


| Basic Information | |
|---|---|
| Family ID | F066745 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.52 % |
| % of genes near scaffold ends (potentially truncated) | 33.33 % |
| % of genes from short scaffolds (< 2000 bps) | 63.49 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.968 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (41.270 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.032 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 0.00% Coil/Unstructured: 73.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 7.94 |
| PF11351 | GTA_holin_3TM | 1.59 |
| PF12850 | Metallophos_2 | 0.79 |
| PF01555 | N6_N4_Mtase | 0.79 |
| PF13560 | HTH_31 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.79 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.97 % |
| All Organisms | root | All Organisms | 46.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100022535 | Not Available | 10493 | Open in IMG/M |
| 3300003413|JGI25922J50271_10037824 | Not Available | 1125 | Open in IMG/M |
| 3300003430|JGI25921J50272_10007343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3384 | Open in IMG/M |
| 3300005527|Ga0068876_10026726 | Not Available | 3615 | Open in IMG/M |
| 3300005581|Ga0049081_10012482 | Not Available | 3206 | Open in IMG/M |
| 3300005581|Ga0049081_10017518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2714 | Open in IMG/M |
| 3300005581|Ga0049081_10054123 | Not Available | 1517 | Open in IMG/M |
| 3300005582|Ga0049080_10243484 | Not Available | 588 | Open in IMG/M |
| 3300005662|Ga0078894_10263898 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
| 3300005805|Ga0079957_1108912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1491 | Open in IMG/M |
| 3300005940|Ga0073913_10017825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300006030|Ga0075470_10008801 | Not Available | 3109 | Open in IMG/M |
| 3300006030|Ga0075470_10039971 | Not Available | 1446 | Open in IMG/M |
| 3300006030|Ga0075470_10123553 | Not Available | 765 | Open in IMG/M |
| 3300006637|Ga0075461_10024971 | Not Available | 1974 | Open in IMG/M |
| 3300006637|Ga0075461_10115699 | Not Available | 837 | Open in IMG/M |
| 3300006641|Ga0075471_10018663 | Not Available | 4136 | Open in IMG/M |
| 3300006641|Ga0075471_10025037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3492 | Open in IMG/M |
| 3300006641|Ga0075471_10042197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2573 | Open in IMG/M |
| 3300006641|Ga0075471_10061108 | Not Available | 2076 | Open in IMG/M |
| 3300006641|Ga0075471_10120732 | Not Available | 1398 | Open in IMG/M |
| 3300006641|Ga0075471_10423044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300006641|Ga0075471_10559489 | Not Available | 563 | Open in IMG/M |
| 3300006802|Ga0070749_10001695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14885 | Open in IMG/M |
| 3300006802|Ga0070749_10006097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7916 | Open in IMG/M |
| 3300006802|Ga0070749_10007738 | Not Available | 7022 | Open in IMG/M |
| 3300006802|Ga0070749_10018958 | All Organisms → Viruses → Predicted Viral | 4376 | Open in IMG/M |
| 3300006802|Ga0070749_10095275 | Not Available | 1765 | Open in IMG/M |
| 3300006802|Ga0070749_10161040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1301 | Open in IMG/M |
| 3300006802|Ga0070749_10359125 | Not Available | 809 | Open in IMG/M |
| 3300006802|Ga0070749_10465030 | Not Available | 692 | Open in IMG/M |
| 3300006802|Ga0070749_10774207 | Not Available | 510 | Open in IMG/M |
| 3300006805|Ga0075464_10015555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3850 | Open in IMG/M |
| 3300006805|Ga0075464_10350411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300006805|Ga0075464_10477721 | Not Available | 762 | Open in IMG/M |
| 3300006863|Ga0075459_1052200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300006863|Ga0075459_1078495 | Not Available | 563 | Open in IMG/M |
| 3300006875|Ga0075473_10124127 | Not Available | 1030 | Open in IMG/M |
| 3300006917|Ga0075472_10001482 | All Organisms → cellular organisms → Bacteria | 9560 | Open in IMG/M |
| 3300006917|Ga0075472_10393262 | Not Available | 685 | Open in IMG/M |
| 3300007202|Ga0103274_1174204 | Not Available | 1212 | Open in IMG/M |
| 3300007346|Ga0070753_1245033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300007346|Ga0070753_1327375 | Not Available | 543 | Open in IMG/M |
| 3300007542|Ga0099846_1174617 | Not Available | 766 | Open in IMG/M |
| 3300007734|Ga0104986_1239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12455 | Open in IMG/M |
| 3300007735|Ga0104988_10131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11139 | Open in IMG/M |
| 3300008106|Ga0114339_1086074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1270 | Open in IMG/M |
| 3300008114|Ga0114347_1073639 | Not Available | 1385 | Open in IMG/M |
| 3300008266|Ga0114363_1008577 | Not Available | 4957 | Open in IMG/M |
| 3300008266|Ga0114363_1012818 | Not Available | 6781 | Open in IMG/M |
| 3300008266|Ga0114363_1173831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300008448|Ga0114876_1056847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1732 | Open in IMG/M |
| 3300008448|Ga0114876_1152081 | Not Available | 843 | Open in IMG/M |
| 3300008448|Ga0114876_1176592 | Not Available | 749 | Open in IMG/M |
| 3300008450|Ga0114880_1011217 | Not Available | 4414 | Open in IMG/M |
| 3300008450|Ga0114880_1018976 | Not Available | 3225 | Open in IMG/M |
| 3300009239|Ga0103858_10029335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| 3300010354|Ga0129333_10305702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
| 3300010354|Ga0129333_10426934 | Not Available | 1170 | Open in IMG/M |
| 3300010354|Ga0129333_10511492 | Not Available | 1051 | Open in IMG/M |
| 3300010354|Ga0129333_10585591 | Not Available | 970 | Open in IMG/M |
| 3300010370|Ga0129336_10202315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
| 3300010370|Ga0129336_10279011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300011116|Ga0151516_11329 | Not Available | 10128 | Open in IMG/M |
| 3300012012|Ga0153799_1018486 | Not Available | 1425 | Open in IMG/M |
| 3300013372|Ga0177922_10036924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
| 3300017747|Ga0181352_1026063 | Not Available | 1786 | Open in IMG/M |
| 3300017747|Ga0181352_1063664 | Not Available | 1052 | Open in IMG/M |
| 3300017785|Ga0181355_1214262 | Not Available | 751 | Open in IMG/M |
| 3300017785|Ga0181355_1372197 | Not Available | 521 | Open in IMG/M |
| 3300019784|Ga0181359_1000947 | Not Available | 7235 | Open in IMG/M |
| 3300019784|Ga0181359_1086307 | Not Available | 1169 | Open in IMG/M |
| 3300019784|Ga0181359_1098760 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300020109|Ga0194112_10070775 | Not Available | 3304 | Open in IMG/M |
| 3300021963|Ga0222712_10067056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2609 | Open in IMG/M |
| 3300022179|Ga0181353_1031775 | Not Available | 1399 | Open in IMG/M |
| 3300022179|Ga0181353_1146853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300022190|Ga0181354_1007653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3037 | Open in IMG/M |
| 3300022213|Ga0224500_10183732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300022223|Ga0224501_10401353 | Not Available | 677 | Open in IMG/M |
| 3300023179|Ga0214923_10262825 | Not Available | 964 | Open in IMG/M |
| 3300024276|Ga0255205_1000117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13700 | Open in IMG/M |
| 3300025445|Ga0208424_1001164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2969 | Open in IMG/M |
| 3300025585|Ga0208546_1000652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11926 | Open in IMG/M |
| 3300025585|Ga0208546_1001555 | All Organisms → cellular organisms → Bacteria | 7062 | Open in IMG/M |
| 3300025585|Ga0208546_1002103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6024 | Open in IMG/M |
| 3300025585|Ga0208546_1003035 | Not Available | 4926 | Open in IMG/M |
| 3300025635|Ga0208147_1009617 | Not Available | 2703 | Open in IMG/M |
| 3300025732|Ga0208784_1030460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
| 3300025732|Ga0208784_1045410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
| 3300025818|Ga0208542_1056262 | Not Available | 1210 | Open in IMG/M |
| 3300025848|Ga0208005_1007290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3393 | Open in IMG/M |
| 3300025848|Ga0208005_1020279 | Not Available | 2042 | Open in IMG/M |
| 3300025848|Ga0208005_1156765 | Not Available | 710 | Open in IMG/M |
| 3300025872|Ga0208783_10060109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1723 | Open in IMG/M |
| 3300025872|Ga0208783_10063533 | Not Available | 1667 | Open in IMG/M |
| 3300025889|Ga0208644_1007312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7908 | Open in IMG/M |
| 3300025889|Ga0208644_1022466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3944 | Open in IMG/M |
| 3300025889|Ga0208644_1232928 | Not Available | 774 | Open in IMG/M |
| 3300025896|Ga0208916_10008076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4114 | Open in IMG/M |
| 3300025896|Ga0208916_10075703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
| 3300027079|Ga0255188_1053165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300027213|Ga0208555_1001025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4736 | Open in IMG/M |
| 3300027213|Ga0208555_1023859 | Not Available | 965 | Open in IMG/M |
| 3300027503|Ga0255182_1049666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300027769|Ga0209770_10121230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300027805|Ga0209229_10035269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2202 | Open in IMG/M |
| 3300027899|Ga0209668_10744809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300028066|Ga0255200_1057395 | Not Available | 545 | Open in IMG/M |
| 3300028083|Ga0255190_1036910 | Not Available | 768 | Open in IMG/M |
| 3300028089|Ga0255299_1033881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300031758|Ga0315907_10050047 | Not Available | 3680 | Open in IMG/M |
| 3300031758|Ga0315907_10211482 | Not Available | 1621 | Open in IMG/M |
| 3300031758|Ga0315907_10887929 | Not Available | 656 | Open in IMG/M |
| 3300031784|Ga0315899_10141275 | Not Available | 2462 | Open in IMG/M |
| 3300031857|Ga0315909_10688730 | Not Available | 665 | Open in IMG/M |
| 3300031857|Ga0315909_10748060 | Not Available | 627 | Open in IMG/M |
| 3300033482|Ga0316627_101121440 | Not Available | 772 | Open in IMG/M |
| 3300033485|Ga0316626_11964457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300033981|Ga0334982_0033806 | Not Available | 2905 | Open in IMG/M |
| 3300033981|Ga0334982_0406597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300033995|Ga0335003_0258455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300034101|Ga0335027_0003643 | All Organisms → cellular organisms → Bacteria | 13598 | Open in IMG/M |
| 3300034101|Ga0335027_0018841 | Not Available | 5896 | Open in IMG/M |
| 3300034102|Ga0335029_0239566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300034374|Ga0348335_154627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 41.27% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.76% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.76% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.76% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.97% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.17% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.59% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.79% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.79% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.79% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.79% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.79% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007202 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028066 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1000225352 | 3300002835 | Freshwater | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTHYKKLPSRVKKK* |
| JGI25922J50271_100378242 | 3300003413 | Freshwater Lake | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTKYKKLPTRVKKPKKK* |
| JGI25921J50272_100073435 | 3300003430 | Freshwater Lake | MPFKSKKQSAACFASGGFGGSVNCLKWAKKTHYKKLPTRVKKKK* |
| Ga0068876_100267262 | 3300005527 | Freshwater Lake | MPFRSRAQSRACFASKGFDGGVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0049081_100124822 | 3300005581 | Freshwater Lentic | MPFRSRAQSRACFASKGFDGGVDCMKWAKSTQYKKLPARVKQPKKK* |
| Ga0049081_100175182 | 3300005581 | Freshwater Lentic | MPFRSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0049081_100541232 | 3300005581 | Freshwater Lentic | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0049080_102434842 | 3300005582 | Freshwater Lentic | MPFKSKKQSAACFASGGFGGAVNCLKWAKKTHYKKLPTRVKKKK* |
| Ga0078894_102638981 | 3300005662 | Freshwater Lake | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTHYKKLPTRVKKKK* |
| Ga0079957_11089122 | 3300005805 | Lake | MPFRSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK* |
| Ga0073913_100178254 | 3300005940 | Sand | MPFKSKKQSAACFASGGFGGAVNCLKWAKSTQYKKLPSRVKKKK* |
| Ga0075470_100088011 | 3300006030 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKSKKK* |
| Ga0075470_100399711 | 3300006030 | Aqueous | MAFRSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0075470_101235532 | 3300006030 | Aqueous | MPFKSKAQSKACFASGGFDGAVDCMKWANKTHYGKLPAKVKKPKK* |
| Ga0075461_100249713 | 3300006637 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0075461_101156992 | 3300006637 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPAKVKKPKKK* |
| Ga0075471_100186631 | 3300006641 | Aqueous | MPFKSKAQSKACFASGGFDGSVDCMKWAKQTHYKKLPAKVKKPKK* |
| Ga0075471_100250377 | 3300006641 | Aqueous | MPFKSKAQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKK* |
| Ga0075471_100421973 | 3300006641 | Aqueous | MPFKSKAQSKACFASGGFNGAVDCMKWAKKTHYGKLPAKVKKPKKK* |
| Ga0075471_100611081 | 3300006641 | Aqueous | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKK |
| Ga0075471_101207322 | 3300006641 | Aqueous | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTHYKKLPT |
| Ga0075471_104230441 | 3300006641 | Aqueous | KQSAACFASGGFGGAVNCLKWAKSTQYKKLPTRVKKKK* |
| Ga0075471_105594892 | 3300006641 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPAKVKK |
| Ga0070749_1000169512 | 3300006802 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKQTHYKKLPAKVKKPKK* |
| Ga0070749_100060974 | 3300006802 | Aqueous | MPFKSKAQSKACFASGGFNGAVDCMKWAKKTHYGKLPAKVKKPKK* |
| Ga0070749_100077381 | 3300006802 | Aqueous | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKSKKK* |
| Ga0070749_100189584 | 3300006802 | Aqueous | MPFRSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPTKVKKPKKK* |
| Ga0070749_100952752 | 3300006802 | Aqueous | MPFRSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPEKK* |
| Ga0070749_101610402 | 3300006802 | Aqueous | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPAKVKKKK* |
| Ga0070749_103591253 | 3300006802 | Aqueous | ACFASGGFDGSVDCMKWAKSTQYKKLPAKVKKPKKK* |
| Ga0070749_104650301 | 3300006802 | Aqueous | MPFKSKKQSAACFASGGFGGAVNCLKWAKQTHYKKLP |
| Ga0070749_107742072 | 3300006802 | Aqueous | MPFKSKAQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKAKKPKK* |
| Ga0075464_100155552 | 3300006805 | Aqueous | MPFKSKAQSRACFASKGFDGSVDCMKWAKQTHYKKLPAKVKKPKK* |
| Ga0075464_103504111 | 3300006805 | Aqueous | LKFKMPFRSKAQSSACFASKGFDGSVDCMKWAKSTKYKKLPDRVKKPKKK* |
| Ga0075464_104777212 | 3300006805 | Aqueous | MPFKSKKQSAACFASGGFGGAVNCLKWAKSTQYKKLPTRVKKKK* |
| Ga0075459_10522003 | 3300006863 | Aqueous | SRACFASKGFDGSVDCMKWAKQTHYKKLPAKVKKPKK* |
| Ga0075459_10784951 | 3300006863 | Aqueous | LPANMPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0075473_101241272 | 3300006875 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARV |
| Ga0075472_1000148221 | 3300006917 | Aqueous | MPFKSKKQSAACFASGGFNGAVNCLEWAKKTHYKKLPTRVKKKK* |
| Ga0075472_103932622 | 3300006917 | Aqueous | MPFKSKAQSRACFASKGFDGSVDCMKWAKSSRYKKLPARVKKSKKK* |
| Ga0103274_11742041 | 3300007202 | Freshwater Lake | AQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0070753_12450333 | 3300007346 | Aqueous | MPFKSKKQSAACFASGGFGGAVNCLKWAKQTHYKKLPTRVKKKK* |
| Ga0070753_13273752 | 3300007346 | Aqueous | MPFKSKAQSKACFASGGFNGAVDCMKWAKSTHYKKLPRKVKKK* |
| Ga0099846_11746173 | 3300007542 | Aqueous | MPFKSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK* |
| Ga0104986_12392 | 3300007734 | Freshwater | MPFKSKAQSKACFASGGFDGSVDCMKWAKSTQYKKLPARVKKSKKK* |
| Ga0104988_101312 | 3300007735 | Freshwater | MPFKSKAQSKACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0114339_10860744 | 3300008106 | Freshwater, Plankton | ATRNNPSNPHRVANMPFRSRAQSRACFASKGFDGGVDCMKWAKSTQYKKLPARVKKPTQK |
| Ga0114347_10736391 | 3300008114 | Freshwater, Plankton | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPSKVKKKK* |
| Ga0114363_10085772 | 3300008266 | Freshwater, Plankton | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPSNVKKKK* |
| Ga0114363_10128187 | 3300008266 | Freshwater, Plankton | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPAKVK |
| Ga0114363_11738313 | 3300008266 | Freshwater, Plankton | MPFKSKAQSKACFASGGFNGAVDCMKWAKSTHYKKLPRNVKKK* |
| Ga0114876_10568472 | 3300008448 | Freshwater Lake | MPFRSKSQSKACLASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK* |
| Ga0114876_11520812 | 3300008448 | Freshwater Lake | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKQPKKK* |
| Ga0114876_11765921 | 3300008448 | Freshwater Lake | MPFRSKSQSKACLASGGFDGAVDCMKWAKKTHYGKLPAKVKKPK |
| Ga0114880_10112171 | 3300008450 | Freshwater Lake | MPFRSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKK |
| Ga0114880_10189763 | 3300008450 | Freshwater Lake | MPFKSKSQSKACFASGGFDGAVDCMKWAKSTQYKKLPARVKKSKKK* |
| Ga0103858_100293351 | 3300009239 | River Water | RIIMPFKSKSQQRVCYASKGFDGAVDCMKWAKKTNFGKLPEKVHKPKRTTYK* |
| Ga0129333_103057025 | 3300010354 | Freshwater To Marine Saline Gradient | AQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0129333_104269342 | 3300010354 | Freshwater To Marine Saline Gradient | MPFKSKKQFAACFASGGFGGAVNCLKWAKQTHYKKLPTRVKKKKK* |
| Ga0129333_105114922 | 3300010354 | Freshwater To Marine Saline Gradient | MPFKSKKQSAACFASGGFGGAVNCLKWAKSTQYKKLPTRVKKKKK* |
| Ga0129333_105855912 | 3300010354 | Freshwater To Marine Saline Gradient | MPFKSKKQSAACFASGGFGGAVNCLKWAKQTHYKKL |
| Ga0129336_102023154 | 3300010370 | Freshwater To Marine Saline Gradient | ACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK* |
| Ga0129336_102790111 | 3300010370 | Freshwater To Marine Saline Gradient | PLTMPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPAKVKKKK* |
| Ga0151516_113297 | 3300011116 | Freshwater | MPFKSKAQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK* |
| Ga0153799_10184861 | 3300012012 | Freshwater | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVK |
| Ga0177922_100369245 | 3300013372 | Freshwater | PMPFKSKKQSAACFASGGFGGAVNCLKWAKKTHYKKLPTRVKKKK* |
| Ga0181352_10260632 | 3300017747 | Freshwater Lake | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPNKK |
| Ga0181352_10636642 | 3300017747 | Freshwater Lake | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTKYKKLPTRVKKPKKK |
| Ga0181355_12142621 | 3300017785 | Freshwater Lake | MPFKSKKQSAACFASGGFGGAVNCLKWAKSTQYKKLPT |
| Ga0181355_13721971 | 3300017785 | Freshwater Lake | RPKLPVPSLIANMPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0181359_10009472 | 3300019784 | Freshwater Lake | MPFRSKSQSKACFASGGFDGAVNCMKWAKKTHYGKLPAKVKKHKKK |
| Ga0181359_10863072 | 3300019784 | Freshwater Lake | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTHYKKLPTRVKKKK |
| Ga0181359_10987602 | 3300019784 | Freshwater Lake | MPFKSKKQSAACFASGGFDGAVDCLKWAKKTHYKKLPTRVKKKK |
| Ga0194112_100707753 | 3300020109 | Freshwater Lake | MPFKSKAQSKACFASGGFNGAVNCMKWAKSTHYKKLPSKVKKKK |
| Ga0222712_100670562 | 3300021963 | Estuarine Water | MPFKSKAQSRACFASKGFDGAVDCMKWAKKTHYGKLPAKVKKPKK |
| Ga0181353_10317752 | 3300022179 | Freshwater Lake | MPFKSKKQSAACFASGGFGGSVNCLKWAKKTHYKKLPTRVKKKK |
| Ga0181353_11468533 | 3300022179 | Freshwater Lake | EGSPLSNPMPFKSKKQSAACFASGGFDGAVDCLKWAKKTHYKKLPTRVKKKK |
| Ga0181354_10076532 | 3300022190 | Freshwater Lake | MPFRSKSQSKAYFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK |
| Ga0224500_101837324 | 3300022213 | Sediment | CFASKGFDGSVDCMKWAKSTQYKKLPARVKKSKKK |
| Ga0224501_104013533 | 3300022223 | Sediment | LRVSAQLRNNMPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0214923_102628252 | 3300023179 | Freshwater | MPFKSKAQSKACFASGGFDGAVDCMKWAKKTHYGKLPSKVKKPKKK |
| Ga0255205_100011715 | 3300024276 | Freshwater | MPFRSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0208424_10011642 | 3300025445 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0208546_100065211 | 3300025585 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKQTHYKKLPAKVKKPKK |
| Ga0208546_10015556 | 3300025585 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPAKVKKSKKK |
| Ga0208546_10021031 | 3300025585 | Aqueous | QSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0208546_10030354 | 3300025585 | Aqueous | MPFKSKAQSKACFASGGFDGSVDCMKWAKQTHYKKLPAKVKKPKK |
| Ga0208147_10096171 | 3300025635 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPAR |
| Ga0208784_10304602 | 3300025732 | Aqueous | MPFKSKKQSAACFASGGFNGAVNCLEWAKKTHYKKLPTRVKKKK |
| Ga0208784_10454102 | 3300025732 | Aqueous | MPFKSKAQSKACFASGGFNGAVDCMKWAKKTHYGKLPAKVKKPKK |
| Ga0208542_10562621 | 3300025818 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPA |
| Ga0208005_10072904 | 3300025848 | Aqueous | MPFKSKAQSKACFASGGFNGAVDCMKWAKKTHYGKLPAKVKKPKKK |
| Ga0208005_10202793 | 3300025848 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKK |
| Ga0208005_11567651 | 3300025848 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLP |
| Ga0208783_100601092 | 3300025872 | Aqueous | MPFKSKAQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKK |
| Ga0208783_100635331 | 3300025872 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKS |
| Ga0208644_10073126 | 3300025889 | Aqueous | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKSKKK |
| Ga0208644_10224667 | 3300025889 | Aqueous | MPFRSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPTKVKKPKKK |
| Ga0208644_12329282 | 3300025889 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVK |
| Ga0208916_100080762 | 3300025896 | Aqueous | MPFKSKAQSRACFASKGFDGSVDCMKWAKQTHYKKLPAKVKKPKK |
| Ga0208916_100757035 | 3300025896 | Aqueous | MPFKSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPVRVKKPKKK |
| Ga0255188_10531651 | 3300027079 | Freshwater | SDAIRPRPLMPFRSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK |
| Ga0208555_10010252 | 3300027213 | Estuarine | MPFRSRAQSRACFASKGFDGGVDCMKWAKSTQYKKLPARVKQPKKK |
| Ga0208555_10238592 | 3300027213 | Estuarine | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0255182_10496662 | 3300027503 | Freshwater | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPAKVKKKK |
| Ga0209770_101212302 | 3300027769 | Freshwater Lake | MPFRSKSQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK |
| Ga0209229_100352696 | 3300027805 | Freshwater And Sediment | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTQYKKLPTRVKKKK |
| Ga0209668_107448093 | 3300027899 | Freshwater Lake Sediment | MPFKSKKQSAACFASGGFGGVVDCLKWAKKTHYKKLPTRVKKKK |
| Ga0255200_10573952 | 3300028066 | Freshwater | MPFRSKSQSKACFASGGFDGAVDCIKWAKKTHYGKLPAKVKKPKKK |
| Ga0255190_10369103 | 3300028083 | Freshwater | CFASGGFDGSVDCMKWAKSTQYKKLPAKVKKPKKK |
| Ga0255299_10338814 | 3300028089 | Freshwater | VSAQLPNNTMPFRSKAQSRACFASGGFDGSVDCMKWAKSTQYKKLPARVKKPKKK |
| Ga0315907_100500473 | 3300031758 | Freshwater | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPSKVKKKK |
| Ga0315907_102114821 | 3300031758 | Freshwater | VDSPNNMPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPARVKK |
| Ga0315907_108879292 | 3300031758 | Freshwater | MPFKSKKQSAACFASGGFGGAVNCLKWAKQTHYKKLPTRVKKKK |
| Ga0315899_101412751 | 3300031784 | Freshwater | MPFKSKAQSRACFASKGFDGSVDCMKWAKSTQYKKLPA |
| Ga0315909_106887301 | 3300031857 | Freshwater | MPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPAKV |
| Ga0315909_107480602 | 3300031857 | Freshwater | MPFKSKAQSKACFASGGFDGAVDCMKWAKKTHYGKLPAKVKKPKKK |
| Ga0316627_1011214402 | 3300033482 | Soil | MPFKSKKQSAACFASGGFGGAVNCLKWAKQTHYKKLPTRVKKKKK |
| Ga0316626_119644571 | 3300033485 | Soil | NRPLTMPFKSKAQSKACFASGGFDGAVNCMKWAKSTHYKKLPAKVKKKK |
| Ga0334982_0033806_155_289 | 3300033981 | Freshwater | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTHYKKLPSRVKKKK |
| Ga0334982_0406597_376_510 | 3300033981 | Freshwater | MPFKSKKQSAACFASGGFGGAVDCLKWAKKTQYKKLPSRVKKKK |
| Ga0335003_0258455_139_273 | 3300033995 | Freshwater | MPFKSKKQSAACFASGGFGGAVNCLKWAKSTHYKKLPARVKKKK |
| Ga0335027_0003643_195_329 | 3300034101 | Freshwater | MPFKSKKQSAACFASGGFGGAVDCLKWAKSTQYKKLPSRVKNKK |
| Ga0335027_0018841_185_319 | 3300034101 | Freshwater | MPFKSKKQSAACFASGGFGGAVNCLKWAKKTHYKKLPSRVKKKK |
| Ga0335029_0239566_947_1081 | 3300034102 | Freshwater | MPFKSKKQSGACFASGGFGGAVNCLKWAKKTHYKKLPTRVKKKK |
| Ga0348335_154627_1_108 | 3300034374 | Aqueous | SKACFASGGFDGAVNCMKWAKSTHYKKLPRKVKKK |
| ⦗Top⦘ |