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300011270|Ga0137391_10329469 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300011270|Ga0137391_10869755 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300011271|Ga0137393_10488110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300011271|Ga0137393_11211827 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300011271|Ga0137393_11634689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300012198|Ga0137364_10902938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300012201|Ga0137365_10549785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300012203|Ga0137399_10361735 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300012203|Ga0137399_10773293 | Not Available | 808 | Open in IMG/M |
| 3300012203|Ga0137399_11285543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012205|Ga0137362_11512429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012207|Ga0137381_11551713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300012211|Ga0137377_10211975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1860 | Open in IMG/M |
| 3300012211|Ga0137377_11251965 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300012211|Ga0137377_11519819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300012351|Ga0137386_10478437 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012361|Ga0137360_10262112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300012918|Ga0137396_10242574 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300012918|Ga0137396_10972996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012923|Ga0137359_10148223 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300012924|Ga0137413_10523497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300012927|Ga0137416_11669799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012930|Ga0137407_10030812 | All Organisms → cellular organisms → Bacteria | 4178 | Open in IMG/M |
| 3300012944|Ga0137410_10161887 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300012948|Ga0126375_11395985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas aquatica | 593 | Open in IMG/M |
| 3300012964|Ga0153916_12126934 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012975|Ga0134110_10470493 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300013503|Ga0120127_10096188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300015052|Ga0137411_1196074 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300015242|Ga0137412_10337502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300015374|Ga0132255_101189202 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300015374|Ga0132255_101408076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300016270|Ga0182036_10588188 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300017934|Ga0187803_10089545 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300017959|Ga0187779_10221299 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300017993|Ga0187823_10260295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300020579|Ga0210407_10706999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300020581|Ga0210399_10213680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300020582|Ga0210395_10284626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1243 | Open in IMG/M |
| 3300020583|Ga0210401_10135279 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300020583|Ga0210401_11406833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300020583|Ga0210401_11455257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300021088|Ga0210404_10594359 | Not Available | 629 | Open in IMG/M |
| 3300021168|Ga0210406_10302472 | Not Available | 1300 | Open in IMG/M |
| 3300021171|Ga0210405_11233691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300021407|Ga0210383_11066416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300021411|Ga0193709_1057086 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300021433|Ga0210391_11135568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300021475|Ga0210392_10200559 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300021477|Ga0210398_10334671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300021478|Ga0210402_11205410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300021560|Ga0126371_12619175 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300024182|Ga0247669_1000848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10774 | Open in IMG/M |
| 3300024284|Ga0247671_1006660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1887 | Open in IMG/M |
| 3300024325|Ga0247678_1042068 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300024330|Ga0137417_1069933 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300025905|Ga0207685_10553290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 612 | Open in IMG/M |
| 3300025910|Ga0207684_10369281 | Not Available | 1234 | Open in IMG/M |
| 3300025938|Ga0207704_11903953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300025942|Ga0207689_11494447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300025961|Ga0207712_11624671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300026301|Ga0209238_1248840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300026308|Ga0209265_1170864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300026313|Ga0209761_1083041 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300026557|Ga0179587_10362120 | Not Available | 942 | Open in IMG/M |
| 3300027655|Ga0209388_1131883 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027669|Ga0208981_1069788 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300027842|Ga0209580_10294810 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300027875|Ga0209283_10630418 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027879|Ga0209169_10666955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300028023|Ga0265357_1012157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 884 | Open in IMG/M |
| 3300028037|Ga0265349_1000473 | All Organisms → cellular organisms → Bacteria | 4758 | Open in IMG/M |
| 3300031231|Ga0170824_112476773 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300031564|Ga0318573_10031341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2490 | Open in IMG/M |
| 3300031718|Ga0307474_10161197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| 3300031720|Ga0307469_10839328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300031720|Ga0307469_11560438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300031753|Ga0307477_11024064 | Not Available | 541 | Open in IMG/M |
| 3300031823|Ga0307478_11378998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300031962|Ga0307479_10772704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300031962|Ga0307479_12063352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300032051|Ga0318532_10220496 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300032063|Ga0318504_10022010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2430 | Open in IMG/M |
| 3300032174|Ga0307470_11866314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300032180|Ga0307471_100357837 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300032205|Ga0307472_100775915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300032770|Ga0335085_11233210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter | 793 | Open in IMG/M |
| 3300033486|Ga0316624_11956221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.79% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1029389501 | 3300001431 | Soil | MPGLLQRFLPREDDYFALFAKQAENIHRGAKALFD |
| JGI12712J15308_101825852 | 3300001471 | Forest Soil | MAGVLQRLLPREEGFYHLFVKQADNIYVGAKALLEML |
| JGI25385J37094_101339392 | 3300002558 | Grasslands Soil | MPGLLQRFLPREVGFFDLFAKQAANIHVGAEALLKMLSHYTGVPEQVQIV |
| JGIcombinedJ51221_104597022 | 3300003505 | Forest Soil | MPGLLQRFLPREEGFFDLFAKQAANIHVGANALYKMLSHYTGVP |
| Ga0062595_1021084041 | 3300004479 | Soil | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQMLAHYTGVPEQVQ |
| Ga0062388_1014473151 | 3300004635 | Bog Forest Soil | MTGLLQRLLPREEGFFDLFRKQAENIHRGAEAFQKMLLHYTG |
| Ga0070690_1006895611 | 3300005330 | Switchgrass Rhizosphere | MPGLLQRFLPQERGFFDLFDKQAENIHAGAKALLQMLDHYTGVPE |
| Ga0068869_1011833772 | 3300005334 | Miscanthus Rhizosphere | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQMLAHY |
| Ga0066687_101260781 | 3300005454 | Soil | MPGLLQRFLPREEGFFDLFNKQAANIHDGAEALLKMLEHYT |
| Ga0070706_1014445041 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGLLQRFLPREEGFFDLFAKQAVNINAGANALLKMLSHYTGVP |
| Ga0070699_1008103991 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPREEDFFVLFSKQADNIQLGAKALLQMLEHYTGVPEQVQSIKAVEHEGD |
| Ga0070733_109285802 | 3300005541 | Surface Soil | MTGLLQRFMPREEGFFDLFVQQAENIHAGAAALLKMLSQYT |
| Ga0066670_102970571 | 3300005560 | Soil | MPGLLQRFLPREEGFFDLFAKQAANIHEGANALLKMLE |
| Ga0066708_100299073 | 3300005576 | Soil | MPGLLQRLLPREEGFFDLFAKQAANIHEGANALLKMLE |
| Ga0070761_111032591 | 3300005591 | Soil | MTGLLQRLLPREEGFFDLFRKQAENINNGAEVFLKML |
| Ga0066706_110041752 | 3300005598 | Soil | MPGLLQRLLPQERGFFDLFDSQAENIHVGAKALLQMLDHYTGVPEQVQ |
| Ga0070762_104341242 | 3300005602 | Soil | MTGLLQRLLPREEGFFDLFRKQAENINNGAEAFLRMLLHYTGVPEQVQN |
| Ga0068859_1004025811 | 3300005617 | Switchgrass Rhizosphere | MPGLLQRFLPREEGFFDLFVKQAENIVVGAKALQQMLAHY |
| Ga0066696_104063081 | 3300006032 | Soil | MPGLLQRFLPREESFFDLFAKQAANIHVGADALHKMLSHYTGVPEQVQIVKAI |
| Ga0066656_103547491 | 3300006034 | Soil | MNGLLQRLLPREVGFFGLFVKQAENINAGANALLKMLSHYTGVPEQVQI |
| Ga0075019_101030493 | 3300006086 | Watersheds | MPGLLQRFLPRETGFFDLFAKQAVNIHVGAEALLKMLSHYTGVPEQVQI |
| Ga0066659_106202413 | 3300006797 | Soil | MPGLLQRFLPREVGFFDLFAKQAANIHVGAEALLKML |
| Ga0066660_111287881 | 3300006800 | Soil | MPGLLHRLLPREEGFFDLFAKQAANIREGANALLKM |
| Ga0075436_1008005372 | 3300006914 | Populus Rhizosphere | MPGLLQRFMPREEGFFELFVKQAQNIERGARALVELLSHYTGVPEQVQSIKA |
| Ga0099829_108241871 | 3300009038 | Vadose Zone Soil | MPGLLQRLLPREEGFLDLFAKQAVNIHQGAEALLKMLSH |
| Ga0099830_114461562 | 3300009088 | Vadose Zone Soil | MPGLLQRFLPREVGFFDLFAKQAANIHVGAEALLKMLSHYTGVPEQVQ |
| Ga0099828_102550091 | 3300009089 | Vadose Zone Soil | MSGLLQRFLPREVGFFDLFAKQSANIHVGAEALLKML |
| Ga0099828_117554751 | 3300009089 | Vadose Zone Soil | MPGLLQRLLPREEDFFVLFGKQADNIQLGAKALLQMLE |
| Ga0099828_117990592 | 3300009089 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFVKQADNINAGANALLKMLEHYTGVPEQVQIV |
| Ga0105242_101803701 | 3300009176 | Miscanthus Rhizosphere | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQMLAHYTGVPEQV |
| Ga0126374_101429972 | 3300009792 | Tropical Forest Soil | MPGLLQRFLPREDDFFELFVKQAQNIERGARALVELLTHYAGVPEQVQSIKAIE |
| Ga0126378_120464371 | 3300010361 | Tropical Forest Soil | LQRLLPREEGFFDLFAKQAANIHDGANALLKMLTHYT |
| Ga0126378_128519441 | 3300010361 | Tropical Forest Soil | MPGLLQRFLPREEGFFDLFAKQAGDIHEGANALLRMLEHYTGVPEQVQIVKAF |
| Ga0126377_122083122 | 3300010362 | Tropical Forest Soil | MPGLLQRFMPREDDFFELFVKQAQNIERGSRALVELLSHYTGVPEQVQSIKAIE |
| Ga0137392_101961781 | 3300011269 | Vadose Zone Soil | MPGLLQRLLPREEGFLDLFAKQAVNIHQGAEALLKMLSHYT |
| Ga0137392_109325331 | 3300011269 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANIHDGANALQKMLTHYTGVPEQVQIVKA |
| Ga0137392_110281432 | 3300011269 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAVNIHVGANALLKMLSH |
| Ga0137392_110929072 | 3300011269 | Vadose Zone Soil | MPGLLQRFMPREEGFFDLFARQAENIVVGAKALQEMLSHYTGVPEQVQNVK |
| Ga0137391_103294691 | 3300011270 | Vadose Zone Soil | MNGLLQRLLPREVGFFGLFVKQAENINAGANALLKMLSH |
| Ga0137391_108697551 | 3300011270 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANINAGSNALLK |
| Ga0137393_104881102 | 3300011271 | Vadose Zone Soil | MPGLLQRFMPQEAGFFDLFAKQAANIHVGAEALLTMLSHY |
| Ga0137393_112118271 | 3300011271 | Vadose Zone Soil | MPGLLQRFLPREVGFFDLFAKQAANIHVGANALLKLLSHYTGVPEQVQ |
| Ga0137393_116346891 | 3300011271 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAVNINAGANALLKML |
| Ga0137364_109029382 | 3300012198 | Vadose Zone Soil | MPGLLQRFLPREESFFDLFAKQAANIHVGADALHKMLSHYTGVPEQVQIVKAIE |
| Ga0137365_105497851 | 3300012201 | Vadose Zone Soil | MPGLLQRFLPREVGFFDLFAKQAANIHAGANALLKMLSHYTGVPEQ |
| Ga0137399_103617352 | 3300012203 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAVNINAGANALLKMLSHYTGVPEQVQIV |
| Ga0137399_107732933 | 3300012203 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANIHVGAEALLKMLSHYTGVPEQVQIV |
| Ga0137399_112855432 | 3300012203 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAININAGANALLKMLSHYTGV |
| Ga0137362_115124291 | 3300012205 | Vadose Zone Soil | MPGFLQRLLPREEGFFDLFAKQAVNINAGANALLKMLSHYTGVPEQV |
| Ga0137381_115517131 | 3300012207 | Vadose Zone Soil | MPGLLQRFLPREVGFFDLFAKQAANIHAGANALLK |
| Ga0137377_102119751 | 3300012211 | Vadose Zone Soil | MPGLLQRFMPREEGFFDLFAKQAVNIHVGANALLKMLSRYTGVPEQVQI |
| Ga0137377_112519652 | 3300012211 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANIHVGADALLKML |
| Ga0137377_115198191 | 3300012211 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAVNIHVGANALLKMLSRYTGVPEQVQI |
| Ga0137386_104784372 | 3300012351 | Vadose Zone Soil | MPGLLRRFLPREESFFDLFVQQAENIQAGARALVEMLSHYTGVPEQATTT |
| Ga0137360_102621123 | 3300012361 | Vadose Zone Soil | MPGLLQRFLPREVGFFDLFAKQAANIHVGAEALLKMLSH |
| Ga0137396_102425742 | 3300012918 | Vadose Zone Soil | MPGLLQRLLPREEDFFVLFGKQADNIQLGAKALLQMLEHYTGV |
| Ga0137396_109729962 | 3300012918 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANIHAGADALLKMLSHYTGV |
| Ga0137359_101482231 | 3300012923 | Vadose Zone Soil | MPGLLQRLLPREEDFFVLFSKQADNIQLGAKALLQMLEHYTGVPEQ |
| Ga0137413_105234972 | 3300012924 | Vadose Zone Soil | MPGLLQRFMPQEAGFFDLFAKQAANIHVGAEALLTMLS |
| Ga0137416_116697991 | 3300012927 | Vadose Zone Soil | MPGLLQRLLPREEDFFVLFSKQADNIQLGAKALLQMLEHYTGVPEQVQIIK |
| Ga0137407_100308124 | 3300012930 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFSKQAVNINAGANALLKML |
| Ga0137410_101618871 | 3300012944 | Vadose Zone Soil | MPGLLQRLLPREEGFFDLFAKQAVNINAGANALLKMLSH |
| Ga0126375_113959852 | 3300012948 | Tropical Forest Soil | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQMLAHYTGVPEQVQTIKAVEH |
| Ga0153916_121269341 | 3300012964 | Freshwater Wetlands | MPGILRRFLPRQEDFYDLFVKQADNIHGGAKALVEML |
| Ga0134110_104704932 | 3300012975 | Grasslands Soil | MLGLLQRFLPREEGFFDLFAKQAANIHVGAEALLKM |
| Ga0120127_100961882 | 3300013503 | Permafrost | MTGVLQRLLPREEGFYHLFVKQADNIFVGAKALVEMLSHYTG |
| Ga0137411_11960741 | 3300015052 | Vadose Zone Soil | MPGLLQRFMPREEGFFELFFKQAKNIEKGAKALVNLLSHYTGVPEQVQVQTIKAIEHDGDEIT |
| Ga0137412_103375022 | 3300015242 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQASNIHVGAEALLKMLSHYTGVPEQVQ |
| Ga0132255_1011892022 | 3300015374 | Arabidopsis Rhizosphere | MPGLLQRFLPREEGFFDLFVKQAENIVVGAKALQQMLAHYTGVPE |
| Ga0132255_1014080761 | 3300015374 | Arabidopsis Rhizosphere | MPGLLQRFLPREEGFFDLFVKQAENIVVGAKALQQMLAHYTGVPEQ |
| Ga0182036_105881881 | 3300016270 | Soil | MPGLLQRFLPREEGFFDLFAKQADNIHEGAKALLKMLEHYTRVPEQVQIVKA |
| Ga0187803_100895452 | 3300017934 | Freshwater Sediment | MLPREESFFDMFAKQAENIQVGAKALVDMLSHYTGVP |
| Ga0187779_102212991 | 3300017959 | Tropical Peatland | MPGLLQRLMPREQGFFALFAKQAENIHRGAQTLLDMLTHY |
| Ga0187823_102602951 | 3300017993 | Freshwater Sediment | MNGLLQRLLPHETGFFDLFAKQAANIHAGADALLKMLSHYTGVPEQ |
| Ga0210407_107069992 | 3300020579 | Soil | MPGLLQRLLPREEDFFVLFDKQADNIQLGAKALLQMLEHYTGVPEQVQIVK |
| Ga0210399_102136803 | 3300020581 | Soil | MPGLLQRFLPREEGFFDLFAKQAANIHAGANALHKMLTHYT |
| Ga0210395_102846262 | 3300020582 | Soil | MPGLLQRLMPREEGFFDLFAKQAENIHDGAEALLKMLSHYT |
| Ga0210401_101352794 | 3300020583 | Soil | MTGLLQRILPREQGFFDLFARQAENIHQGAEAHLPDPLAP |
| Ga0210401_114068332 | 3300020583 | Soil | MTGLLQRFMPREEGFFDLFVQQAENIHDGAAALLKM |
| Ga0210401_114552571 | 3300020583 | Soil | MPGLLQRLMPREEGFFDLFAKQAENIHDGAEALLKMLSHYTGVPEQV |
| Ga0210404_105943592 | 3300021088 | Soil | MPGLLQRFLPREEGFFVLFAKQAANIHAGAEALLKMLSHYTGVPEQVQIVKAIEH |
| Ga0210406_103024721 | 3300021168 | Soil | MNGLLQRILPREQGFFDLFAQQAKNIHQGAEALLKMLSHYTG |
| Ga0210405_112336912 | 3300021171 | Soil | MPGLLQRLLPREEDFFVLFDKQADNIQLGAKALLQMLEHYTGVPEQ |
| Ga0210383_110664161 | 3300021407 | Soil | MNGLLQRILPREQGFFDLFAQQAENIHQGAEALLKMLSHYTGVPEQ |
| Ga0193709_10570861 | 3300021411 | Soil | MPGFLQRLLPREEGFFDLFAKQSENIVVGAKALQQM |
| Ga0210391_111355682 | 3300021433 | Soil | MPGLLQRLMPREEGFFGLFAQQAENIHNGAEALLKMLSHYTG |
| Ga0210392_102005592 | 3300021475 | Soil | MPGLLQRFLPREEGFFHLFDKQADNIVVGAKALLRMLEHYTGVP |
| Ga0210398_103346712 | 3300021477 | Soil | MPGLLQRLLPREEGFFDLFAKQAENIHEGAGALLKMLSHYTGVP |
| Ga0210402_112054101 | 3300021478 | Soil | MTGLLQRLLPREEGFFDLFRKQAENIHRGAEAFQKMLLHYTGVPEQV |
| Ga0126371_126191751 | 3300021560 | Tropical Forest Soil | MPGLLQRFLPREEGFFHLFDKQADNIVVGAKALLRMLEHYTGVPEQVQEIKAI |
| Ga0247669_100084811 | 3300024182 | Soil | MNGLLQRLLPREEGFFDLFAKQAENIHDGAEALVKMLSHYTGVP |
| Ga0247671_10066601 | 3300024284 | Soil | MNGLLQRLLPREEGFFDLFAKQAENIHDGAEALVKMLSHYTGV |
| Ga0247678_10420681 | 3300024325 | Soil | MPGLLQRFMPREEGFFDLFAKQADNVVVGAKALQAMLSHYTGVPEQV |
| Ga0137417_10699333 | 3300024330 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQASNIHVGAEALHKMLSHYTGVPE |
| Ga0207685_105532902 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGLLQRFLPREEGFFDLFAKQAENIVVGAKALQQMLSH |
| Ga0207684_103692811 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGLLQRLLPREEGFFRLFAKQAENIVVGAKALQQMLSHYT |
| Ga0207704_119039531 | 3300025938 | Miscanthus Rhizosphere | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQM |
| Ga0207689_114944472 | 3300025942 | Miscanthus Rhizosphere | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQMLAHYTGVPEQVQTIK |
| Ga0207712_116246711 | 3300025961 | Switchgrass Rhizosphere | MPGLLQRFLPREERFFELFGKQAENIVVGAKALQQMLAHYTGVPEQVQTIK |
| Ga0209238_12488401 | 3300026301 | Grasslands Soil | MPGLLQRLLPREEGFFDFFVEQAENIHAGAEALLK |
| Ga0209265_11708642 | 3300026308 | Soil | MPGLLQRFLPREEGFFDLFAKQAANIHEGANALLKMLEHYTGVPEQVQIV |
| Ga0209761_10830412 | 3300026313 | Grasslands Soil | MPGLLQRFLPREVGFYELFVKQAENINAGANALLKML |
| Ga0179587_103621203 | 3300026557 | Vadose Zone Soil | MPGLLQRLLPREQDFFVLFGKQADNIQVGARALLQML |
| Ga0209388_11318831 | 3300027655 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANIHAGADALLKMLSHYTGVPEQV |
| Ga0208981_10697882 | 3300027669 | Forest Soil | MPGLLQRFLPHEEGFFVLFAKQAANIHVGAEALLK |
| Ga0209580_102948102 | 3300027842 | Surface Soil | MPGLLQRFLPREEGFFDLFVQQAENIHAGAAALVKMLSQYTG |
| Ga0209283_106304181 | 3300027875 | Vadose Zone Soil | MPGLLQRFLPREEGFFDLFAKQAANINAGSNALLKMLSHYTAVPEQVQIVKAF |
| Ga0209169_106669551 | 3300027879 | Soil | MTGLLQRLLPREEGFFDLFRKQAENIHRGAEAFQKMLLHYTGVPE |
| Ga0265357_10121571 | 3300028023 | Rhizosphere | MPGLLQRLMPREEGFFDLFAQQAENIHTGAEALLK |
| Ga0265349_10004731 | 3300028037 | Soil | MPGLLQRLMPREEGFFDLFAQQAENIHTGAEALLKMLSHYTGVPEQVQI |
| Ga0170824_1124767731 | 3300031231 | Forest Soil | MTGVLQRLLPREEGFYQLFVTQADNIFVGAKALLEMLSHYTGAPEQ |
| Ga0318573_100313411 | 3300031564 | Soil | MTGLLQRLLPREEGFFGLLAKQAANIHEGANALLKM |
| Ga0307474_101611973 | 3300031718 | Hardwood Forest Soil | MPGLLQRLLPREEGFFDLFGKQAENIHVGAEALVKMLSHYTG |
| Ga0307469_108393282 | 3300031720 | Hardwood Forest Soil | MPGLLQRFLPREEGFFDLFAKQAVNINAGANALLKMLSHYTGVPEQVQ |
| Ga0307469_115604381 | 3300031720 | Hardwood Forest Soil | MPGLLQRFLPREEGFFELFGKQAENIVVGAKALQQMLAHYTGVPEQVQTIKAVEHH |
| Ga0307477_110240641 | 3300031753 | Hardwood Forest Soil | MPGLLQRLLPREEGFFDLFGKQAENIHVGAEALVKMLSHY |
| Ga0307478_113789982 | 3300031823 | Hardwood Forest Soil | MPGLLQRLLPREEDFFVLFDKQADNIQLGAKALLQMLEHYTG |
| Ga0307479_107727042 | 3300031962 | Hardwood Forest Soil | MPGLLQRFLPREEGFFDLFAKQAANIHSGADALLKMLSHYTGVPEQVQ |
| Ga0307479_120633521 | 3300031962 | Hardwood Forest Soil | MNGLLQRLLPREEGFFDLFAKQAENIHVGAEALVKMLSHYTGVPEQVQS |
| Ga0318532_102204962 | 3300032051 | Soil | MTGLLQRLLPREEGFFGLLAKQAANIHEGANALLKMLEHYTGVPEQVQ |
| Ga0318504_100220101 | 3300032063 | Soil | MTGLLQRLLPREEGFFGLLAKQAANIQEGANALLKMLEHYTGVPEQVQIVKAFEH |
| Ga0307470_118663141 | 3300032174 | Hardwood Forest Soil | MTGLLQRFMPREEGFFDLFVQQAENIHDGAAALLKMLSEYTGVPEQVQIVKAIE |
| Ga0307471_1003578371 | 3300032180 | Hardwood Forest Soil | MPGLLQRLLPREEDFFVLFSKQADNIQLGAKALLQMLEHYTGVPE |
| Ga0307472_1007759152 | 3300032205 | Hardwood Forest Soil | MPGLLQRLLPREEDFFVLFDKQADNIQLGSKALLQMLEHYTGVPEQV |
| Ga0335085_112332101 | 3300032770 | Soil | MPGLLQRFLPREEDFYELFVKQAQNIEKGARALVELLSHYT |
| Ga0316624_119562211 | 3300033486 | Soil | MNGLLQRILPREQGFFDLFAKQAENIHDGAEALLKMLSHYTGVP |
| ⦗Top⦘ |