


| Basic Information | |
|---|---|
| Family ID | F066996 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRSTRRTLPKNVELMPQHQDLGLQLLSRLEAVAQHADEQEADCNHAAMMF |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.78 % |
| % of genes near scaffold ends (potentially truncated) | 34.13 % |
| % of genes from short scaffolds (< 2000 bps) | 73.81 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.254 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.635 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.587 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.59% β-sheet: 0.00% Coil/Unstructured: 56.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00665 | rve | 4.76 |
| PF01042 | Ribonuc_L-PSP | 3.17 |
| PF13683 | rve_3 | 3.17 |
| PF05362 | Lon_C | 2.38 |
| PF02190 | LON_substr_bdg | 2.38 |
| PF00873 | ACR_tran | 1.59 |
| PF04392 | ABC_sub_bind | 1.59 |
| PF04632 | FUSC | 1.59 |
| PF01593 | Amino_oxidase | 1.59 |
| PF07885 | Ion_trans_2 | 1.59 |
| PF12142 | PPO1_DWL | 1.59 |
| PF06114 | Peptidase_M78 | 0.79 |
| PF00072 | Response_reg | 0.79 |
| PF01152 | Bac_globin | 0.79 |
| PF00581 | Rhodanese | 0.79 |
| PF01979 | Amidohydro_1 | 0.79 |
| PF04343 | DUF488 | 0.79 |
| PF05598 | DUF772 | 0.79 |
| PF00155 | Aminotran_1_2 | 0.79 |
| PF12625 | Arabinose_bd | 0.79 |
| PF06356 | DUF1064 | 0.79 |
| PF15887 | Peptidase_Mx | 0.79 |
| PF00486 | Trans_reg_C | 0.79 |
| PF13565 | HTH_32 | 0.79 |
| PF14681 | UPRTase | 0.79 |
| PF00589 | Phage_integrase | 0.79 |
| PF09361 | Phasin_2 | 0.79 |
| PF00239 | Resolvase | 0.79 |
| PF05990 | DUF900 | 0.79 |
| PF01255 | Prenyltransf | 0.79 |
| PF04116 | FA_hydroxylase | 0.79 |
| PF00884 | Sulfatase | 0.79 |
| PF04545 | Sigma70_r4 | 0.79 |
| PF00216 | Bac_DNA_binding | 0.79 |
| PF01263 | Aldose_epim | 0.79 |
| PF02322 | Cyt_bd_oxida_II | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 4.76 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 4.76 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 4.76 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 4.76 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 3.17 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 2.38 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 2.38 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 2.38 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 2.38 |
| COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 1.59 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.59 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.79 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.79 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.79 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.79 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.79 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.79 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.79 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.79 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.79 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.79 |
| COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.25 % |
| Unclassified | root | N/A | 31.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_104519154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2895 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100360580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1334 | Open in IMG/M |
| 3300004152|Ga0062386_100108400 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| 3300004479|Ga0062595_100967059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300005171|Ga0066677_10634033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300005172|Ga0066683_10440745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 800 | Open in IMG/M |
| 3300005172|Ga0066683_10736634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300005175|Ga0066673_10309130 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005178|Ga0066688_10715731 | Not Available | 634 | Open in IMG/M |
| 3300005186|Ga0066676_11111787 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005332|Ga0066388_101652392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
| 3300005434|Ga0070709_10051701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2579 | Open in IMG/M |
| 3300005439|Ga0070711_100457339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1046 | Open in IMG/M |
| 3300005552|Ga0066701_10899897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300005553|Ga0066695_10145142 | Not Available | 1476 | Open in IMG/M |
| 3300005575|Ga0066702_10776685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300005713|Ga0066905_101808832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300005937|Ga0081455_10041056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4074 | Open in IMG/M |
| 3300006034|Ga0066656_10684636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300006175|Ga0070712_100192388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1597 | Open in IMG/M |
| 3300006797|Ga0066659_11658041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300007255|Ga0099791_10056389 | Not Available | 1764 | Open in IMG/M |
| 3300009012|Ga0066710_100262548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2505 | Open in IMG/M |
| 3300009012|Ga0066710_102927295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300009089|Ga0099828_10280346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1498 | Open in IMG/M |
| 3300009089|Ga0099828_11645661 | Not Available | 565 | Open in IMG/M |
| 3300009090|Ga0099827_10384865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300009090|Ga0099827_11410519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300009094|Ga0111539_10429685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300009137|Ga0066709_101290302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300009137|Ga0066709_102500561 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009143|Ga0099792_10309166 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300009147|Ga0114129_10510832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300009156|Ga0111538_11692899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300009792|Ga0126374_11227041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300010043|Ga0126380_11722146 | Not Available | 564 | Open in IMG/M |
| 3300010046|Ga0126384_10190432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1615 | Open in IMG/M |
| 3300010047|Ga0126382_11224972 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010048|Ga0126373_12521694 | Not Available | 573 | Open in IMG/M |
| 3300010166|Ga0126306_11219066 | Not Available | 619 | Open in IMG/M |
| 3300010335|Ga0134063_10721597 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010337|Ga0134062_10248356 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010359|Ga0126376_11312139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300010359|Ga0126376_12991236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300010360|Ga0126372_12249660 | Not Available | 595 | Open in IMG/M |
| 3300010361|Ga0126378_12210938 | Not Available | 628 | Open in IMG/M |
| 3300010362|Ga0126377_13322768 | Not Available | 520 | Open in IMG/M |
| 3300010398|Ga0126383_10421495 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300012199|Ga0137383_10189563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1507 | Open in IMG/M |
| 3300012200|Ga0137382_10929639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300012211|Ga0137377_10643963 | Not Available | 996 | Open in IMG/M |
| 3300012285|Ga0137370_10335684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 907 | Open in IMG/M |
| 3300012350|Ga0137372_10417466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
| 3300012362|Ga0137361_10224910 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300012362|Ga0137361_11177022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300012362|Ga0137361_11392346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300012582|Ga0137358_10876280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300012685|Ga0137397_10971871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300012918|Ga0137396_10238325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1341 | Open in IMG/M |
| 3300012922|Ga0137394_11046377 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012972|Ga0134077_10331060 | Not Available | 645 | Open in IMG/M |
| 3300012986|Ga0164304_11020021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300016319|Ga0182033_10504660 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300016341|Ga0182035_10880382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
| 3300016371|Ga0182034_11650633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300016404|Ga0182037_11742524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300017657|Ga0134074_1060824 | Not Available | 1280 | Open in IMG/M |
| 3300018078|Ga0184612_10607159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300018433|Ga0066667_10215248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1426 | Open in IMG/M |
| 3300018468|Ga0066662_12309791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300018482|Ga0066669_10193644 | Not Available | 1548 | Open in IMG/M |
| 3300018482|Ga0066669_10886450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300021168|Ga0210406_10130242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2121 | Open in IMG/M |
| 3300021478|Ga0210402_10881331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 821 | Open in IMG/M |
| 3300021560|Ga0126371_10604467 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300024288|Ga0179589_10040666 | Not Available | 1698 | Open in IMG/M |
| 3300025915|Ga0207693_11403326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300025916|Ga0207663_10236038 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300026308|Ga0209265_1065490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
| 3300026319|Ga0209647_1219803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300026327|Ga0209266_1156051 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300026508|Ga0257161_1118418 | Not Available | 555 | Open in IMG/M |
| 3300026551|Ga0209648_10821568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300027070|Ga0208365_1013093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Thermohalobaculum → Thermohalobaculum xanthum | 1036 | Open in IMG/M |
| 3300028710|Ga0307322_10172798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300031544|Ga0318534_10809647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031679|Ga0318561_10062391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1892 | Open in IMG/M |
| 3300031751|Ga0318494_10757262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300031763|Ga0318537_10038901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1708 | Open in IMG/M |
| 3300031770|Ga0318521_10832337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031890|Ga0306925_11489051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300031897|Ga0318520_10365595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300031910|Ga0306923_12115244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300031912|Ga0306921_12226273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300031941|Ga0310912_10013631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5213 | Open in IMG/M |
| 3300031945|Ga0310913_10167880 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300031947|Ga0310909_10112875 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300032043|Ga0318556_10586874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300032052|Ga0318506_10074398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300032054|Ga0318570_10166657 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300032180|Ga0307471_101904914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300032261|Ga0306920_100231530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2756 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.79% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1045191546 | 3300000955 | Soil | MRSPWRALLQDIELMPQHQDLGFKLLPRLEVVAQHANEQKADCNHAAMMF* |
| JGIcombinedJ26739_1003605801 | 3300002245 | Forest Soil | MRSTWRTLPKNVELMPQHQHLGLQLLSRLEAVAQHANEKEANCNPAAIMF* |
| Ga0062386_1001084002 | 3300004152 | Bog Forest Soil | MRSTWRALPKNIELMPQHQDLGFQLLSRLEAVAQHADEQEADCNHAAIMFRFAADRESIG |
| Ga0062595_1009670591 | 3300004479 | Soil | AQRSLLQHIQLMPQHQNLGFELLTRLEVVAQHADEQEADCNHAAIMF* |
| Ga0066677_106340331 | 3300005171 | Soil | MRSTWRTRPKNVQLMPQHQDLDLQLLSRLEAVAQHADEQQTNCNHAAIMF* |
| Ga0066683_104407453 | 3300005172 | Soil | VWRTLPKNVELMSQYQDFGLQPPSRLEAVAQHADEQEADCNHSAIMF* |
| Ga0066683_107366341 | 3300005172 | Soil | TWRTLPKNVQLMPQHQDLDLQLLSRLEAVAQHADEQQANCNHAAIMF* |
| Ga0066673_103091301 | 3300005175 | Soil | MRSTRRTLPKNVELMLQHQDLGLQPLSRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0066688_107157311 | 3300005178 | Soil | MRSTRRTLPKNVELMPQQPLPRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0066676_111117872 | 3300005186 | Soil | MRSTRRTLPKNIELMPQHQDLGLQPLSRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0066388_1016523922 | 3300005332 | Tropical Forest Soil | MQSTWRALLQHAELMPQDEDFGFQPASRLETVAQHADEQEADCNHSAIMF* |
| Ga0070709_100517013 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWKNRATSKSWRAPPKNVELMPQHQHLGLHLLSRLEAVAQHADEQQPDCNHAAIMF* |
| Ga0070711_1004573393 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSAWRSLLQDIELMPQYHDLGFHLLSRLEAVAQHADEQEADCNHAAIMF* |
| Ga0070699_1000258641 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VELMSQYQDFGLQPPSRREAVAQYADEQEADCNHLAIMF* |
| Ga0070696_1003011584 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VELMSQYQDFGLQPPSRREAVAQYADEQEADCNHTAIMF* |
| Ga0066701_108998971 | 3300005552 | Soil | GTIGPTQMRSTWRTLPKNVQLMPQHQDLGLQLLSRLEAVAQHADEQQANCNHAAIMF* |
| Ga0066695_101451422 | 3300005553 | Soil | MRSTWRTLPKNVQLMPQHQDLDLQLLSRLEAVAQHADEQQANCNHAAIMF* |
| Ga0066702_107766851 | 3300005575 | Soil | PNEQSTIGPTQMQSAWRSLPKNVELMPQHQDLGLQPLSRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0066905_1018088322 | 3300005713 | Tropical Forest Soil | MRWAWRSLLQDIELMPQYHDLDCQLRSRLETVAEHADEREADCNHAAIIF* |
| Ga0068861_1008723113 | 3300005719 | Switchgrass Rhizosphere | MPQHQHLGLHLLSRLEAVAQHADEQQPDCNHAAIMF* |
| Ga0081455_100410563 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLERERSLLQDIELMPQYHDLGFQLRSRLEAVAQHADEQEANCNHAAIMF* |
| Ga0066656_106846361 | 3300006034 | Soil | MRSTWRTLPKNVQLMPQHQDLGLQLLSRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0070712_1001923883 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWKNRATSKSWRAPPKNVELMPQNQHLGLHLLSRLEAVAQHADEQQPDCNHAAIMF* |
| Ga0066659_116580411 | 3300006797 | Soil | TIGPTQMRSTRRTLPKNVELMPQQPLPRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0099791_100563892 | 3300007255 | Vadose Zone Soil | MRSTWRTLPKNVELMPQHQHLGLQLLSRLEAVAQHADEQQSDCNHAAIMF* |
| Ga0066710_1002625482 | 3300009012 | Grasslands Soil | MRSTWRTLPKNVQLMPQHQDLGLQLLSRLEAVAQHADEQQANCNHAAIMF |
| Ga0066710_1029272951 | 3300009012 | Grasslands Soil | MRSTRRTLPKNVELMPQHQDLGLQPLSRLEAVAQRTDEQQADCNHAAIMF |
| Ga0099829_112806742 | 3300009038 | Vadose Zone Soil | LQDIELLPQDHDFGFQPLSRLEAVAQHADEQEADCNHSAIMF* |
| Ga0099828_102803462 | 3300009089 | Vadose Zone Soil | MQSATWRALLQDVELMPQYQNFGFQLPSRLEAVAQHADEKEADCNHAAIMF* |
| Ga0099828_116456611 | 3300009089 | Vadose Zone Soil | QSAIDPPQMRSTWRAVQNIELMPQRQNLGFQLLSRLEAVAQQAEEQEPQRNHAAMMS* |
| Ga0099827_103848651 | 3300009090 | Vadose Zone Soil | RRALLQDIELMPQDHDFGFQPLSRLEAVAQHADEQEADCNHSAIMF* |
| Ga0099827_114105192 | 3300009090 | Vadose Zone Soil | MRSTRRTLPKNVELMPQHQDLGLQPLSRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0111539_104296852 | 3300009094 | Populus Rhizosphere | MRSPWRTLLQDVELMPQHQDLGRQLLPRLEVVAQHADEQEGDCNHSAIMF* |
| Ga0066709_1012903021 | 3300009137 | Grasslands Soil | MRSTWRTRPKNVQLMPQHQDLDLQLLSRLEAVAQHADEQQANCNHAAIMF* |
| Ga0066709_1025005611 | 3300009137 | Grasslands Soil | MRSTRRTLPKNVELMPQHQDLGLQPLSRLEAVAQRTDEQQANCNHAAIMF* |
| Ga0099792_103091661 | 3300009143 | Vadose Zone Soil | MQSTARRTVPKNVELMSQYQDFGLQPPSRLEAVAQYADEKEADCNHAAIMF* |
| Ga0114129_105108323 | 3300009147 | Populus Rhizosphere | MSWKNRATSKSWRAPPKNVELMPQHQDLGLQLLSRLEAVAQHADEQQLDCNHAAIMF* |
| Ga0111538_116928991 | 3300009156 | Populus Rhizosphere | RATSKSWRAPPKNVELMPQHQHLGLHLLSRLEAVAQHADEQQPDCNHAAIMF* |
| Ga0075423_131816022 | 3300009162 | Populus Rhizosphere | SLVQDTELMPQNHDLGFQLLSRLEAVAQHADEQEADCDHAAIMF* |
| Ga0126374_112270411 | 3300009792 | Tropical Forest Soil | MRSAWRSLLQDIELIPQYHDFDFQLRSRLETVAEHADEQEADCNHAAIMF* |
| Ga0126380_117221461 | 3300010043 | Tropical Forest Soil | MPSARRSLLQDIELMPQYENLAFQLLPRPEEVEQHAEEQEADCNHAAIMFCFVRDCESNG |
| Ga0126384_101904322 | 3300010046 | Tropical Forest Soil | MRSAWRSLLQDIELMPQYHDLDFQLRSRLETVAEHADEQEADCNDAAIMF* |
| Ga0126384_108642163 | 3300010046 | Tropical Forest Soil | MPQHQDLGLRLLSRLEAVAQHADEQEADCDHTAIMF* |
| Ga0126382_112249721 | 3300010047 | Tropical Forest Soil | IEPNEQSTIGPTQMQSAWRSLLQDIELMPQYHDLGFQLLSRLEAVAQHADEQEADCNHAAIMF* |
| Ga0126373_125216941 | 3300010048 | Tropical Forest Soil | MRSTWRTPPKNVDLMPQHQHLGLQLLSRLQAVAQHADEQQPDCNHAAIMF* |
| Ga0126306_112190661 | 3300010166 | Serpentine Soil | MWFAWRSLSQDIELMPQYYDHGFQLLSRPEAIAQHADEQEADSYHAAIMFRFATDRESIGWS |
| Ga0134063_107215972 | 3300010335 | Grasslands Soil | MRSTWRTLPKNVQLMPQHQDLGLQLLSRLEAVAQHADEQQPDCNHAAIMF* |
| Ga0134062_102483561 | 3300010337 | Grasslands Soil | MQSAWRSLPKNVELMPQHQDLGLQPLSRLEAVAQRTDEQQADCNHAAIMF |
| Ga0126376_113121393 | 3300010359 | Tropical Forest Soil | LMPQYQDFGFQPRPRLEEVAQHADEQEADRNHSAIMF* |
| Ga0126376_129912362 | 3300010359 | Tropical Forest Soil | MRSAWRSLLQDIELIPQYHDLDFQLRSRLETVAEHADEQEADCNHAAIMF* |
| Ga0126372_122496602 | 3300010360 | Tropical Forest Soil | MGSPARRSLLQHTELMPQHQDLGFQLLSRLEVVAQHADEQKADCHHAAIVF* |
| Ga0126378_122109382 | 3300010361 | Tropical Forest Soil | MRSTWRTPPKNVELMPQHQHLGLQLLSRLEAVAQHADEQQPDCNHAAIMF* |
| Ga0126377_133227682 | 3300010362 | Tropical Forest Soil | MRLPWRTLLQDVELMPQHQDLGRQLLSRLKVVAQHADEQEGDCNHSAIMF* |
| Ga0134126_108967693 | 3300010396 | Terrestrial Soil | ELMPQHQHLGLHLLSRLEAVAQHADEQQLDCNHAAIMF* |
| Ga0126383_104214951 | 3300010398 | Tropical Forest Soil | MRSAWRSLLQDIELMPQYHDLDFQLRSRLETVAEHADEQEADCN |
| Ga0105246_125118741 | 3300011119 | Miscanthus Rhizosphere | MAQDQDFGFQPLLRLEAVAQHTEEQEADCDHSAIMF* |
| Ga0137383_101895634 | 3300012199 | Vadose Zone Soil | QSVWRSLPQNIQLMPQDQVFGFQPPSRLEAVAHYADEQEPNCNHSAIMF* |
| Ga0137382_109296391 | 3300012200 | Vadose Zone Soil | WRSLLQDIEVMPQYHDPGFQLLSRLEAVAQHADEQEADCDHAATM* |
| Ga0137363_103744422 | 3300012202 | Vadose Zone Soil | MPQDQDFGFQLPSRLEAVAQHAGEEVGNCDHAAIMF* |
| Ga0137376_109100812 | 3300012208 | Vadose Zone Soil | LNQDFGLQPLSRLEVVAQYPNEQEADCNHAAIMF* |
| Ga0137377_106439632 | 3300012211 | Vadose Zone Soil | MQSTVWRTLPKNVELMSQYQNFGFQPPSRLEAVAHYADEQEPNCNHSAIMF* |
| Ga0137370_103356842 | 3300012285 | Vadose Zone Soil | MRSTRRTLPKNVELMPQHQDLGLSRLEAVAQRTDEQQADCNHAAIMF* |
| Ga0137372_104174662 | 3300012350 | Vadose Zone Soil | MQSTVWRTLPKNVELMSQYQGFGLQPPSRLEAVAQYADKQEAGCNHAAIMF* |
| Ga0137369_101010164 | 3300012355 | Vadose Zone Soil | MPQYQNFGFQAPARLEAIAEYADEQEADCNHAAIMF* |
| Ga0137361_102249101 | 3300012362 | Vadose Zone Soil | MRSTWRALLQDIELMPQHQDLGFQLLSRLEAIAQHADEQEADCNHSAMMF* |
| Ga0137361_111770221 | 3300012362 | Vadose Zone Soil | WRSLPKNVELMPQHQDLGLQLLSRLEAVAQHADEQQANCNHAAIMF* |
| Ga0137361_113923461 | 3300012362 | Vadose Zone Soil | MQSTAWRTVPKNVELMSQYQDFGLQPPSRLEAVAQYADEKEADCNHAAIMF* |
| Ga0137358_108762801 | 3300012582 | Vadose Zone Soil | MSWKSWATSKSWRAPPKNVELMPQHQDLGFQLLSRPEAVAQHADEQQANCNHAAIM |
| Ga0137397_109718712 | 3300012685 | Vadose Zone Soil | MRSTWRTLPKNVELMPEHQDLGFQLLSRFEAVAQHADEQEADCNHAAIMF* |
| Ga0137396_102383253 | 3300012918 | Vadose Zone Soil | PKNVELMPQHQHLGLQLLSRLEAVAQHADEQQSDCNHAAIMF* |
| Ga0137394_110463772 | 3300012922 | Vadose Zone Soil | MRSPRRALLQDIELMPEHQDLGFQLLSRFEAVAQHADEQEADCNHAAIMF* |
| Ga0134077_103310602 | 3300012972 | Grasslands Soil | MRSTRRTLPKNVELMPQHQDLGLQLLSRLEAVAQHADEQEADCNHAAMMF* |
| Ga0164308_115959531 | 3300012985 | Soil | MPQHQDLGFQLLSRLEVGAQHADEQEADCNHAAMMF* |
| Ga0164304_110200211 | 3300012986 | Soil | MRSPWRALLQDIELMPQHQDLGFQLLSRLEVVAQHADEQEADCNHAAMMF* |
| Ga0132258_121032602 | 3300015371 | Arabidopsis Rhizosphere | MPQHQDLGFQLLSRPEVVAQHADEQQARCNHAAMMF* |
| Ga0132257_1029386972 | 3300015373 | Arabidopsis Rhizosphere | ELMTQYDELRLQLLSRPEAVAQHADEQEADCNHLAIMI* |
| Ga0182033_105046601 | 3300016319 | Soil | MWSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0182035_103870862 | 3300016341 | Soil | MPQDQDFGFQPLWRLETVAQHLEKQEADCDHSAILF |
| Ga0182035_108803821 | 3300016341 | Soil | PPTRRALLQDVQLMTQDEEFGFQPLWRFETIPQHAEIQEADCNHSAMMF |
| Ga0182034_116506331 | 3300016371 | Soil | TIDPTQMRSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0182037_117425241 | 3300016404 | Soil | STIDPTQMRSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0134074_10608242 | 3300017657 | Grasslands Soil | MRSTWRTLPKNVELMPQHQDLGLSRLEAVAQRTDEQQADCNHAAIMF |
| Ga0184635_100266133 | 3300018072 | Groundwater Sediment | MPQDQDFGFQQLLRLEAVAQHAEKQEADCNHSAIMF |
| Ga0184632_101841901 | 3300018075 | Groundwater Sediment | MPQHQDFGFQAPSRPEAVAEYADEQEADCDHAASMI |
| Ga0184612_106071592 | 3300018078 | Groundwater Sediment | LPTLLKDVDLMSQYQDFGLQPPPRLKAVAQHADEKDADCNHAAIMF |
| Ga0066667_102152482 | 3300018433 | Grasslands Soil | MSWKSRATSKSWRAPPKNVELMPQHQDLGFQLLSRLEAVAQHADEQEADCNHVAIML |
| Ga0066662_123097911 | 3300018468 | Grasslands Soil | DEKGTVDPTQMQWPARHSLLQHTELMPQHQDLGFQLLSRLEVIAQHADEQEADCNHAAIM |
| Ga0066669_101936442 | 3300018482 | Grasslands Soil | MRSTRRTLPKNVELMPQHQDLGLQLLSRLEAVAQRTDEQQADCNHAAIMF |
| Ga0066669_108864501 | 3300018482 | Grasslands Soil | EPTQTQSTAWRTLPKNVELMPQYQDFGLQPPSRLEAVAQYADEQEADCNHAGIMF |
| Ga0210406_101302422 | 3300021168 | Soil | MSWKNRATSKSWRAPPKNVELMPQHQHLGLQLLSRLEAVAQHADE |
| Ga0213878_100503583 | 3300021444 | Bulk Soil | MPQHQDLGCQLLSRLEAVAQHADEQEADCDHTAIMF |
| Ga0210402_108813312 | 3300021478 | Soil | QMQSTARRTLPKNVELMPQYQDFGLQPPSRLEAVAKYADEQEADCNHAPIMF |
| Ga0126371_106044672 | 3300021560 | Tropical Forest Soil | MRSTWRTPPKNVELMPQHQLSRLEAVAQHADEQQPDCNHAAIMF |
| Ga0179589_100406662 | 3300024288 | Vadose Zone Soil | MIGPTQTRSTWRPPPKNVELMPQHQDLGFQLLSRPEAVAQHADEQEADCNHAAMMF |
| Ga0207693_114033261 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SPAQRSQLQHIQLMPQHQNLGFELLTRLEVVAQHADEQEADCNHAAIMF |
| Ga0207663_102360382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTWRTLPKNVELMPQHQHLGLQLLSRLEAVAQHADEQQPDCNQAAIMF |
| Ga0209265_10654903 | 3300026308 | Soil | IGPTQMRSTWRTRPKNVQLMPQHQDLDLQLLSRLEAVAQHADEQQANCNHAAIMF |
| Ga0209647_12198031 | 3300026319 | Grasslands Soil | DPTQMQSTAWRTVPKNVELMSQYQDFGLQPPSRLEAVAQYADEKEADCNHAAIMF |
| Ga0209266_11560512 | 3300026327 | Soil | MRSTWRTLPKNVQLMPQHQDLDLQLLSRLEAVAQHADEQQANCNHAAIMF |
| Ga0257161_11184181 | 3300026508 | Soil | MRSTWRTPPKNVELMPQHQHLGLQLLSRLEAVAQHADEQQPDCNHAAIMF |
| Ga0209648_108215681 | 3300026551 | Grasslands Soil | PFTPSPTFAHSSLLQHVELMPQYQDFGFQSPSRLEAIAQHADEKEADCNHAAIMF |
| Ga0208365_10130932 | 3300027070 | Forest Soil | ATIEPDEQSAVDPTQMRSTSRAPLQNIELMPQRQNLGFQLPSRLEAVVQQAEEQKHQRNHAAMMF |
| Ga0209524_10414501 | 3300027521 | Forest Soil | MPQHQDFGFQLLSRLEEVAQHADEQEAHCKHAAIMF |
| Ga0307322_101727981 | 3300028710 | Soil | QMRSTLRTPPKNVELMPQHQHLGLQLLSRLEAVAQHADEQQPDCNHAAIMF |
| Ga0318516_102081563 | 3300031543 | Soil | MPQHQDLGFQLPSRLEAVAQHADEQEDDCNHAAMMF |
| Ga0318534_108096472 | 3300031544 | Soil | MRSRWRTPPENIELMPQHQDLGFQLPSRLEAVAQHADEQEDDCNHAAMMF |
| Ga0318561_100623913 | 3300031679 | Soil | VLLAPASTIDPTQMRSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0307468_1005682352 | 3300031740 | Hardwood Forest Soil | MSQYQDFGLQPLSRLEAVAQYPDEQEADYNHAAIMF |
| Ga0318494_107572621 | 3300031751 | Soil | STIGPTQMQSPAQRSLLQHTELMPQHQDLGFQLLSRLEVVAQHADEQEADCHHAAIVF |
| Ga0318537_100389013 | 3300031763 | Soil | IGPAQMRSRWRTPPENIELMPQHQDLGFQLPSRLEAVAQHADEQEDDCNHAAMMF |
| Ga0318521_108323372 | 3300031770 | Soil | IDPTQMWSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0318517_103085361 | 3300031835 | Soil | IELMPQHQDLGFQLPSRLEAVAQHADEQEDDCNHAAMMF |
| Ga0306925_114890512 | 3300031890 | Soil | PTQMQSPAPRSLLQHTELMPQHQDLGFQLLSRLEVAAQHADEQEADCHHAAIVF |
| Ga0318520_103655951 | 3300031897 | Soil | MRSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0306923_121152441 | 3300031910 | Soil | NEQGTVGPTQMQSMRCALLQNIELMPQDDDLGFQLPSRLEVVAQHADEQETDCDHAAIMF |
| Ga0306921_122262731 | 3300031912 | Soil | MRSTWRTPPKNVELMPQHQHLGLQLLSRLEAVAQHADEQQSDCNHAAIMF |
| Ga0310912_100136311 | 3300031941 | Soil | SAWRSLLQDIELMPQYHALGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0310916_109084092 | 3300031942 | Soil | MPQHQDLGFQLLSRLEAVAQHADEQEADCDHAAIMF |
| Ga0310913_101678804 | 3300031945 | Soil | QMQSPARRSLLQHTELMPQHQDLGFQLLSRLEVVAQHAHEQEADCHHAAIVF |
| Ga0310913_102393963 | 3300031945 | Soil | VQNIELMPQRQNLGFQLPSRLEAVVQQAEEQEPQRNHAR |
| Ga0310909_101128751 | 3300031947 | Soil | IGPTQMQSPARRSLLQHTELMPQHQDLGFQLLSRLEVVAQHADEQEADCHHAAIVF |
| Ga0318556_105868741 | 3300032043 | Soil | LAHGAVLLAPASTIDPTQMRSPWRTLLQDIELMPQNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0318506_100743982 | 3300032052 | Soil | MRSRWRTPPENIELMPQHQDLGFQLPSRLEAVAQHADEQEDYCNHAAMMF |
| Ga0318570_101666572 | 3300032054 | Soil | MRSPWRTLLQDIELMPHNQELGFQLLSRLEAVAQHADEQEADCNHAAIMF |
| Ga0307471_1019049142 | 3300032180 | Hardwood Forest Soil | MPQHQDLGFQLLSRLEAIAQHADEQEADCNHSAMMF |
| Ga0306920_1002315305 | 3300032261 | Soil | PNEQSTIGPTQMRSAWRSLLQDIELMPQYHALGFQLLSRLEAVAQHADEQEADCNHAAIM |
| ⦗Top⦘ |