


| Basic Information | |
|---|---|
| Family ID | F066947 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GSNRTPLLADHMAVNIAPGDIDQLAATLQHKVSRGKMYLT |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 77.78 % |
| % of genes from short scaffolds (< 2000 bps) | 69.05 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF08811 | DUF1800 | 56.35 |
| PF13188 | PAS_8 | 3.17 |
| PF10067 | DUF2306 | 2.38 |
| PF07394 | DUF1501 | 1.59 |
| PF01609 | DDE_Tnp_1 | 1.59 |
| PF00355 | Rieske | 1.59 |
| PF01058 | Oxidored_q6 | 1.59 |
| PF04307 | YdjM | 0.79 |
| PF00873 | ACR_tran | 0.79 |
| PF00023 | Ank | 0.79 |
| PF13426 | PAS_9 | 0.79 |
| PF03551 | PadR | 0.79 |
| PF14060 | DUF4252 | 0.79 |
| PF08327 | AHSA1 | 0.79 |
| PF12146 | Hydrolase_4 | 0.79 |
| PF13517 | FG-GAP_3 | 0.79 |
| PF00144 | Beta-lactamase | 0.79 |
| PF07843 | DUF1634 | 0.79 |
| PF08241 | Methyltransf_11 | 0.79 |
| PF12697 | Abhydrolase_6 | 0.79 |
| PF05973 | Gp49 | 0.79 |
| PF13231 | PMT_2 | 0.79 |
| PF13185 | GAF_2 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 56.35 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 1.59 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 1.59 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 1.59 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.59 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 1.59 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.59 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.59 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.59 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.59 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.59 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.79 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.79 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.79 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.79 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.79 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.79 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.79 |
| COG4272 | Uncharacterized membrane protein | Function unknown [S] | 0.79 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.22 % |
| Unclassified | root | N/A | 27.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101213257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300000955|JGI1027J12803_107096428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300001356|JGI12269J14319_10243243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300001593|JGI12635J15846_10672792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100236588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1716 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101090807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101527965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005541|Ga0070733_10187077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
| 3300005541|Ga0070733_10375616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300005542|Ga0070732_11028180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005557|Ga0066704_10833289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005602|Ga0070762_10030128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2895 | Open in IMG/M |
| 3300005602|Ga0070762_10050384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2292 | Open in IMG/M |
| 3300005610|Ga0070763_10024804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2689 | Open in IMG/M |
| 3300006052|Ga0075029_100291466 | Not Available | 1040 | Open in IMG/M |
| 3300006162|Ga0075030_100418868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
| 3300006176|Ga0070765_100616165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300006893|Ga0073928_10025039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5946 | Open in IMG/M |
| 3300006893|Ga0073928_10279284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1264 | Open in IMG/M |
| 3300009090|Ga0099827_11118480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300009522|Ga0116218_1146366 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300009523|Ga0116221_1425024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300009616|Ga0116111_1090815 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300009623|Ga0116133_1181974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300009624|Ga0116105_1009814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1947 | Open in IMG/M |
| 3300009628|Ga0116125_1109466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300009646|Ga0116132_1269599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009665|Ga0116135_1058400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1350 | Open in IMG/M |
| 3300009700|Ga0116217_10011660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7236 | Open in IMG/M |
| 3300009700|Ga0116217_10673462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300010048|Ga0126373_12528715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010048|Ga0126373_13054009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300010343|Ga0074044_10938455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300010376|Ga0126381_101385417 | Not Available | 1016 | Open in IMG/M |
| 3300011269|Ga0137392_10659674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300012189|Ga0137388_11689924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300012199|Ga0137383_10992457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300012208|Ga0137376_10491007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300012354|Ga0137366_11212538 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300013307|Ga0157372_10433711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
| 3300014165|Ga0181523_10169927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
| 3300014200|Ga0181526_10267431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300014657|Ga0181522_10253012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300014658|Ga0181519_10880278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300016404|Ga0182037_12055091 | Not Available | 513 | Open in IMG/M |
| 3300017934|Ga0187803_10015754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3015 | Open in IMG/M |
| 3300017935|Ga0187848_10206253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300017936|Ga0187821_10466013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017941|Ga0187850_10181128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300017959|Ga0187779_10490044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300017961|Ga0187778_10570686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300017970|Ga0187783_10238533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1331 | Open in IMG/M |
| 3300017974|Ga0187777_11165148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300017975|Ga0187782_10668856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300017975|Ga0187782_11645529 | Not Available | 507 | Open in IMG/M |
| 3300018018|Ga0187886_1351442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300018085|Ga0187772_10067743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2235 | Open in IMG/M |
| 3300020579|Ga0210407_10455195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300020579|Ga0210407_10898637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300020580|Ga0210403_10873153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300020583|Ga0210401_10127439 | Not Available | 2387 | Open in IMG/M |
| 3300021181|Ga0210388_10901731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300021404|Ga0210389_10258646 | Not Available | 1362 | Open in IMG/M |
| 3300021432|Ga0210384_10834491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300021477|Ga0210398_10543833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300021479|Ga0210410_10146300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2105 | Open in IMG/M |
| 3300022722|Ga0242657_1237388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300022732|Ga0224569_108475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300025414|Ga0208935_1055490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300025434|Ga0208690_1059241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300025939|Ga0207665_11471011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 542 | Open in IMG/M |
| 3300025949|Ga0207667_11423492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 666 | Open in IMG/M |
| 3300026355|Ga0257149_1026320 | Not Available | 808 | Open in IMG/M |
| 3300026508|Ga0257161_1136426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300027516|Ga0207761_1108912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300027568|Ga0208042_1050810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300027867|Ga0209167_10164685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300027879|Ga0209169_10055127 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2065 | Open in IMG/M |
| 3300027889|Ga0209380_10485662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300027905|Ga0209415_11098579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300027911|Ga0209698_10317850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300028020|Ga0265351_1016315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300028036|Ga0265355_1021613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300028566|Ga0302147_10326509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300028773|Ga0302234_10454433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300030646|Ga0302316_10408738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300030760|Ga0265762_1003823 | Not Available | 2695 | Open in IMG/M |
| 3300031028|Ga0302180_10370030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300031234|Ga0302325_10841068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300031525|Ga0302326_10539528 | Not Available | 1754 | Open in IMG/M |
| 3300031708|Ga0310686_102813332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300031962|Ga0307479_10058849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3702 | Open in IMG/M |
| 3300031962|Ga0307479_10855878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300031996|Ga0308176_11189552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300032180|Ga0307471_101069460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300032205|Ga0307472_100312234 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300032783|Ga0335079_10002152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22751 | Open in IMG/M |
| 3300032892|Ga0335081_11753013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300032898|Ga0335072_11360682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300032955|Ga0335076_11432800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.59% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1012132571 | 3300000364 | Soil | RMPMLEGMSVNIAATDIDQLAATLQYKVTRGKIISI* |
| JGI1027J12803_1070964281 | 3300000955 | Soil | VGSSRVPLLEGSSVNIAATDIDHLAATLQYKISRGRTFST* |
| JGI12269J14319_102432432 | 3300001356 | Peatlands Soil | SLLADHMPVNIAPGDVDQLAATLQHKVSRGKTYLT* |
| JGI12635J15846_106727922 | 3300001593 | Forest Soil | LDTISVNIAATDIDHLAATLQHKVSRGKTYLTKEIGS* |
| JGIcombinedJ26739_1002365882 | 3300002245 | Forest Soil | ADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP* |
| JGIcombinedJ26739_1010908071 | 3300002245 | Forest Soil | PLLADHMAVNISPGDVDQMAATLQHKASRGRVHLT* |
| JGIcombinedJ26739_1015279652 | 3300002245 | Forest Soil | HAVGSSRTPLLDTISVNIAATDIDHLAATLQHKVSRGKTYLTKEIGS* |
| Ga0070733_101870771 | 3300005541 | Surface Soil | DAVGSNRTPLLADHMAVNISPADVDQLAATLQHKVSRGKMYLT* |
| Ga0070733_103756161 | 3300005541 | Surface Soil | IQVRRDAVGSNRAPLLADRVAVNIAPGDIDHLAATLQHKVSRGKVYVTQS* |
| Ga0070732_110281801 | 3300005542 | Surface Soil | DAVGSNRVPILETGAVNIAAADIDHLAATLQYKVSRGKAYLT* |
| Ga0066704_108332891 | 3300005557 | Soil | GSSRSPLLDSMTVNIAAADIDHLAATLQYKVSRGKAYLTP* |
| Ga0066705_108832892 | 3300005569 | Soil | SNRTPFFDDRSASNISPVDVDHLAASLQHKITHGRLYLT* |
| Ga0066702_103087891 | 3300005575 | Soil | TRFLEDRMAVNIAAGDIDHLAATLQHKVTHGRLYLT* |
| Ga0068857_1002433512 | 3300005577 | Corn Rhizosphere | NRTPFLQDRLAVNIAAADIDQLAATLQHKVTHGRLYLT* |
| Ga0070762_100301281 | 3300005602 | Soil | GSNRAPLLDAMQVNIAAADIDHLAATLQHKVSRGKTYLTKELAP* |
| Ga0070762_100503842 | 3300005602 | Soil | PLLADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP* |
| Ga0070763_100248043 | 3300005610 | Soil | PLLADHMAVNIAPGDVDQLAATLQHKVSRGKMYLT* |
| Ga0075029_1002914662 | 3300006052 | Watersheds | SSRVPLLEGTSVNIAAADIDHLAATLQHKVSRGKIISI* |
| Ga0075030_1004188681 | 3300006162 | Watersheds | SSRTPLLEGTSVNIAAADIDHLAATLQYKVSRGKVIVI* |
| Ga0070765_1006161652 | 3300006176 | Soil | GSNRAPLLADHMPVTIAPGDIDQLAATLQHKVSRGKTYLT* |
| Ga0066658_106140012 | 3300006794 | Soil | VRFFEDRAAVNIAAGDIDQLAATLQHKITHGRLYLT* |
| Ga0066659_111009153 | 3300006797 | Soil | DAVGSNRVPFLEHMSVNIAPGDIDQLAASLQHKLTNGKLYLT* |
| Ga0073928_100250397 | 3300006893 | Iron-Sulfur Acid Spring | MTVNIAAADIDHLAATLQHKVSRARVYLTKEIGS* |
| Ga0073928_102792842 | 3300006893 | Iron-Sulfur Acid Spring | PLLADHMAVNIAPGDVDQLAAALQHKVSRGKVYLT* |
| Ga0066710_1003054261 | 3300009012 | Grasslands Soil | GSNRVPFLQDRNALNIAPVDIDQLAAGLQHRLSHGRLYLT |
| Ga0099827_111184801 | 3300009090 | Vadose Zone Soil | VGSNRVPFLEHMSVNIAAGDIDQLAAGLQHKLSHGKMYLT* |
| Ga0116214_13152952 | 3300009520 | Peatlands Soil | PFLQDRMVGDIAAADIDQLAASLQHKMSHGRLYLT* |
| Ga0116218_11463661 | 3300009522 | Peatlands Soil | TPLLDPMQVNIAAADIDHLAATLQHKVSRGKVYLTKELGQ* |
| Ga0116221_14250242 | 3300009523 | Peatlands Soil | AVGSNRTPLLADHMSVNIAPTDVDQLAATLQHKISRGKMYLT* |
| Ga0116111_10908151 | 3300009616 | Peatland | DTMSVNIAATDIDHLAATLQHKISRGKVYLTKEIGS* |
| Ga0116133_11819742 | 3300009623 | Peatland | GSSRTPLLADHMPVNIGPSDVDQLAATLQHKVSRGKVYLT* |
| Ga0116105_10098141 | 3300009624 | Peatland | TPMLHGMSVNIAAADIDQLAATLQHKVSRGKTYLTKELGQ* |
| Ga0116125_11094661 | 3300009628 | Peatland | VGSSRTPLLDTMSVNIAASDIDHLAATLQHRVSRGKTYLT* |
| Ga0116132_12695992 | 3300009646 | Peatland | GSNRAPLLDAMQVNIAAADIDHLAATLQHKVSRGKVYLTKELAP* |
| Ga0116135_10584002 | 3300009665 | Peatland | VRRDAVGSSRAPLLADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP* |
| Ga0116217_100116601 | 3300009700 | Peatlands Soil | NRTPLLDPMQVNIAASDIDHLAATLQHKVSRGKVYLTKELGQ* |
| Ga0116217_106734621 | 3300009700 | Peatlands Soil | VGSNRTPLLHGMAVNIAATDIDHLAATLQHKVSREKKYLT* |
| Ga0126373_125287151 | 3300010048 | Tropical Forest Soil | SRSPLLESMSVNIAAADIDHLAATLQYKVSRGKAYLT* |
| Ga0126373_130540091 | 3300010048 | Tropical Forest Soil | VVGSSRAPLLDSMSLNIAATDIDHLAATLQHKVSRGKAYST* |
| Ga0074044_109384552 | 3300010343 | Bog Forest Soil | LLADHMAVNIAPGDVDQLAATLQHKVSRGKMYLT* |
| Ga0126379_101948571 | 3300010366 | Tropical Forest Soil | SRTPLLERAVDIAPGDIDQLAANLQHKVTHGRLYQT* |
| Ga0126381_1013854171 | 3300010376 | Tropical Forest Soil | DVVGSSRAPLLDSMSLNIAATDIDHLAATLQYKVSRGKAYST* |
| Ga0137392_106596742 | 3300011269 | Vadose Zone Soil | GSNRTPLLADHMAVNIAPGDIDQLAATLQHKVSRGKMYLT* |
| Ga0137388_107824701 | 3300012189 | Vadose Zone Soil | NHVRFFEDRAAVNIAAGDIDHLAATLQHKVTHGRLYLT* |
| Ga0137388_116899242 | 3300012189 | Vadose Zone Soil | VGSNRTPLLDSAQVNIAAADIDQLAATLQHKVSRGKMYLTKESDQ* |
| Ga0137383_109924571 | 3300012199 | Vadose Zone Soil | VVGSNRTPLLDTMPVNIAAADIDQLAATLQHKVSRGKLYLTKESGH* |
| Ga0137376_104910071 | 3300012208 | Vadose Zone Soil | DAIGSNRTPLLADRMTVNIAASDIDHLAATLQHKVSHGKLYLT* |
| Ga0137366_112125381 | 3300012354 | Vadose Zone Soil | LDSVPVNISASDIDQLAATLQHKVSRGKLYLAKESGH* |
| Ga0137407_100141857 | 3300012930 | Vadose Zone Soil | VGSNRVRFFEDRMPVNIAAGDIDQLAATLQHKVTHGRLYLT* |
| Ga0164301_115135561 | 3300012960 | Soil | SVGSNRTPFLQDRLAVNIAAGDIDQLAATLQHKVTHGRLYLT* |
| Ga0157372_104337114 | 3300013307 | Corn Rhizosphere | SSRSPLLDSMGVNIAAADIDHLAATLQYKVSRGKAYLTP* |
| Ga0181523_101699271 | 3300014165 | Bog | SSRVPLLAEHMTVNIAPTDVDQLAATLQHKVSNGKMYLT* |
| Ga0181526_102674312 | 3300014200 | Bog | QVRRDAVGSNRVPLLAEHMPVSIAPGDVDQLAATLQHKVSRGKMYLT* |
| Ga0181522_102530122 | 3300014657 | Bog | DAVGSNRTPMLDGMQVNIAAADIDHLAATLQHKVSRGKVYLTKEASY* |
| Ga0181519_108802781 | 3300014658 | Bog | SNRTPLLADHMALNIAPTDVDHLAATLQHKVSRDKVFLT* |
| Ga0182037_120550911 | 3300016404 | Soil | VPMLEGMPVNIAASDIDQLAATLQYKVSRGRVISV |
| Ga0187818_101549942 | 3300017823 | Freshwater Sediment | RDTVGSNRTPFLQDRVQANIAAADVDQLAASLQHKITHGRLFLT |
| Ga0187801_101011672 | 3300017933 | Freshwater Sediment | RARFLEGRMADNIATADIDHLAATLQHKVNRGRLYLT |
| Ga0187803_100157541 | 3300017934 | Freshwater Sediment | AVGSNRMPLLAGHTSVNIAAGDIDHLAASLQHKTSRGKMYLTSGS |
| Ga0187848_102062532 | 3300017935 | Peatland | PLLTDHMAVNIAPGDIDQLAATLQHKVSRGKTYLT |
| Ga0187821_104660131 | 3300017936 | Freshwater Sediment | VGSNRTPFLEPAAVNIAATDIDHLAASLQYKVSRGKTYLTT |
| Ga0187850_101811281 | 3300017941 | Peatland | VRRDAVGSSRTPLLADHMPVNIGPSDVDQLAATLQHKVSRGKVYLT |
| Ga0187779_104900441 | 3300017959 | Tropical Peatland | LDGVPVNIAAADIDQLAATLQHKVSRGKTYATSTAASSEQ |
| Ga0187778_105706862 | 3300017961 | Tropical Peatland | TPLLDGMPVNIAAADIDQLAATLQHKVSHGKAYLT |
| Ga0187783_102385332 | 3300017970 | Tropical Peatland | SRSPLLESMSVNIAAADIDHLAATLQYKVSRGKAYLT |
| Ga0187777_111651481 | 3300017974 | Tropical Peatland | NRAPLLTDRISVNIAAGDIDHLAATLQHKVSRGKVYST |
| Ga0187782_106688562 | 3300017975 | Tropical Peatland | VVGSSRAPLLTDRMSVNIAAGDIDHLAATLQHKVSRGKSYVT |
| Ga0187782_116455292 | 3300017975 | Tropical Peatland | VVGSSRSQLLDSMAVNIAAADIDHLAATLQYKVSRGKAYLT |
| Ga0187886_13514422 | 3300018018 | Peatland | RDAVGSNRTPLLADHMSVNISPTDVDHLAATLQHKVSRAKMYLT |
| Ga0187859_106393202 | 3300018047 | Peatland | VGSNRTPFLQDRMGGDIAAADIDQLAASLQHKMNHGRLYLT |
| Ga0187772_100677432 | 3300018085 | Tropical Peatland | VRRDVVGSSRAPLLDSTPVNIAAPDIDQLAAALQHKVSRGKSYLTGQS |
| Ga0066669_115143182 | 3300018482 | Grasslands Soil | VVRNRAPFLAYRMSVNIAPADVDQLAATLQHKITHGRLYLT |
| Ga0210407_104551952 | 3300020579 | Soil | DAIGSNRTPLLADRMTVNIAASDIDHLAATLQHKVSHGKLYLT |
| Ga0210407_108986371 | 3300020579 | Soil | PLLADHMAVNIGPGDVDQLAATLQHKVSRGKMYLT |
| Ga0210403_108731532 | 3300020580 | Soil | SSRTPLLAEHMPVNIAPGDVDQLAATLQHKVSRGKMYLT |
| Ga0210401_101274392 | 3300020583 | Soil | RAPLLADHMPVTIAPGDIDQLAATLQHKVSRGKTYLT |
| Ga0210388_109017312 | 3300021181 | Soil | TPLLDSMTVNIAAADIDQLAATLQHKVSRGRMYLTKESGH |
| Ga0210389_102586462 | 3300021404 | Soil | TPLLADHMAVNISPTDIDQLAATLQHKVSRGKMYLT |
| Ga0210384_108344911 | 3300021432 | Soil | LLDTMTVNIAAADIDQLAATLQHKVSRGRMYLTKESGH |
| Ga0210398_105438331 | 3300021477 | Soil | VRRDAVGSSRAPLLADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP |
| Ga0210410_101463002 | 3300021479 | Soil | GSNRTPLLADRMTVNIAASDIDHLAATLQHKVSHGKLYLT |
| Ga0126371_129791781 | 3300021560 | Tropical Forest Soil | RDAVGSSRTPLLERAVDIAPGDIDQLAANLQHKVTHGRLYQT |
| Ga0242657_12373882 | 3300022722 | Soil | SNRVPLLAEHMAVNIAPGDVDQLAATLQHKVSRGKAYLT |
| Ga0224569_1084751 | 3300022732 | Rhizosphere | RDAVGSSRAPLLADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP |
| Ga0224560_1102202 | 3300023019 | Soil | TPFLQDRMGGDIAAADIDQLAASLQHKMNHGRLYLT |
| Ga0208935_10554901 | 3300025414 | Peatland | GMSVNIAAADIDQLAATLQHKVSRGKTYLTKELGQ |
| Ga0208690_10592412 | 3300025434 | Peatland | TPLVSDHMTVNLGPADVDQLAATLQHKVSRGKMYLT |
| Ga0207665_114710111 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AVGSSRSPLLDTTPVTIAAADIDHLAATLQHKVSRGKVFLT |
| Ga0207667_114234923 | 3300025949 | Corn Rhizosphere | SRAPLLESMTVNIAAADIDHLAATLQYKVSRGKVYLTP |
| Ga0207668_100031241 | 3300025972 | Switchgrass Rhizosphere | PFLQDRLAVNIAAADIDQLAATLQHKVTHGRLYLT |
| Ga0207674_101308314 | 3300026116 | Corn Rhizosphere | NRTPFLQDRLAVNIAAADIDQLAATLQHKVTHGRLYLT |
| Ga0257149_10263201 | 3300026355 | Soil | TPLLDTLSVNIAAADIDHLAATLQHKMSRGKTYSTKELSS |
| Ga0257161_11364261 | 3300026508 | Soil | IGSNRTPLLADRMTVNIAASDIDHLAATLQHKVSHGKLYLT |
| Ga0207761_11089121 | 3300027516 | Tropical Forest Soil | SSRVPMLEGMPVNIAATDIDQLAATLQYKVSRGRVISI |
| Ga0208042_10508102 | 3300027568 | Peatlands Soil | DAVGSSRVPLLADHMAVNIAPGDVDQLAATLQHKVSRGKMYLT |
| Ga0209139_101871252 | 3300027795 | Bog Forest Soil | YAVGSNRTPFLEERMAGNISAPDVDQLASTLQHKTSHGRLFLT |
| Ga0209773_104966372 | 3300027829 | Bog Forest Soil | PFLQDRMGGDIAAADIDQLAASLQHKMNHGRLYLT |
| Ga0209517_101675391 | 3300027854 | Peatlands Soil | NRTPFLQDRMGGDIAASDVDQLAAALQHKMSHGRLFLT |
| Ga0209167_101646852 | 3300027867 | Surface Soil | IQVRRDAVGSNRAPLLADRVAVNIAPGDIDHLAATLQHKVSRGKVYVTQS |
| Ga0209169_100551272 | 3300027879 | Soil | APLLADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP |
| Ga0209380_104856621 | 3300027889 | Soil | GSNRAPLLADHMAVNIAPGDVDQLAATLQHKVTRGKMYLT |
| Ga0209415_110985792 | 3300027905 | Peatlands Soil | GSNRTPLLADHMSVNIAPTDVDQLAATLQHKISRGKMYLT |
| Ga0209698_103178501 | 3300027911 | Watersheds | TPLLDSMLVNIAAADIDQLAATLQHKVSRGKVYLTKEIGY |
| Ga0265351_10163151 | 3300028020 | Soil | RREAVGSNRVPLLAEHMAVNIAPGDVDQLAATLQHKVSRGKAYLT |
| Ga0265355_10216131 | 3300028036 | Rhizosphere | RRDAVGSNRTPLLADHMAVNISPTDVDQLAATLQHKASRGKMYLT |
| Ga0302147_103265091 | 3300028566 | Bog | RRDAVGSSRMPLLADHMAVNISPADVDQLAATLQHKVTRGKMYLT |
| Ga0302234_104544331 | 3300028773 | Palsa | NRTPLLADHMAVNIAPGDVDQLAATLQHKVSRGKMYLT |
| Ga0302316_104087382 | 3300030646 | Palsa | TAVLQGMPVNIAAADIDQLAATLQHKVSRGRAYLTKELGS |
| Ga0265762_10038232 | 3300030760 | Soil | RAPLLADRVSVNIAPGDIDQLAATLQHKVSRGKVYVSQP |
| Ga0302180_103700301 | 3300031028 | Palsa | RDAVGSNRAPLLADHMAVNIAPGDVDQLAATLQHKVSRGKNYLT |
| Ga0302325_108410682 | 3300031234 | Palsa | EAVGSNRVPLLADHMSVNIAPSDVDQLAATLQHKVSRGKTYLT |
| Ga0302326_105395281 | 3300031525 | Palsa | DAVGSNRAPLLADHMAVNIAPGDVDQLAATLQHKVSRGKNYLT |
| Ga0310686_1028133321 | 3300031708 | Soil | LLDTMSVNIAAADIDHLAATLQHKVSRGKMYLTKESGQ |
| Ga0307468_1014059932 | 3300031740 | Hardwood Forest Soil | DSVGSNRSPFLQDRMAVNIAAGDIDQLAATLQHKVTHGRLYLT |
| Ga0307475_111876431 | 3300031754 | Hardwood Forest Soil | TPFLEGRLAESIAATDIDHLAATLQHKVTHGRLTLV |
| Ga0307479_100588491 | 3300031962 | Hardwood Forest Soil | SNRTPLLAEHMSVNIAPGDVDQLAATLQHKVSRGKVYLT |
| Ga0307479_108558781 | 3300031962 | Hardwood Forest Soil | RTPLLDSISVNIAATDIDHLAATLQHKVSRGKTYLTKEIGS |
| Ga0308176_111895522 | 3300031996 | Soil | RSPLLDSMSVNIAAADIDHLAATLQYKVSRGKAYLTP |
| Ga0307471_1010694601 | 3300032180 | Hardwood Forest Soil | NRTPLLADRMTVNIAASDIDHLAATLQHKVSHGKLYLT |
| Ga0307472_1003122341 | 3300032205 | Hardwood Forest Soil | VGSSRVPLLEGALINIAATDIDHLAATLQHKVSRGRTIVI |
| Ga0335079_1000215225 | 3300032783 | Soil | VPLLENTSVNIAAADIDHLAATLQYKVSRGKAYLT |
| Ga0335081_117530131 | 3300032892 | Soil | DVVGSSRAPLLDGVPVNIAAADIDQLAATLQHKVSRGKTYAT |
| Ga0335072_113606822 | 3300032898 | Soil | NRVPLLPERTVNIAASDIDQLAAGLQHKLSRGRAYSAP |
| Ga0335076_114328001 | 3300032955 | Soil | GSSRVPLLEGSSVNIAAADIDHLAATLQYKVSRAKAYLT |
| Ga0310810_100200611 | 3300033412 | Soil | TPFLADKHSVNIAPGDIDHLAAALQHKTTNGRRYVT |
| Ga0326726_100359625 | 3300033433 | Peat Soil | RIPFLEERVALNIAPSDIDQLAATLQHKISHGKQYLT |
| ⦗Top⦘ |