


| Basic Information | |
|---|---|
| Family ID | F066649 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MTKQIEIHGQRVELYSPDQGRTWSSSPQSIVAYGQRKKMLRLELQKWF |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.67 % |
| % of genes near scaffold ends (potentially truncated) | 84.92 % |
| % of genes from short scaffolds (< 2000 bps) | 87.30 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.302 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment (10.318 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.302 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.159 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.63% β-sheet: 17.11% Coil/Unstructured: 55.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF11752 | DUF3309 | 12.70 |
| PF04120 | Iron_permease | 7.94 |
| PF01391 | Collagen | 4.76 |
| PF13545 | HTH_Crp_2 | 3.17 |
| PF02954 | HTH_8 | 2.38 |
| PF06745 | ATPase | 2.38 |
| PF00210 | Ferritin | 2.38 |
| PF05532 | CsbD | 1.59 |
| PF03631 | Virul_fac_BrkB | 1.59 |
| PF04972 | BON | 1.59 |
| PF02806 | Alpha-amylase_C | 1.59 |
| PF00072 | Response_reg | 0.79 |
| PF06305 | LapA_dom | 0.79 |
| PF08937 | DUF1863 | 0.79 |
| PF01435 | Peptidase_M48 | 0.79 |
| PF00665 | rve | 0.79 |
| PF17167 | Glyco_hydro_36 | 0.79 |
| PF02518 | HATPase_c | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.59 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.59 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.59 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.59 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.59 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.79 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.79 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.79 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.30 % |
| Unclassified | root | N/A | 12.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10824610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300000559|F14TC_100565026 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300000891|JGI10214J12806_12079122 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300000953|JGI11615J12901_13895199 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300004019|Ga0055439_10300743 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300004022|Ga0055432_10122634 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300004145|Ga0055489_10149569 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300004266|Ga0055457_10093743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300005338|Ga0068868_100231693 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300005339|Ga0070660_101899645 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005439|Ga0070711_101309607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300005456|Ga0070678_100071798 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300005459|Ga0068867_102225184 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005471|Ga0070698_100349505 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1410 | Open in IMG/M |
| 3300005471|Ga0070698_100531254 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005471|Ga0070698_101155737 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005536|Ga0070697_101700339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300005549|Ga0070704_100955419 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005556|Ga0066707_10506353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300005574|Ga0066694_10532831 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005617|Ga0068859_100258511 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1832 | Open in IMG/M |
| 3300005889|Ga0075290_1005290 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300006791|Ga0066653_10522051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Fuscovulum → Fuscovulum blasticum | 601 | Open in IMG/M |
| 3300006852|Ga0075433_10492347 | Not Available | 1080 | Open in IMG/M |
| 3300006894|Ga0079215_10233866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300006904|Ga0075424_100345524 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1585 | Open in IMG/M |
| 3300006918|Ga0079216_11038100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300006969|Ga0075419_10369540 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300007076|Ga0075435_100639480 | Not Available | 923 | Open in IMG/M |
| 3300007255|Ga0099791_10117915 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1229 | Open in IMG/M |
| 3300009053|Ga0105095_10075962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300009087|Ga0105107_10250045 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300009092|Ga0105250_10574062 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009094|Ga0111539_12622344 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009100|Ga0075418_10821063 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300009111|Ga0115026_10491576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 910 | Open in IMG/M |
| 3300009147|Ga0114129_10093313 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300009147|Ga0114129_10685977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
| 3300009162|Ga0075423_11279092 | Not Available | 784 | Open in IMG/M |
| 3300009167|Ga0113563_12560941 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009609|Ga0105347_1143212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300009678|Ga0105252_10197506 | Not Available | 860 | Open in IMG/M |
| 3300010401|Ga0134121_10133793 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300011409|Ga0137323_1078171 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300011417|Ga0137326_1010219 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300011419|Ga0137446_1137120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300011442|Ga0137437_1315957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300011445|Ga0137427_10461762 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012035|Ga0137445_1118986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012134|Ga0137330_1039862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300012171|Ga0137342_1046849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300012204|Ga0137374_10043047 | All Organisms → cellular organisms → Bacteria | 4753 | Open in IMG/M |
| 3300012207|Ga0137381_11049116 | Not Available | 702 | Open in IMG/M |
| 3300012353|Ga0137367_10390255 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300012923|Ga0137359_10746675 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012931|Ga0153915_10605609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300012931|Ga0153915_12956254 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012988|Ga0164306_11315470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300014883|Ga0180086_1033107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1202 | Open in IMG/M |
| 3300015255|Ga0180077_1117592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300015262|Ga0182007_10321949 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300016445|Ga0182038_12171478 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017997|Ga0184610_1046106 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300018031|Ga0184634_10213481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300018052|Ga0184638_1175608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300018052|Ga0184638_1233514 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018052|Ga0184638_1293622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300018063|Ga0184637_10513205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300018067|Ga0184611_1152805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300018068|Ga0184636_1281972 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300018076|Ga0184609_10058503 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1661 | Open in IMG/M |
| 3300018079|Ga0184627_10278662 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018081|Ga0184625_10018577 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300018081|Ga0184625_10294549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300018084|Ga0184629_10463600 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300019789|Ga0137408_1223935 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300021432|Ga0210384_10524629 | Not Available | 1066 | Open in IMG/M |
| 3300025001|Ga0209618_1077585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 510 | Open in IMG/M |
| 3300025160|Ga0209109_10078121 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300025165|Ga0209108_10211996 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300025312|Ga0209321_10373068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300025314|Ga0209323_10263793 | Not Available | 1093 | Open in IMG/M |
| 3300025318|Ga0209519_10046503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → Anaeromyxobacter dehalogenans | 2449 | Open in IMG/M |
| 3300025319|Ga0209520_10650288 | Not Available | 600 | Open in IMG/M |
| 3300025327|Ga0209751_10464262 | Not Available | 1040 | Open in IMG/M |
| 3300025560|Ga0210108_1078670 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300025905|Ga0207685_10174849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300025917|Ga0207660_11466812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300025917|Ga0207660_11647704 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300025932|Ga0207690_11096858 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300025936|Ga0207670_10102835 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300025945|Ga0207679_11911061 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025949|Ga0207667_11807180 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300026014|Ga0208776_1018202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300027424|Ga0209984_1037692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300027665|Ga0209983_1009736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1964 | Open in IMG/M |
| 3300027831|Ga0209797_10239037 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300027835|Ga0209515_10565653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300027840|Ga0209683_10315033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300027843|Ga0209798_10487357 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027909|Ga0209382_10239216 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300030606|Ga0299906_10518796 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300030628|Ga0247629_10315685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10035638 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300031716|Ga0310813_11212265 | Not Available | 695 | Open in IMG/M |
| 3300031740|Ga0307468_100231142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300031740|Ga0307468_101838391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300031820|Ga0307473_10914671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300031854|Ga0310904_10868735 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031944|Ga0310884_10767640 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031965|Ga0326597_10072192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4264 | Open in IMG/M |
| 3300031997|Ga0315278_12093009 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032205|Ga0307472_100988371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300033407|Ga0214472_11102378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300033407|Ga0214472_11402658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300033419|Ga0316601_102592688 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300033434|Ga0316613_11187374 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300034090|Ga0326723_0327191 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300034147|Ga0364925_0298113 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300034151|Ga0364935_0073250 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 10.32% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.17% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.59% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.59% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.59% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.59% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030628 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_108246101 | 3300000363 | Soil | MIKQIEIHGQRVKLYSSDKGRTWASSPQSIVAYGQRKRMLRCDLQK |
| F14TC_1005650263 | 3300000559 | Soil | MKKQIEIHGHRVELYSPDKGRTWSSNPQSIVAYVQRKTMLRMELQKRFA |
| JGI10214J12806_120791222 | 3300000891 | Soil | MTKKIAIHGQRVQLYSMDEGRTWSSSPQSIVAYGQRKSMLRLELQKSFEQIDDGMQD |
| JGI11615J12901_138951992 | 3300000953 | Soil | MIKLIDVHGRRVKLYSSDNGRTWSSSPQAIIAYGYRKQLLRGDLQKAF |
| Ga0055439_103007432 | 3300004019 | Natural And Restored Wetlands | MIKQIDIHGQRVKLYSSDNGRTWSSSPQSIVAYSQRKQLSRCDLQKAFERLSDIQDPE |
| Ga0055432_101226341 | 3300004022 | Natural And Restored Wetlands | MIKQIEIHGQCFELYSPDDGRTWSSSPQSIVAYRRRKKMLRLELQ |
| Ga0055489_101495691 | 3300004145 | Natural And Restored Wetlands | VVKQIDIHGRRVKLYSSDKGRTWSSSPQAILAYGQRQQILRRDL |
| Ga0055457_100937432 | 3300004266 | Natural And Restored Wetlands | MIKQIDVHGQRVKLYSSDNGRTWSSSPQSIVAYGQRKQLLRCD |
| Ga0068868_1002316934 | 3300005338 | Miscanthus Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQRKEILR |
| Ga0070660_1018996451 | 3300005339 | Corn Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQRKEIL |
| Ga0070711_1013096072 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKKIEIHGQRVQLYSLDEGRTWSSSPQSIIAYGQRKTTLRLELQKRFERLDGL |
| Ga0070678_1000717984 | 3300005456 | Miscanthus Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQRKEILRLELQERFA |
| Ga0068867_1022251841 | 3300005459 | Miscanthus Rhizosphere | MKKQIEIHGQRVDLYSLDQGRTWASSPQSIIACKEREAAL |
| Ga0070698_1003495053 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKRIVEIHGQRVGLYSLDLGRTWASSRQSIVAYGQRKTTLRWELQK* |
| Ga0070698_1005312543 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKQIEIYRQRVALYSPDKGRIWSSSPQSIVAYGQRKTMLRLELQKSF |
| Ga0070698_1011557371 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKQIEIYGQRVALYSPDKGRTWSSSPQSIVAFGQRKKMLRLELK |
| Ga0070697_1017003391 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKQIEIYGRRVALYSPDKGRTWSSSPRLIVAYRQRKKMLRLELQKSFEQIA* |
| Ga0070704_1009554191 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | QTPTKAKESFMKKRIVEIHGQRVGLYSLDLGRTWASSRQSIVAYGQRKTTLRWELQK* |
| Ga0066707_105063532 | 3300005556 | Soil | MREFMMKQIEIYGQRVELYSPDKGRTWSSCPQSIVAYGQRKTMLRLE |
| Ga0066694_105328311 | 3300005574 | Soil | MTKKIEIHGQRVQLYSLDEGHTWSSSPQSIVAYGQRKTTLRL |
| Ga0068859_1002585111 | 3300005617 | Switchgrass Rhizosphere | MVKQIEIYGERVKLYSLDGGCTWSSSPQSIVAYGRRKT |
| Ga0075290_10052905 | 3300005889 | Rice Paddy Soil | MIKQIELHGQRVKLYSSDKGRTWASSPQSIVAYGQRKRM |
| Ga0066653_105220511 | 3300006791 | Soil | MTKKIEIHGQRVQLYSLDEGHTWSSSPQSIVAYGQRKTTLRLELQKRFERLDGL |
| Ga0075433_104923472 | 3300006852 | Populus Rhizosphere | MTKQIKIHGQRVQLYSLDEGLTWSSSRQSIVAYGQRKRLLRSDLQKIFERL |
| Ga0079215_102338662 | 3300006894 | Agricultural Soil | VKSSSDAENFMTKQIEIHGRRVQLYSLDEGRTWASSPQSIVAYGQRKTMLRLELQKSFERID |
| Ga0075424_1003455243 | 3300006904 | Populus Rhizosphere | MMKQIEIYGRRVALSSPDKGRTWSSSPRLIVAYRQRKKMLRLELQKSFERIA* |
| Ga0079216_110381002 | 3300006918 | Agricultural Soil | VKSSSDAENFMTKQIEIHGRRVQLYSLDEGRTWASSPQSIVAYGQRKTMLRLELQKSFERIDGMP |
| Ga0075419_103695401 | 3300006969 | Populus Rhizosphere | MKKQIEIHGQRVELCSSDEGRTWSSNPQSIVAYGQRKTMLRLELQKRFARIDGMQ |
| Ga0075435_1006394802 | 3300007076 | Populus Rhizosphere | MMTKQIEIHGQRVRLFSSAEGRTWSSSPRPIDAYSQRKLMSGLELQKSFARIDKR |
| Ga0099791_101179153 | 3300007255 | Vadose Zone Soil | MTKKIEIHGQRVQLYSLDEGHTWSRSPQSIVAYGQRKTTLRLEL |
| Ga0105095_100759621 | 3300009053 | Freshwater Sediment | VLKQIEIHGQRFEIFYSPDDGRTWSSSPPSIVAYGRRKKTLRLELQKRFELIRTT |
| Ga0105107_102500451 | 3300009087 | Freshwater Sediment | MTKQIEINGQRVKLYSLDGGRTWSSSPQSIVAYGQRKMMLR |
| Ga0105250_105740621 | 3300009092 | Switchgrass Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGR |
| Ga0111539_126223441 | 3300009094 | Populus Rhizosphere | MTKQIEIHGQHVQLYSLDEGRTWSSSPQSIIAYGQRKTT |
| Ga0075418_108210632 | 3300009100 | Populus Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQ |
| Ga0115026_104915761 | 3300009111 | Wetland | MIKQIDIHGQRVKLYSSDKGRTWSSSPQSIVAYGQRQQALR |
| Ga0114129_100933131 | 3300009147 | Populus Rhizosphere | MKKQIEIHGQRVELCSSDEGRTWSSNPQSIVAYGQRKTMLRLELQKRF |
| Ga0114129_106859771 | 3300009147 | Populus Rhizosphere | MTKRIEIHGQRVQLYSLDEGRTWSSSPQSIIAYGQRKT |
| Ga0075423_112790922 | 3300009162 | Populus Rhizosphere | MTKQIEIHGQHVQLYSLDEGRTWSSSPQAIAAYGQ |
| Ga0113563_125609413 | 3300009167 | Freshwater Wetlands | VRAVIKQIEIHGQRFELYSPDNGRTWPSSRQSIVAYGRRKK |
| Ga0105347_11432121 | 3300009609 | Soil | MKKQIEIHGQRVELYSPDKGRTWSSSPQSILAYGQRKTMLRLELQKSFERIDAMQDPD |
| Ga0105252_101975062 | 3300009678 | Soil | MIKQIEIHGQRFELYSPDDGRTWSSSLQSIVAYERRKTILRLALQKRFELIRATED |
| Ga0134121_101337935 | 3300010401 | Terrestrial Soil | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQRKEILRLEL |
| Ga0137323_10781712 | 3300011409 | Soil | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIIAYGQRKTMLRLELQKRFERID |
| Ga0137326_10102192 | 3300011417 | Soil | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIIAYGQRKTMLRLELQKRFERIDEMQDPRSK |
| Ga0137446_11371201 | 3300011419 | Soil | MTKLIEIHGQPVKLYSSDKGCTWSSSPQSIIAYGQRKQMLRWELQKRFE |
| Ga0137437_13159571 | 3300011442 | Soil | MMKQIEIHGQRVALYSPDKGRTWSSSPKSIVAYGQRKKMLRLE |
| Ga0137427_104617621 | 3300011445 | Soil | MIKQIEIHGQRFELYSPDDGRTWSSSLQSIVAYERRKTIL |
| Ga0137445_11189861 | 3300012035 | Soil | MVKQIAIHGQRVKLFSSDKGRTWSSNPRSIVAYGQRKQRLCCELQKTFERVDE |
| Ga0137330_10398621 | 3300012134 | Soil | VVKQIYIQGQRVKLYSSDKGRTWSSSPQSIVAYGQRKQVLRGELQKAFER |
| Ga0137342_10468492 | 3300012171 | Soil | MMKQIEIHGQRVELYSLAKGRTWSSSPQSIIAYGQREKMLRLELQ |
| Ga0137374_100430475 | 3300012204 | Vadose Zone Soil | MKKQIEIHGQRVELCSSDEGRTWSSNPQSIVAYGQRKTMLRLELQKRFARIDDMQDPDPISQNLRFQ* |
| Ga0137381_110491162 | 3300012207 | Vadose Zone Soil | MTKKIEIHGQRVQLYSLDEGHTWSSSPQSIVAYGQRKTTLRLELQKRFERLDGLQYPD |
| Ga0137367_103902553 | 3300012353 | Vadose Zone Soil | MKKQIEIHGQRVELCSSDEGRTWSSNRKSIVAYRRRKTMLRLELQKRFEH |
| Ga0137359_107466752 | 3300012923 | Vadose Zone Soil | MTKRIEIYGQRVQLYSLDEGRTWSSSPQSIIAYGQRKTTLRLELQKRFERLDGMQDPDP |
| Ga0153915_106056091 | 3300012931 | Freshwater Wetlands | DTMLKQIENNGQRFELHSADQGRTWSSSPRSIIAYARRKKTAQLELQKKFEEIDET* |
| Ga0153915_129562543 | 3300012931 | Freshwater Wetlands | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIVAYERR |
| Ga0164306_113154702 | 3300012988 | Soil | MTKQIEIHGKRVQLYSLDEGRTWSSSPQSIIAYGQRKTTLRLELQKRFERV |
| Ga0075312_10200262 | 3300014254 | Natural And Restored Wetlands | MTKQIEIHGQRVQLYSFDDGRTWSSTPQSIVAFGQRQTLLRLELQKSFERIDVMPDSIRITSLNLRSQ* |
| Ga0180086_10331071 | 3300014883 | Soil | MVKQIEIHGQRIEVHSPDKGRTWSSSPRAIVAYGQRKRMLRFELQKRF |
| Ga0180077_11175921 | 3300015255 | Soil | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIIAYRQRKTMLRLELQKRFERIDEMQDPRSK |
| Ga0182007_103219491 | 3300015262 | Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQREEILRL |
| Ga0182038_121714781 | 3300016445 | Soil | MTKQVEIHGQRVKVYSSDEGRTWSSSPRPIDAYSQRKM |
| Ga0184610_10461064 | 3300017997 | Groundwater Sediment | MMKQIEIYGQRVALYSPDKGRTWSSSPQSIIAYGQRKTMLRLELQKSFERIDKMQDPRSE |
| Ga0184634_102134811 | 3300018031 | Groundwater Sediment | MLKQIEINGQRFELYSPDKGRTWSSSPRSIVAFGRRKKMLSLELRKRFELMDE |
| Ga0184638_11756081 | 3300018052 | Groundwater Sediment | MMKQIEIHGQRVKLYSSDKERTWSSSPQSIVAYGQRKTMLRLELQKR |
| Ga0184638_12335142 | 3300018052 | Groundwater Sediment | MMKQIEIYGQWVALYSPDKGRTWSSSPQSIVAFGQRKKMLRLELKQRFA |
| Ga0184638_12936221 | 3300018052 | Groundwater Sediment | MTKQIEIHGQRVELYSPDQGRTWSSSPQSIVAYGQRKKMLRLELQKWF |
| Ga0184637_105132051 | 3300018063 | Groundwater Sediment | MKKQIEIHGQRIELYSPDKGRTWSSSPQSIVAYGQRQEILRLELKQRFARIDEMQDPDP |
| Ga0184611_11528052 | 3300018067 | Groundwater Sediment | VSDDEPDQENFMMKQIEIYGKRLALYSPDKGRTWSSSPRLIVAYRQRKKMLRLELQKSFERIA |
| Ga0184636_12819723 | 3300018068 | Groundwater Sediment | MIKQIEIYGQRVKLYSSDKGRTWSSSSQSIVAYGQR |
| Ga0184609_100585035 | 3300018076 | Groundwater Sediment | MMKQIEIYGQRVALYSPDKGRTWSSSPQSIVAYGQRKTMLR |
| Ga0184627_102786623 | 3300018079 | Groundwater Sediment | MMKQIEIYGQRVALYSPDKGRTWSSSPQSIVAYGQ |
| Ga0184625_100185775 | 3300018081 | Groundwater Sediment | MMKQIEIYGKRLALYSPDKGRTWSSSPRLIVAYRQRKKMLRLELQKSFERIA |
| Ga0184625_102945491 | 3300018081 | Groundwater Sediment | MTKKIEIHGQRVQLYSLDEGRTWSSSPQSIIAYGQRKTTLRLELQKRFER |
| Ga0184629_104636002 | 3300018084 | Groundwater Sediment | MKKRIDIHGQRVELYSSDEGRTWTSNPQSIVAYGQRKEILRLEL |
| Ga0137408_12239353 | 3300019789 | Vadose Zone Soil | MKKQIEIHGKRVELCSSDEGRTWSSNPQSIVAYIQRKTMLRLELQKRFARIDE |
| Ga0210384_105246292 | 3300021432 | Soil | MTKQIEIHGQRVQLYSLDEGRTWSSSPQSIVAYGQRKTM |
| Ga0209618_10775851 | 3300025001 | Soil | MMKQIELYGQCFELYSADGGRTWSSDPRSIVAYEQRREL |
| Ga0209320_100238566 | 3300025155 | Soil | MTKQIEIHGQRVQLYSFDDGRTWSSTPQSIVAFGQRKTLLRLELQKSFERIDVVPDPIRITSLNLRS |
| Ga0209619_105022612 | 3300025159 | Soil | MTKQIEIHGQRVQLYSFDDGRTWSSTPQSIVAFGQRKTLLRLELQKSFERIDVMPDPIRITSLNLRSQ |
| Ga0209109_100781211 | 3300025160 | Soil | MMKQIEIHGQRIELYSPDKGRTWSSNPRSIVAYGQRKKMLRLELQKGFER |
| Ga0209108_102119961 | 3300025165 | Soil | MVKQIEVHGQRVELYSLDEGHTWSSNPQSIVAYGQRKELSR |
| Ga0209321_103730683 | 3300025312 | Soil | MMKQIEIHGQRIELYSPDKGRTWSSSSQSIVAYGRRKKTLSLELQKRFER |
| Ga0209323_102637932 | 3300025314 | Soil | MTKQIEIKGQRVKLYSSDNGRTWSSSPQSIVAYGQRQTMLRLELQKRFERI |
| Ga0209519_100465031 | 3300025318 | Soil | MMKQIEIYGKRIEVYSPDKGRTWSSSPRAIVAYGQRKRM |
| Ga0209519_100623693 | 3300025318 | Soil | MTKQIEIHGQRVQLYSFDDGRTWSSTPQSIVAFGQRKTLLRLELQKSFERIDVVPDPIRITSLNLRSQ |
| Ga0209520_106502882 | 3300025319 | Soil | MKQIEVHGRRVKLYSPDGGRTWSSNPQSIVAYGQRKELLR |
| Ga0209751_104642621 | 3300025327 | Soil | MTKQIEIHGQRVQLYSLDGGCTGSSRPQSMVAYGQRKKMLRLEIQQR |
| Ga0210108_10786702 | 3300025560 | Natural And Restored Wetlands | MTKQIVVHGQRVKLYCQDGGHTWSSNPQAISAYGRRKELLRLELKYSFARIDEMRDLDPE |
| Ga0207685_101748492 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKQIEIQGQRVQLYSLDEGRTWSSSPQSIVAYGQRQTVLRLELQKRFARI |
| Ga0207660_114668122 | 3300025917 | Corn Rhizosphere | MTKKIAIHGQRVQLYSMDEGRTWSSSPQSIVAYGQRKSMLRLELQKSFEHIDDG |
| Ga0207660_116477041 | 3300025917 | Corn Rhizosphere | MKKRIDLHGQRVELYSADEGRTWTSSPQSIIAYRQRK |
| Ga0207690_110968581 | 3300025932 | Corn Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGRRK |
| Ga0207670_101028355 | 3300025936 | Switchgrass Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQRKEI |
| Ga0207679_119110611 | 3300025945 | Corn Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGRRKEILRLELKERFA |
| Ga0207667_118071802 | 3300025949 | Corn Rhizosphere | MKKRIDIHGQRVELYSSDQGRTWSSNPQLIAAYGQRKEILRLELKERFAR |
| Ga0208776_10182021 | 3300026014 | Rice Paddy Soil | MIKQIELHGQRVKLYSLDKGRTWASSPQSIVAYGQRKRM |
| Ga0208654_10131171 | 3300026062 | Natural And Restored Wetlands | MTKQIEIHGQRVQLYSFDDGRTWSSTPQSIVAFGQRQTLLRLELQKSFERIDVMPDSIRITSLNLRSQ |
| Ga0209984_10376921 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MMKQIEIYGQRVALYSPDKGRTWSSSPQSIVAYGQRKAMLRLELQKGFERIDGEMQDPD |
| Ga0209983_10097361 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MIKQIELHGQRVKLYSSDKGRTWASSPQSIVAYGQRKRMLRCDLQKTFERLEEIQDLDSPRS |
| Ga0209797_102390372 | 3300027831 | Wetland Sediment | MKKTIEIHGQRVTLFSSDEGRTWASNPQSTIAYGEREEMLRR |
| Ga0209515_105656531 | 3300027835 | Groundwater | VVKQIEINGQRFELYSPDKGRTWSSSPRSIVAYGQRKKMLRLEL |
| Ga0209683_103150331 | 3300027840 | Wetland Sediment | MTKQIEIHGQRVKIYSLDKGRTWSSSPQSIVAYGQREKMLRNDL |
| Ga0209798_104873573 | 3300027843 | Wetland Sediment | MIKQIEIHGRRVKLYSSDKGRTWSSSPQSIVAYGQRKQT |
| Ga0209382_102392163 | 3300027909 | Populus Rhizosphere | MMKQIEIHGQRVQLYSLDKGSTWSSSPQAIVAYGQRKSMLRLELQKS |
| Ga0299906_105187961 | 3300030606 | Soil | MIKQIEIHGQCFELYSPDDGRTWSSSPQSIVAYGRRKTMLCLELQKRFGLIRATE |
| Ga0247629_103156851 | 3300030628 | Soil | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIVAYGQRKKILRVELQKSFERIAEM |
| (restricted) Ga0255310_100356381 | 3300031197 | Sandy Soil | LIKQIEIHGQRFELYSPDEGRTWSSSPQSIVAYGRRKKKSRLE |
| Ga0299913_103458022 | 3300031229 | Soil | MTKQIEIHGQRVQLYSFDDGRTWSSTPQSIVAFGQRKTLLRLELQKSFERIDVVPEPIRITSLNLRSQ |
| Ga0310813_112122652 | 3300031716 | Soil | MIKQVEVHGHRIKLYSLDGGQTWSSSPQSIVAYRHRERL |
| Ga0307468_1002311422 | 3300031740 | Hardwood Forest Soil | MTKQIEIHGQRVQLYSLGEGHTWSSSPQSIVAYGQRKTMLRLELQKRFERIDGDAGPRSE |
| Ga0307468_1018383911 | 3300031740 | Hardwood Forest Soil | MTKQIEIHGQRVQLYSLDEGRTWSSSPQAIAAYGQRQTML |
| Ga0307473_109146712 | 3300031820 | Hardwood Forest Soil | MTKQIEIHGQRVQLYSLGEGHTWSSSPQSIVAYGQRKTMLRLELQKRFERIDGDAG |
| Ga0310904_108687351 | 3300031854 | Soil | MTKQIEIHGQRVRLYSLDEGHTWASSQQSIVDYGQRQTMLRLELQKRF |
| Ga0310884_107676402 | 3300031944 | Soil | MKKIIEIHGQRVELYSRDEGRTWSSNPQLIVAYEQRRE |
| Ga0326597_100721925 | 3300031965 | Soil | MIKQIEIYGQRVKLYSSDKGRTWSSSSQSIVAYGQRK |
| Ga0315278_120930092 | 3300031997 | Sediment | MIKQIEIYGQRLKLRSVDKERTGSSSPQSIVACGQRKQM |
| Ga0307472_1009883711 | 3300032205 | Hardwood Forest Soil | MMKQIEIYGRRVALYSPDKGRTWSSSPRLIVAYRQRKKMLRLELQKSFEQIA |
| Ga0214472_111023783 | 3300033407 | Soil | MIKQIEIHGQCVELYSPDDGRTWSSSPRLIVAYERRKKTLRLDLQKRFERID |
| Ga0214472_114026581 | 3300033407 | Soil | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIVDYGQRKKMLRLELQKRFERMAEMQDTDP |
| Ga0316601_1025926882 | 3300033419 | Soil | MKKIIEIHGQRVELYSLDEGRTWSSNPQSIVAYGQRQETLRLEIQQKFARIDDM |
| Ga0316613_111873741 | 3300033434 | Soil | MKKIIEIHGQRVELYSLDEGRTWSSNPQSIVAYGQRQETLRLEIQQ |
| Ga0326723_0327191_530_688 | 3300034090 | Peat Soil | MTKQIEIHGQRVHLFSLDEGHTWSSSPQSIVAYGQRQTMLRLELQKRFERIDE |
| Ga0364925_0298113_430_603 | 3300034147 | Sediment | MTKQIEIHGQRVQLSSLDEGRTWSSSPQSSVAYEQRKTMLRLELQKRFESIDGIPDPV |
| Ga0364935_0073250_164_316 | 3300034151 | Sediment | MTKQIEIHGQRVELYSPDKGRTWSSSPQSIIAYGQRKTMLRLELQKGLNA |
| ⦗Top⦘ |