


| Basic Information | |
|---|---|
| Family ID | F067013 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PPVARRYRDLTDADGELRADAPVSEREARLAGQVLRVVMRDLDPGR |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 92.06 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.095 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.318 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.635 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.651 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 2.70% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 12.70 |
| PF01964 | ThiC_Rad_SAM | 5.56 |
| PF07690 | MFS_1 | 5.56 |
| PF02775 | TPP_enzyme_C | 3.17 |
| PF01565 | FAD_binding_4 | 2.38 |
| PF16326 | ABC_tran_CTD | 1.59 |
| PF13609 | Porin_4 | 0.79 |
| PF00501 | AMP-binding | 0.79 |
| PF13519 | VWA_2 | 0.79 |
| PF00682 | HMGL-like | 0.79 |
| PF01019 | G_glu_transpept | 0.79 |
| PF02276 | CytoC_RC | 0.79 |
| PF00909 | Ammonium_transp | 0.79 |
| PF00486 | Trans_reg_C | 0.79 |
| PF01494 | FAD_binding_3 | 0.79 |
| PF13360 | PQQ_2 | 0.79 |
| PF01740 | STAS | 0.79 |
| PF01558 | POR | 0.79 |
| PF13581 | HATPase_c_2 | 0.79 |
| PF01011 | PQQ | 0.79 |
| PF03600 | CitMHS | 0.79 |
| PF01261 | AP_endonuc_2 | 0.79 |
| PF00082 | Peptidase_S8 | 0.79 |
| PF14329 | DUF4386 | 0.79 |
| PF13358 | DDE_3 | 0.79 |
| PF00069 | Pkinase | 0.79 |
| PF13505 | OMP_b-brl | 0.79 |
| PF00116 | COX2 | 0.79 |
| PF05292 | MCD | 0.79 |
| PF03928 | HbpS-like | 0.79 |
| PF00083 | Sugar_tr | 0.79 |
| PF13193 | AMP-binding_C | 0.79 |
| PF07517 | SecA_DEAD | 0.79 |
| PF07519 | Tannase | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 5.56 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.17 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.59 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.79 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.79 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.79 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.79 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.79 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.79 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.79 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.79 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.10 % |
| Unclassified | root | N/A | 11.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000571|JGI1358J11329_10034753 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300001356|JGI12269J14319_10247559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300001431|F14TB_100029319 | Not Available | 529 | Open in IMG/M |
| 3300001593|JGI12635J15846_10069435 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300002886|JGI25612J43240_1033828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300004092|Ga0062389_101257686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300004152|Ga0062386_100217534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1506 | Open in IMG/M |
| 3300004152|Ga0062386_100306974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300004635|Ga0062388_102909670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
| 3300005174|Ga0066680_10827204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300005187|Ga0066675_10707905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300005294|Ga0065705_10352991 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005434|Ga0070709_11810405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005541|Ga0070733_10121515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300005574|Ga0066694_10303231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300005591|Ga0070761_10404539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300005764|Ga0066903_102251662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300005937|Ga0081455_10177255 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300006174|Ga0075014_100189839 | Not Available | 1029 | Open in IMG/M |
| 3300006176|Ga0070765_100382228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300006852|Ga0075433_10606597 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006852|Ga0075433_11587073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300006864|Ga0066797_1320119 | Not Available | 542 | Open in IMG/M |
| 3300006903|Ga0075426_11401095 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006904|Ga0075424_101685488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300009088|Ga0099830_11371710 | Not Available | 588 | Open in IMG/M |
| 3300009090|Ga0099827_11075544 | Not Available | 698 | Open in IMG/M |
| 3300009101|Ga0105247_10445286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 932 | Open in IMG/M |
| 3300009137|Ga0066709_102463301 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009162|Ga0075423_10446140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
| 3300009162|Ga0075423_10499350 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300009444|Ga0114945_11060829 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009548|Ga0116107_1057793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1288 | Open in IMG/M |
| 3300009552|Ga0116138_1037073 | Not Available | 1436 | Open in IMG/M |
| 3300009621|Ga0116116_1055032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300009623|Ga0116133_1056099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300009628|Ga0116125_1000531 | All Organisms → cellular organisms → Bacteria | 17677 | Open in IMG/M |
| 3300009639|Ga0116122_1147421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300009645|Ga0116106_1184690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300009665|Ga0116135_1259432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300009760|Ga0116131_1133689 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300010329|Ga0134111_10548422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 512 | Open in IMG/M |
| 3300010336|Ga0134071_10710232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010339|Ga0074046_10006583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9109 | Open in IMG/M |
| 3300010343|Ga0074044_10073375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2315 | Open in IMG/M |
| 3300010366|Ga0126379_10358020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
| 3300010371|Ga0134125_12009575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 628 | Open in IMG/M |
| 3300010379|Ga0136449_100591613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1894 | Open in IMG/M |
| 3300011119|Ga0105246_12164222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300011269|Ga0137392_11344287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300012210|Ga0137378_10257834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300012225|Ga0137434_1005713 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300012683|Ga0137398_10410501 | Not Available | 923 | Open in IMG/M |
| 3300012917|Ga0137395_10220902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
| 3300012917|Ga0137395_10945960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300012918|Ga0137396_10492209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300012925|Ga0137419_10670424 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300014156|Ga0181518_10134095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
| 3300014162|Ga0181538_10216163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300014162|Ga0181538_10218662 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300014326|Ga0157380_10578235 | Not Available | 1107 | Open in IMG/M |
| 3300015054|Ga0137420_1450428 | Not Available | 1229 | Open in IMG/M |
| 3300016698|Ga0181503_1031697 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017928|Ga0187806_1053866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1227 | Open in IMG/M |
| 3300017948|Ga0187847_10837537 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017973|Ga0187780_11212597 | Not Available | 553 | Open in IMG/M |
| 3300017993|Ga0187823_10150778 | Not Available | 733 | Open in IMG/M |
| 3300017997|Ga0184610_1047467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1260 | Open in IMG/M |
| 3300017998|Ga0187870_1272508 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018017|Ga0187872_10178340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300018025|Ga0187885_10224413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300018025|Ga0187885_10508158 | Not Available | 537 | Open in IMG/M |
| 3300018053|Ga0184626_10102217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1215 | Open in IMG/M |
| 3300018074|Ga0184640_10084184 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300018078|Ga0184612_10204695 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300018082|Ga0184639_10327995 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300018084|Ga0184629_10625820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300019487|Ga0187893_10868964 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300020580|Ga0210403_10662602 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300020582|Ga0210395_10106712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
| 3300020582|Ga0210395_10405636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300021081|Ga0210379_10177899 | Not Available | 912 | Open in IMG/M |
| 3300021180|Ga0210396_11343993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300021401|Ga0210393_11026041 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300021404|Ga0210389_10466596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
| 3300021420|Ga0210394_10100858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2497 | Open in IMG/M |
| 3300021432|Ga0210384_10386850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300021478|Ga0210402_11452059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300021479|Ga0210410_10527780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300021559|Ga0210409_11575593 | Not Available | 533 | Open in IMG/M |
| 3300022509|Ga0242649_1033646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300022715|Ga0242678_1027885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300023255|Ga0224547_1045332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300025477|Ga0208192_1054252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300025494|Ga0207928_1021059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1269 | Open in IMG/M |
| 3300025907|Ga0207645_10765927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 656 | Open in IMG/M |
| 3300026089|Ga0207648_11054872 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300026116|Ga0207674_11264320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300026328|Ga0209802_1295683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300027645|Ga0209117_1002446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6446 | Open in IMG/M |
| 3300027825|Ga0209039_10423699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300027835|Ga0209515_10202964 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300027854|Ga0209517_10469906 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300027867|Ga0209167_10080991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1637 | Open in IMG/M |
| 3300027867|Ga0209167_10169172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300028017|Ga0265356_1032918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300028047|Ga0209526_10374623 | Not Available | 949 | Open in IMG/M |
| 3300028536|Ga0137415_10753994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 784 | Open in IMG/M |
| 3300028565|Ga0302145_10133443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300028775|Ga0302231_10028746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2393 | Open in IMG/M |
| 3300028784|Ga0307282_10353765 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300028906|Ga0308309_11193779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300029943|Ga0311340_11329048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300029951|Ga0311371_10820197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300029992|Ga0302276_10384758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300030707|Ga0310038_10007022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 7768 | Open in IMG/M |
| 3300031093|Ga0308197_10337762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300031122|Ga0170822_15466425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 536 | Open in IMG/M |
| 3300031708|Ga0310686_115313859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300031708|Ga0310686_119855734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300031823|Ga0307478_11507662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300031834|Ga0315290_11181712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 636 | Open in IMG/M |
| 3300032180|Ga0307471_102432233 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300032805|Ga0335078_11770033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300034282|Ga0370492_0465176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300034354|Ga0364943_0166961 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.59% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.59% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.59% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.79% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.79% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000571 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1358J11329_100347534 | 3300000571 | Groundwater | ARLPPVARNYRDLTDADGELRADAPVSEREARLSGQVLRVVMRDLDPGR* |
| JGI12269J14319_102475593 | 3300001356 | Peatlands Soil | ARLPAVARTYRDDDGNDTTTVSERDARLAGQVLRVVMRDLDPGR* |
| F14TB_1000293191 | 3300001431 | Soil | LPPVARRYRELLDADGRLPKDVAVSARDARTATQVLRIVMSDLDPGR* |
| JGI12635J15846_100694351 | 3300001593 | Forest Soil | KTGLIRGGCARLPAVAWNYRDESGSAKAAASENDARRTGQVLHVVMRDLDPGR* |
| JGI25612J43240_10338281 | 3300002886 | Grasslands Soil | IRGGCARLPPVARAYHDLTDESGELRAGVHVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0062389_1012576863 | 3300004092 | Bog Forest Soil | CARLPAVARAYRDHDIANVESDPKATVSERDARQTGQVLHVVMRDLDPGR* |
| Ga0062386_1002175341 | 3300004152 | Bog Forest Soil | RLPAIARTYRDQVDVDAMTSKPEISERDARQTSQVLRVVMRDLDPGR* |
| Ga0062386_1003069744 | 3300004152 | Bog Forest Soil | RLPAVARTYRDHTDAEGDSGPKATVSERDARRAGQVLHVVMRDLDPGR* |
| Ga0062388_1029096702 | 3300004635 | Bog Forest Soil | AGLIRGGCARLPSVAWTYREHGSKAPISENDARRAGQVLHVIMRDLDPGR* |
| Ga0066680_108272041 | 3300005174 | Soil | ARSYRDLTYAKGESGAKATVSERHARLAGQVLHVVMRDLSPGR* |
| Ga0066675_107079052 | 3300005187 | Soil | AGLILGGCARLPPVARAYRDLADGTGELRSDIAVSEREARLAGQVLRVVIRDLDPGR* |
| Ga0065705_103529912 | 3300005294 | Switchgrass Rhizosphere | GVIQGGCARLPPVARQYRDLTDSDGALRPDVRVSEREARLAGQVLVVVMRDLDPGR* |
| Ga0070709_118104051 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IRGGCTRLPAVARTYRDPIGTVPASVTEREARTTGQVLHVVMRDLDPGR* |
| Ga0070733_101215155 | 3300005541 | Surface Soil | NGCARLPAVVRTYRDPTNTDDKSGPKTAVSERNARLAGQVLHVVMRDLDPGR* |
| Ga0066694_103032311 | 3300005574 | Soil | LPPVARTYRDLTDAEGQFRSDVSVSERDARITAQVLHVVMRDLDPGR* |
| Ga0070761_104045393 | 3300005591 | Soil | RLPAVARTYRDDGGDDATTVSERDARLAGQVLRVVMRDLDPGR* |
| Ga0066903_1022516622 | 3300005764 | Tropical Forest Soil | PPVARTYRSLVDDHGQLRGDAQVSEREARIATQVLRVVMRDLDPGR* |
| Ga0081455_101772552 | 3300005937 | Tabebuia Heterophylla Rhizosphere | IRGGCARLPAVARGYHELTDEAGDLRAGAQVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0075014_1001898391 | 3300006174 | Watersheds | AWRYRDLTAVEGEPGPSAKVSEDDARRALQVLHVVMRDLDPGR* |
| Ga0070765_1003822283 | 3300006176 | Soil | LPVVAWTYRDNGENGLMPTISEGDARRAGQVLRVVMRDLDPGR* |
| Ga0075433_106065971 | 3300006852 | Populus Rhizosphere | LPPVARAYHDLTDETGELRAGVHVTEREAKLAGQVLRVVMRDLDPGR* |
| Ga0075433_115870732 | 3300006852 | Populus Rhizosphere | EAGELRAGVHVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0066797_13201191 | 3300006864 | Soil | PPVARRYRDLTDADGELRVDAPVSEREARLAGQVLRVVMRDLDPGR* |
| Ga0075426_114010952 | 3300006903 | Populus Rhizosphere | EDGHVRPGAIVSERAARLAGQVLRVVIRDLDPQR* |
| Ga0075424_1016854882 | 3300006904 | Populus Rhizosphere | TDEAGELRAGVHVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0099830_113717101 | 3300009088 | Vadose Zone Soil | SPTDAAGDLRPDVTISERKTQLAGQVLRVVMRDLDPGQ* |
| Ga0099827_110755441 | 3300009090 | Vadose Zone Soil | KYRDLTDADGELRPDAQVSERDARLADQVLRVVMRDLDPGR* |
| Ga0105247_104452862 | 3300009101 | Switchgrass Rhizosphere | AYRDLTDADGHLRPDVSVSERDARVAGQVLRVVMRDLDPSR* |
| Ga0066709_1024633012 | 3300009137 | Grasslands Soil | VARVYHYRTDESGELRAGVHVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0075423_104461401 | 3300009162 | Populus Rhizosphere | YHDLTDEAGELRAGVHVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0075423_104993501 | 3300009162 | Populus Rhizosphere | IIRGGCARLPPVARAYHDLTDEAGELRAGVHVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0114945_110608291 | 3300009444 | Thermal Springs | IGGGCARLPPVARTYRDLTDADGELRADVNVSEREARLAAQVLRVVMRDLNPGR* |
| Ga0116107_10577934 | 3300009548 | Peatland | ARLPAVARTYRDRADAGGESRPKATVSERDARQTGQVLRVVMRDLDPGR* |
| Ga0116138_10370732 | 3300009552 | Peatland | YRDYTDGGDGSELKATVTDRDARQAGQVLHVVMRDLDPGR* |
| Ga0116116_10550321 | 3300009621 | Peatland | PAVARTYRDRADAGGESRPKATVSERDARQTGQVLRVVMRDLDPGR* |
| Ga0116133_10560993 | 3300009623 | Peatland | NGCARLPAVARTYRDYTDADSGPKTTVSERDARVAGQVLHVVMRDLDPGR* |
| Ga0116125_10005311 | 3300009628 | Peatland | RDRGEVPAGTQVSEREARLCAQVLRVIMRDLDPGR* |
| Ga0116122_11474211 | 3300009639 | Peatland | RDYTDADSGPKTTVSERDARVAGQVLHVVMRDLDPGR* |
| Ga0116106_11846903 | 3300009645 | Peatland | LIRSGCARLPAVARTYRDYTDSDSGPKTTVSERDARVAGQVLHVVMRDLDPGR* |
| Ga0116135_12594321 | 3300009665 | Peatland | LPAVARTYRDQGDGAQRVKISERDARLAGQVLNVVMRDLDPSR* |
| Ga0116131_11336891 | 3300009760 | Peatland | IRSGCARLPAAARTYRDYTDANGEQGLKATVSARDARQTGQVLRVVMRDLDPGR* |
| Ga0134111_105484222 | 3300010329 | Grasslands Soil | RLPAVARRYKDLTDPDGQVRPGAAVSERDARVAGQVLRVVMRDLDPGR* |
| Ga0134071_107102322 | 3300010336 | Grasslands Soil | EGLIRGGCARLPPVARTYRDLTDAEGQFRSDVSVSERDARVTTQVLHVVMRDLDPGR* |
| Ga0074046_1000658312 | 3300010339 | Bog Forest Soil | CARLPAVARTYRDHTDAEGDSGPKATVSERDARRAGQVLHVVMRDLDPGR* |
| Ga0074044_100733755 | 3300010343 | Bog Forest Soil | YARLPAVARRYRDLTDAGESGGPKATVSERDARLAGQVLHVVMRDLDPGR* |
| Ga0126379_103580201 | 3300010366 | Tropical Forest Soil | YHDLTDEAGELRAGVHVTAHEARLAGQVLRVVMRDLDPGR* |
| Ga0134125_120095752 | 3300010371 | Terrestrial Soil | GCARLPAVARAYHDLTDEAGELRTGVQVTEREARLAGQVLRVVMRDLDPGR* |
| Ga0136449_1005916135 | 3300010379 | Peatlands Soil | LPAVARTYRDHTPADSESGPKAIVSERDARQAGQVLRVVMRDLDPGR* |
| Ga0105246_121642221 | 3300011119 | Miscanthus Rhizosphere | RQYRDLTDADGELRAEAVVSEREARLAGQVLRVVMRDLDPGR* |
| Ga0137392_113442871 | 3300011269 | Vadose Zone Soil | SGWARLPAVARTYRDLTHANGESGAKATVSERNARLAAQVLHVVMRDLNPGR* |
| Ga0137378_102578341 | 3300012210 | Vadose Zone Soil | RLPLVARTYRNLTDANGESHSKATVSESDARRTGQVLHVVMRDLDPGR* |
| Ga0137434_10057132 | 3300012225 | Soil | RDLTDADGELRADAKVSEREARLAGQVLRVVMRDLDPGR* |
| Ga0137398_104105011 | 3300012683 | Vadose Zone Soil | GCARLPAIARSYRDVAESNGDGGLKATVSARDARTAGQVLHVVMRDLNPGR* |
| Ga0137395_102209022 | 3300012917 | Vadose Zone Soil | LPQVARKYRELADAGGERGPKVMISERDARLAGQVLHVVMRDLHPGR* |
| Ga0137395_109459602 | 3300012917 | Vadose Zone Soil | LPQVARKYRELADAGGERGPKVMISERDARLAGQVLHVVMRDLDPGRY* |
| Ga0137396_104922091 | 3300012918 | Vadose Zone Soil | RSGCARLPLVARTYRNLTDANGDSRSKATISERDARRTGQVLHVVMRDLDPGR* |
| Ga0137419_106704241 | 3300012925 | Vadose Zone Soil | VARQYKDLSDADGRLRPDATVSERDARVAGQVLHVVMRDLDPGR* |
| Ga0181518_101340951 | 3300014156 | Bog | LPAVSRAYRDLTDTNDEGGSKAISERDARQTGQVLHVVMKDLDPGR* |
| Ga0181538_102161634 | 3300014162 | Bog | ARAYRDLTVSNGERGLKAKVSDRDARMAGQVLRVVMRDLDPGR* |
| Ga0181538_102186621 | 3300014162 | Bog | PAIAQSYRELISTNGQQRSQAGVSERDARVTGQVLHVVMRDLNPGR* |
| Ga0157380_105782352 | 3300014326 | Switchgrass Rhizosphere | RLPAQARTYRDLTDAEGQLRSDVTVSERDARITSQVLHVVMRDLNPGR* |
| Ga0137420_14504284 | 3300015054 | Vadose Zone Soil | CARLPLVARTYRNLTDANGESHSKATISERDARRTGQVLHVVMRDLDPGR* |
| Ga0181503_10316971 | 3300016698 | Peatland | RAYRDHSGAEGSGELNSKVTERDARQTGQVLHVVMRDLDPGR |
| Ga0187806_10538661 | 3300017928 | Freshwater Sediment | RTYRDDGGNDTTTVSERDARLAGQVLRVVMRDLDPGR |
| Ga0187847_108375372 | 3300017948 | Peatland | GIARAYRDHTGAEGGDGPNNKITERDARQTGQVLHVVMRDLDPGR |
| Ga0187780_112125972 | 3300017973 | Tropical Peatland | DLTDGNGEPLGDAPVSEREARTAAQVLRVVMRDLDPGR |
| Ga0187823_101507782 | 3300017993 | Freshwater Sediment | ARRYRDLNVAGSDLGSEITVSERDARLAGQVLHVTMRDLDPGR |
| Ga0184610_10474671 | 3300017997 | Groundwater Sediment | AGIIHGGCARLSPVARSYRDLTDVDGELRQDVTVSEREARLAGQVLRVVMRDLDPGR |
| Ga0187870_12725081 | 3300017998 | Peatland | DGGDGSELKATVTDRDARQAGQVLHVVMRDLDPGR |
| Ga0187872_101783401 | 3300018017 | Peatland | IRSGCAGLPAIARTYRDYTDADGGPKATVSERDARVTGQVLHVVMRDLDPGR |
| Ga0187885_102244133 | 3300018025 | Peatland | LPAVARTYRDYTDADGGPKATVSERDARVAGQVLHVVMRDLDPGR |
| Ga0187885_105081581 | 3300018025 | Peatland | YRDHSDAEDELGTNATVSERDARQAGQVLHVVMRDLDPGR |
| Ga0184626_101022171 | 3300018053 | Groundwater Sediment | RGGCARLPPVARTYRDLTDAAGELRADAPVSERDARVAGQVLRVVMRDLDPGR |
| Ga0184640_100841842 | 3300018074 | Groundwater Sediment | PPVARRYRDLTDADGELRADAPVSEREARLAGQVLRVVMRDLDPGR |
| Ga0184612_102046951 | 3300018078 | Groundwater Sediment | GADGELRADAPVSEREARLAGQVLRVVMRDLDPGR |
| Ga0184639_103279952 | 3300018082 | Groundwater Sediment | MLPIVPPVARKYRDLTDADGELHADAPVSEREARLAGQVLRVVMRDLDPGR |
| Ga0184629_106258202 | 3300018084 | Groundwater Sediment | CARLPHVARTYQDLTDADGELLSDAPVSEREARLAGQVLRVVMRDLDPGR |
| Ga0187893_108689642 | 3300019487 | Microbial Mat On Rocks | RTYRELANPDGQPRPDVTISEREARLAGQVLQVVMRDLDPGR |
| Ga0210403_106626021 | 3300020580 | Soil | YREHTDDGGENRVKIQVSERDARRTGQVLHVVMRDLDPGR |
| Ga0210395_101067121 | 3300020582 | Soil | RLPAVARTYRDDGGDDATTVSERDARLAGQVLRVVMRDLDPGR |
| Ga0210395_104056362 | 3300020582 | Soil | RSGCARLPAAARNYRDHADVDGESGSKSSISERDARRAGQVLHVVIRDLDPGR |
| Ga0210379_101778991 | 3300021081 | Groundwater Sediment | RDLTDATGELRADAPVSEREARLAGQVLRVVMRDLDPGR |
| Ga0210396_113439932 | 3300021180 | Soil | ARLPVVAWIYRDHGENSSEATISENDARRAGQVLHVVMRDLDPGR |
| Ga0210393_110260412 | 3300021401 | Soil | RLPAIARTYRDQTSADGGSAFEVEVAERDAKLTGQVLRVVMRDLDPGR |
| Ga0210389_104665961 | 3300021404 | Soil | RDHDDNGLKSTVSERDARQTGQVLHVVMRDLDPGR |
| Ga0210394_101008581 | 3300021420 | Soil | ARLPAAARRYRDHNENDAAGISERDARLAGQVLHVLMRDLNPGR |
| Ga0210384_103868501 | 3300021432 | Soil | TYRDDSGDDATTVSERDARLAGQVLRVVMRDLDPGR |
| Ga0210402_114520591 | 3300021478 | Soil | IRGGCARLPAVARAYRDHVDNGKSVTISERDARLAGQVLNVIMRDLNPGR |
| Ga0210410_105277804 | 3300021479 | Soil | LIRSGCARLPAAARTYRDHTDTPSENGAEANISERDARVAGQVLHVVMRDLDPGR |
| Ga0210409_115755931 | 3300021559 | Soil | RSGCARLPATARTYRDRVSSDSEGVGQGTVSESDARRTGQVLHVIMRDLDPGR |
| Ga0242649_10336461 | 3300022509 | Soil | IRSGCARLPAVARTYRDLTDADCESGSKATVSESNARLAGQVLRVVMRDLDPGR |
| Ga0242678_10278851 | 3300022715 | Soil | AVARTYRDLTDADCESGSKATVSESNARLAGQVLRVVMRDLDPGR |
| Ga0224547_10453321 | 3300023255 | Soil | RSGCARLPAIARTYRDRMNAEGDSIPQGTVSESDAKRTGQVLHVIMRDLDPGR |
| Ga0208192_10542523 | 3300025477 | Peatland | RTYRDHTDAGGGPKTTVSERDARVAGQVLHVVMRDLDPGR |
| Ga0207928_10210592 | 3300025494 | Arctic Peat Soil | IRSGCARLPPVTRRYRDLTDADGELRAHAPVSEREARIAAQVLRVVMRDLDPGR |
| Ga0207645_107659272 | 3300025907 | Miscanthus Rhizosphere | PVARAYRDIAAADGEPAPDVPVSERDARVAGQVLLVVMRDLDPGR |
| Ga0207648_110548721 | 3300026089 | Miscanthus Rhizosphere | ILGGCARLPPVARAYRDLSDADGQLRPDVAVSGRDAQLARQVLMVVLRDLDPGR |
| Ga0207674_112643202 | 3300026116 | Corn Rhizosphere | GGCARLPPVARQYRDLTDADGELRAEAVVSEREARLAGQVLRVVMRDLDPGR |
| Ga0209802_12956831 | 3300026328 | Soil | ARSYRDLTYAKGESGAKATVSERHARLAGQVLHVVMRDLSPGR |
| Ga0209117_10024461 | 3300027645 | Forest Soil | RGGCARLPEVARKYRDSADTNGDGHSKAGVSEREARLTGQVLHVVMRDLDPGR |
| Ga0209039_104236992 | 3300027825 | Bog Forest Soil | RLPAIARTYRDQVDVDAMTSKPEISERDARQTSQVLRVVMRDLDPGR |
| Ga0209515_102029642 | 3300027835 | Groundwater | RDLTDSDGEPGPDVTVSERDARLAGQVLHVIMRDLDPGR |
| Ga0209517_104699062 | 3300027854 | Peatlands Soil | RTYRDYTDGGDGSELKATVTDRDARQAGQVLHVVMRDLDPGR |
| Ga0209167_100809915 | 3300027867 | Surface Soil | IARTYRDDGENETTMASERDARLAGQVLRVVMRDLDPGR |
| Ga0209167_101691721 | 3300027867 | Surface Soil | NGCARLPAVVRTYRDPTNTDDKSGPKTAVSERNARLAGQVLHVVMRDLDPGR |
| Ga0265356_10329181 | 3300028017 | Rhizosphere | ARAYRDEGGGVKAEVTERDARTAGQVLHVVMRDLDPGR |
| Ga0209526_103746231 | 3300028047 | Forest Soil | IHSGCARLPPVARRYRDINVDGSDLSSDITVSERDARLAGQVLHVVMRDLDPGR |
| Ga0137415_107539941 | 3300028536 | Vadose Zone Soil | GCARLPLVARTYRNLTDANGDSRSKATISERDARRTGQVLHVVMRDLDPGR |
| Ga0302145_101334431 | 3300028565 | Bog | RGGCARLPAVARAYRDEAQADSSAEISERDARTTGQVLNVVMRDLDPGR |
| Ga0302231_100287461 | 3300028775 | Palsa | EDDSGNEMKATISEREARLAGQVLHVVMRDLDPGR |
| Ga0307282_103537651 | 3300028784 | Soil | ARLPAVARSYRDLTDADGQLRSDVAVSGREAQLARQVLMVVLRDLDPGR |
| Ga0308309_111937793 | 3300028906 | Soil | IARTYRDDGETDTTAVSERDARLAGQVLRVVMRDLDPGR |
| Ga0311340_113290481 | 3300029943 | Palsa | LPAVARAYRENSQAAEERDTQAPVSERDARQAGQVLRVVMRDLDPGR |
| Ga0311371_108201972 | 3300029951 | Palsa | RDPADADGGSKAAVSERDARLAGQVLRVVMRDLDPGR |
| Ga0302276_103847582 | 3300029992 | Bog | GCARLPAVARTYRDPTEANGENVLKATASERDARLAGQVLHVIMRDLDPGR |
| Ga0310038_100070229 | 3300030707 | Peatlands Soil | TYRDDDGNDTTTVSERDARLAGQVLRVVMRDLDPGR |
| Ga0308197_103377621 | 3300031093 | Soil | GLIRSGCARLPPVARRYKDLTDGDGELRADATVSEREARLAGQVLHVVMRDLDPGR |
| Ga0170822_154664252 | 3300031122 | Forest Soil | ARLPEVAWTYRDHDEGGSDMAISEQDARRAGQVLHVVMRDLDPGR |
| Ga0310686_1153138591 | 3300031708 | Soil | ARLPAVARTYRDAEGGSKAIVSERDAQVAGQVLRVVMRDLDPGR |
| Ga0310686_1198557341 | 3300031708 | Soil | ARLPTIARTYRDDGEKGSRTMVSEHDARKAGQVLHVIMRDLDPGR |
| Ga0307478_115076621 | 3300031823 | Hardwood Forest Soil | LIRSGCARLPAIARTYRDRMNAEGDSVPRETVSESDAKRTGQVLHVIMRDLDPGR |
| Ga0315290_111817122 | 3300031834 | Sediment | PVARTYRDLTDADGELRVDAPVSEREARLAGQVLRVVMRDLDPGR |
| Ga0307471_1024322331 | 3300032180 | Hardwood Forest Soil | GGCARLPAVARAYHDLTDESGELLAGAHVTERDARLAAQVLRVVMRDLDPGR |
| Ga0335078_117700331 | 3300032805 | Soil | RGGCARLPAIARSYRDLISADAGHRPEASVSERDARVTGQVLHVVMRDLNPGR |
| Ga0370492_0465176_291_425 | 3300034282 | Untreated Peat Soil | VARTYRDPTEANGENVLKATASERDARLAGQVLHVIMRDLDPGR |
| Ga0364943_0166961_2_136 | 3300034354 | Sediment | VARRYRELTDGDGAPRPDVTVSEREARTAGQVLVVVMRDLDPGR |
| ⦗Top⦘ |