


| Basic Information | |
|---|---|
| Family ID | F066606 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.80 % |
| % of genes near scaffold ends (potentially truncated) | 34.92 % |
| % of genes from short scaffolds (< 2000 bps) | 87.30 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.063 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.460 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.397 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.651 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.07% β-sheet: 21.92% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF13847 | Methyltransf_31 | 40.48 |
| PF13649 | Methyltransf_25 | 13.49 |
| PF02635 | DrsE | 7.94 |
| PF12847 | Methyltransf_18 | 5.56 |
| PF08241 | Methyltransf_11 | 3.97 |
| PF07690 | MFS_1 | 3.97 |
| PF13360 | PQQ_2 | 3.17 |
| PF01206 | TusA | 1.59 |
| PF13489 | Methyltransf_23 | 0.79 |
| PF00903 | Glyoxalase | 0.79 |
| PF08704 | GCD14 | 0.79 |
| PF02771 | Acyl-CoA_dh_N | 0.79 |
| PF01451 | LMWPc | 0.79 |
| PF07992 | Pyr_redox_2 | 0.79 |
| PF13701 | DDE_Tnp_1_4 | 0.79 |
| PF00230 | MIP | 0.79 |
| PF09837 | DUF2064 | 0.79 |
| PF07274 | DUF1440 | 0.79 |
| PF12697 | Abhydrolase_6 | 0.79 |
| PF13442 | Cytochrome_CBB3 | 0.79 |
| PF01797 | Y1_Tnp | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.59 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.79 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.79 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.79 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG3477 | Uncharacterized membrane protein YagU, involved in acid resistance, DUF1440 family | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.06 % |
| Unclassified | root | N/A | 7.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_10518446 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10471224 | Not Available | 548 | Open in IMG/M |
| 3300000574|JGI1357J11328_10038999 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300000787|JGI11643J11755_11238345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300000890|JGI11643J12802_11298136 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300002223|C687J26845_10021208 | All Organisms → cellular organisms → Bacteria | 2879 | Open in IMG/M |
| 3300004114|Ga0062593_100235409 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300004156|Ga0062589_102899788 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300004157|Ga0062590_100944345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300004157|Ga0062590_102588923 | Not Available | 539 | Open in IMG/M |
| 3300004463|Ga0063356_103038857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio | 723 | Open in IMG/M |
| 3300004480|Ga0062592_100569489 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005172|Ga0066683_10174534 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300005176|Ga0066679_10270927 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005180|Ga0066685_10144501 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300005180|Ga0066685_10662196 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005181|Ga0066678_10295222 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005181|Ga0066678_10931215 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005290|Ga0065712_10119565 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300005294|Ga0065705_10126230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2665 | Open in IMG/M |
| 3300005345|Ga0070692_10895811 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005445|Ga0070708_100391181 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300005445|Ga0070708_101868819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300005446|Ga0066686_10450294 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005467|Ga0070706_100791459 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005518|Ga0070699_101010042 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005536|Ga0070697_101907787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 532 | Open in IMG/M |
| 3300005542|Ga0070732_10000423 | All Organisms → cellular organisms → Bacteria | 27445 | Open in IMG/M |
| 3300005555|Ga0066692_10548606 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005557|Ga0066704_10764982 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005558|Ga0066698_10335965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300005558|Ga0066698_10539034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300005575|Ga0066702_10615972 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005576|Ga0066708_10875647 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005616|Ga0068852_101488650 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005618|Ga0068864_101083092 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005713|Ga0066905_100121067 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300005937|Ga0081455_10631471 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006032|Ga0066696_11013710 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006034|Ga0066656_10564598 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006042|Ga0075368_10272174 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006800|Ga0066660_11123503 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006806|Ga0079220_10846072 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006844|Ga0075428_100982438 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300006844|Ga0075428_102403088 | Not Available | 541 | Open in IMG/M |
| 3300006853|Ga0075420_101935162 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006880|Ga0075429_100931430 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006894|Ga0079215_10124869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300006904|Ga0075424_102272280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 570 | Open in IMG/M |
| 3300006914|Ga0075436_100947472 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300007004|Ga0079218_10198196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
| 3300009012|Ga0066710_100186521 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
| 3300009012|Ga0066710_103425062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300009078|Ga0105106_10414985 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300009087|Ga0105107_10058736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2717 | Open in IMG/M |
| 3300009089|Ga0099828_10527637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300009090|Ga0099827_11099497 | Not Available | 690 | Open in IMG/M |
| 3300009101|Ga0105247_10771926 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300009137|Ga0066709_102085694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300009137|Ga0066709_103007523 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300009174|Ga0105241_10635585 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300009177|Ga0105248_10800021 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300009545|Ga0105237_11967293 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009815|Ga0105070_1085064 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010040|Ga0126308_10222804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300010304|Ga0134088_10164137 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012022|Ga0120191_10002424 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300012034|Ga0137453_1003180 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300012035|Ga0137445_1075591 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012681|Ga0136613_10799380 | Not Available | 502 | Open in IMG/M |
| 3300012975|Ga0134110_10338386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 656 | Open in IMG/M |
| 3300014265|Ga0075314_1016817 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300014268|Ga0075309_1196547 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300015241|Ga0137418_11271062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300015359|Ga0134085_10476687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300015371|Ga0132258_10499958 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
| 3300015371|Ga0132258_11739600 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300015371|Ga0132258_13579326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300016319|Ga0182033_11325239 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300017656|Ga0134112_10160282 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300018078|Ga0184612_10341045 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300018082|Ga0184639_10123337 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300018431|Ga0066655_10286258 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300018433|Ga0066667_11252586 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300018468|Ga0066662_10199748 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300018476|Ga0190274_10146320 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300018481|Ga0190271_10661594 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300018482|Ga0066669_10794232 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300019360|Ga0187894_10043672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2707 | Open in IMG/M |
| 3300019360|Ga0187894_10502730 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300019362|Ga0173479_10167639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300025155|Ga0209320_10219831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300025165|Ga0209108_10164328 | Not Available | 1163 | Open in IMG/M |
| 3300025167|Ga0209642_10591933 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025319|Ga0209520_10542754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300025322|Ga0209641_10200947 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300025324|Ga0209640_10212213 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300025914|Ga0207671_10189862 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300025922|Ga0207646_11368990 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300025925|Ga0207650_10159969 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300026075|Ga0207708_10129006 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300026324|Ga0209470_1338612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300026537|Ga0209157_1319088 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026540|Ga0209376_1172370 | Not Available | 1014 | Open in IMG/M |
| 3300027543|Ga0209999_1063693 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300027657|Ga0256865_1225232 | Not Available | 502 | Open in IMG/M |
| 3300027815|Ga0209726_10011086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8951 | Open in IMG/M |
| 3300027815|Ga0209726_10099679 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300027818|Ga0209706_10238901 | Not Available | 873 | Open in IMG/M |
| 3300027842|Ga0209580_10000201 | All Organisms → cellular organisms → Bacteria | 39021 | Open in IMG/M |
| 3300027909|Ga0209382_10183525 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300028812|Ga0247825_10450765 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031740|Ga0307468_101702127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031770|Ga0318521_10758890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300031796|Ga0318576_10345780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300031820|Ga0307473_11292670 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031911|Ga0307412_10437493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300031954|Ga0306926_10266927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2120 | Open in IMG/M |
| 3300031954|Ga0306926_11795322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300031965|Ga0326597_10131850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3005 | Open in IMG/M |
| 3300031965|Ga0326597_10191613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2406 | Open in IMG/M |
| 3300031965|Ga0326597_10681904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300032001|Ga0306922_11750206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300032013|Ga0310906_10560622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300033290|Ga0318519_10652038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.38% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.59% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.59% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.59% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.59% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.79% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0017.00004210 | 2162886013 | Switchgrass Rhizosphere | LTAAGFEQVAIRERFDSFRGTTKERTARKFGVIGVNVYAAKPK |
| ICChiseqgaiiFebDRAFT_104712241 | 3300000363 | Soil | LLGHRGFERVVVKERFDCFRGTSKERVAAKYGVAGVNVYARKPR* |
| JGI1357J11328_100389993 | 3300000574 | Groundwater | MEILRGIGFQDVELRRRFDPFRATTKEAVARKFGVVGVNVYARKPN* |
| JGI11643J11755_112383451 | 3300000787 | Soil | LPEAELLALLTQIGFRDVAVTDRFDCFDDTTKERTARKYGVVGVNVYAAKX* |
| JGI11643J12802_112981362 | 3300000890 | Soil | QIGFRDVAVTDRFDCFDDTTKERTARKYGVVGVNVYAAKS |
| C687J26845_100212083 | 3300002223 | Soil | LLNDLGFRDVRVVQRFDCFRATSKERTARNYGVRGVNVLARKPHSLTRSRY* |
| Ga0062593_1002354092 | 3300004114 | Soil | VLLGHLGFDEVDVKERFDCFRGTSKEGVARKYGVVGVNVYARKPLSTVR* |
| Ga0062589_1028997881 | 3300004156 | Soil | VVLTQTGFQNVAIRERFDCFRGTSKERTARTYGVIGVNVYATKPR* |
| Ga0062590_1009443451 | 3300004157 | Soil | GQIGFEDVAIQERFDCFRGTSKERVAMKYGVVGVNVYARKPGRR* |
| Ga0062590_1025889232 | 3300004157 | Soil | LVALLGHLRFDDVVVKERFDCFRGTSKEGVARKYGVVGVNVYAQKPAVTMKVIS* |
| Ga0063356_1030388572 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VALLEQIGFSGVVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRL* |
| Ga0062592_1005694892 | 3300004480 | Soil | VALLEQIGFSGVVIKQRFDCFRGTSKEGVAKKYGVIGVNVYAHKANRL* |
| Ga0066683_101745342 | 3300005172 | Soil | VGLLTQLGFQGVVAKERFDCFRGTSKEGVARKYGVVGVNVHACKPVG* |
| Ga0066679_102709273 | 3300005176 | Soil | ELVGLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR* |
| Ga0066685_101445011 | 3300005180 | Soil | LPEAELIAVLSQIGFTDVVVRDRFDCFRGTSKEGVAKKYGVVGVNVYASKGRDGAPKN* |
| Ga0066685_106621963 | 3300005180 | Soil | LLTQIGFQGVIVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP* |
| Ga0066678_102952221 | 3300005181 | Soil | IGFQNVELRERFDPFRGTSKEKIARQFGVVGVNVYAQKRKV* |
| Ga0066678_109312152 | 3300005181 | Soil | RSLDRLNCRRSAELITLLTQIGFQGVVVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP* |
| Ga0065712_101195653 | 3300005290 | Miscanthus Rhizosphere | VLLGHLGFDEVDVKERFHCFRGTSKEGVARKYGVVGVNVYARKPLSTVR* |
| Ga0065705_101262303 | 3300005294 | Switchgrass Rhizosphere | LTAAGFEQVAIRERFDSFRGTTKERTARKFGVIGVNVYAAKPK* |
| Ga0070692_108958112 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VALLEQIGFSDVVIRQRFDCFRGTSKEGVATKYGVVGVNLYAHKANRL* |
| Ga0070708_1003911812 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAAAGFRDVEIRERFDCFRGTSKEAIARKYGVMGVNVFGCKPS* |
| Ga0070708_1018688191 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ELAVVLHQIGFHDVAIRERFDCFRGSSKERTARKYGVIGVNVYARKDE* |
| Ga0066686_104502942 | 3300005446 | Soil | LIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVVGVNVYAQKRKV* |
| Ga0070706_1007914591 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGRVGLSDVRVTDRYDCFRGTSKEGVARKYGVIGVNVYARKPELP* |
| Ga0070699_1010100422 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLGQIGFEGVVLKERFNCFRGTSKEGVATKYGVVGVNVYALRG |
| Ga0070697_1019077871 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLSDVRVTDRYDCFRGTSKEGVARKYGVVGVNVYARKPELP* |
| Ga0070732_100004236 | 3300005542 | Surface Soil | VAELLNVLSAVGFGQVEVRERFDCFRGTTKERTARKYGVMGVNVHARKPA* |
| Ga0066692_105486061 | 3300005555 | Soil | IGFQGVIVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP* |
| Ga0066704_107649822 | 3300005557 | Soil | LIQVLRGIGFQNVELRERLDPFRGTSKEKIARQFGVIGVNVYAQKRKV* |
| Ga0066698_103359653 | 3300005558 | Soil | VLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVY |
| Ga0066698_105390342 | 3300005558 | Soil | LIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKRKV* |
| Ga0066702_106159722 | 3300005575 | Soil | VGLLTQLGFESVAVKERFDCFRGTSKEDVARKYGVVGVNVHASRPDRR* |
| Ga0066708_108756472 | 3300005576 | Soil | VLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR* |
| Ga0068852_1014886502 | 3300005616 | Corn Rhizosphere | VLTQAGFSNVRALDHFDCFRQTSKERTARKYGVMGVNVY |
| Ga0068864_1010830921 | 3300005618 | Switchgrass Rhizosphere | LLGHLGFDDVVVKERFDCFRGTSKERVAMKYGVIGVNVYARKPR* |
| Ga0066905_1001210673 | 3300005713 | Tropical Forest Soil | VLARVGFSSVRVTDRYDCFRATAKESVARKFGVIGVNVYARKPS* |
| Ga0081455_106314712 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VLKATGFEQVEVREQFDCFRGTSKERTARKYGVVGLNVYARKPFQE* |
| Ga0066696_110137102 | 3300006032 | Soil | VGLLTQLGFQGVVAKERFDCFRGTSKEGVARKYGVVGVNVHASRPDRR* |
| Ga0066656_105645981 | 3300006034 | Soil | MTLLTQIGFQRVVVKERFDCFRGTSKEGVAKKYGVSGVNLYAAKPKPEAP* |
| Ga0075368_102721742 | 3300006042 | Populus Endosphere | VLGRVGFADVRVVERFDCFQGTTKERTAQKYGVIGVNVYARKE* |
| Ga0066660_111235032 | 3300006800 | Soil | GALPEAELVGLLTQLGFQDVVAKERFDCFRGTSKEGVAKKYGVVGVNVHASKPHRP* |
| Ga0079220_108460722 | 3300006806 | Agricultural Soil | VLTETGFSDVAITHRFDCFHGTSKEGTARKYGVIGVNVFARRAQ* |
| Ga0075428_1009824382 | 3300006844 | Populus Rhizosphere | VALLEQIGFSDIVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRP* |
| Ga0075428_1024030881 | 3300006844 | Populus Rhizosphere | ELVALLGHLGFDDVVVKERFDCFRGTSKERVAAKYGVVGVNVYARKPR* |
| Ga0075420_1019351621 | 3300006853 | Populus Rhizosphere | LLGDIGFEGVAVRQHFDCFRGTSKEGVARKYEVVGVNVFAHTPGKR* |
| Ga0075429_1009314301 | 3300006880 | Populus Rhizosphere | VALLEQIGFSDIVLKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRP* |
| Ga0079215_101248691 | 3300006894 | Agricultural Soil | VTLLGHLGFERVVVKERFDCFRGTSKERVAAKYGVAGVNVY |
| Ga0075424_1022722801 | 3300006904 | Populus Rhizosphere | EAELLALLGQIGFDDVAAKQRFDCFRGTSKEGVARKYGVVGVNVYARKPNRR* |
| Ga0075436_1009474722 | 3300006914 | Populus Rhizosphere | VLTRVGFSGARVTDRFDCFRGTSKEGVARKYGVLGVNVYARRPD* |
| Ga0079218_101981963 | 3300007004 | Agricultural Soil | VTLLGHLGFERVVVKERFDCFRGTSKERVAAKYGVAGVNVYARKPR* |
| Ga0066710_1001865212 | 3300009012 | Grasslands Soil | VLNAIGFTMVDVTEHFDCFAGTSKEGTARKYGVFGVNVHARKP |
| Ga0066710_1034250622 | 3300009012 | Grasslands Soil | LIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVVGVNVYAQKRKV |
| Ga0105106_104149852 | 3300009078 | Freshwater Sediment | MEILRGIGFQDVELRRRFDPFRATTKEPVARKFGVIGVNVYARKPN* |
| Ga0105107_100587362 | 3300009087 | Freshwater Sediment | VAELVEALGSAGLSDVRVDRSFDCFRGTSKENVASKYGVRGVNVYGRKRA* |
| Ga0099828_105276372 | 3300009089 | Vadose Zone Soil | LIQVLQGIGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKRKV* |
| Ga0099827_110994972 | 3300009090 | Vadose Zone Soil | LIQVLRGVGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKRKV* |
| Ga0105247_107719262 | 3300009101 | Switchgrass Rhizosphere | VLTQAGFSNVRALDHFDCFRQTSKERTARKYGVMGVNVYARKA* |
| Ga0066709_1020856942 | 3300009137 | Grasslands Soil | LLAQIGFQGVVVNERFDCFRGTSKEGVARKYGVAGVNLHACKPR* |
| Ga0066709_1030075232 | 3300009137 | Grasslands Soil | MTLLTQIGFQGVIVKERFDCFRGTSKEDVAKKYGVSGVNVYASKP* |
| Ga0105241_106355852 | 3300009174 | Corn Rhizosphere | VLTQAGFSNVRVLDHFDCFRQTSKERTARKYGVMGVNVYARKA* |
| Ga0105248_108000213 | 3300009177 | Switchgrass Rhizosphere | GRLGFIGVRVTERFDAFRGTSKERTAQKYGVIGVNVYAQKRATGETL* |
| Ga0105237_119672931 | 3300009545 | Corn Rhizosphere | VGFIDIRVTDRFECFRGTSKERTALKYGVIGVNVYARKPTAQ* |
| Ga0105070_10850641 | 3300009815 | Groundwater Sand | LGGAGFEAVEIRERFDCFAGTTKERVARKYGVSGVNVYARKPART* |
| Ga0126308_102228043 | 3300010040 | Serpentine Soil | ELVALLGHLGFEDVVIRERFDRFRRTSKEGVARKYGVAGVNVYARKPRRR* |
| Ga0134088_101641372 | 3300010304 | Grasslands Soil | MTLLTQIGFQGVIVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP* |
| Ga0120191_100024242 | 3300012022 | Terrestrial | VPFLNLIGFSDITIKERFDCFRGTRKEGTARKYGVAGMNVFARKPPRR* |
| Ga0137453_10031802 | 3300012034 | Soil | ALPEAELIALLREVGFHDVALKERFDCFRGTSKEAIAAKYGVIGVNVYARKPNRG* |
| Ga0137445_10755911 | 3300012035 | Soil | GFERVEIRERFDCFRGTTKERTARKYGVMGVNVYARKP* |
| Ga0136613_107993801 | 3300012681 | Polar Desert Sand | MLGSIGFRDVEVRERFDSFRGTSKERFARKYGVMGVNVYARKP* |
| Ga0134110_103383862 | 3300012975 | Grasslands Soil | LIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKQKV* |
| Ga0075314_10168173 | 3300014265 | Natural And Restored Wetlands | VALLAQIGFDDVVVKERFDCFRGTSKEGVATKYGVVGVNVHARRPNRR* |
| Ga0075309_11965472 | 3300014268 | Natural And Restored Wetlands | MTLLADLGFHAAEVRDRFDCFRGTSKERVALKYGVTGVNVYAVKPH* |
| Ga0137418_112710621 | 3300015241 | Vadose Zone Soil | EAELVVLLGDLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR* |
| Ga0134085_104766872 | 3300015359 | Grasslands Soil | GHLGFDGVVVKERFDCFRGTSTERVAMKYGVVGVNVYARKPLSTVR* |
| Ga0132258_104999582 | 3300015371 | Arabidopsis Rhizosphere | VALLAQVGFRDVAVTDRFDCFHDTSKERVARTYGVVGVNVYAARP* |
| Ga0132258_117396003 | 3300015371 | Arabidopsis Rhizosphere | LVRVGFSGVRVTERYDCFRATSKESVARKFGVVGVNVHARKP* |
| Ga0132258_135793262 | 3300015371 | Arabidopsis Rhizosphere | VLRAAGFAPVEVRGRFDCFIGTSKERTAKKYGVIGLNVFARRPVR* |
| Ga0132257_1018659331 | 3300015373 | Arabidopsis Rhizosphere | MEVLSSIGFKDVNVAERFDPFRGTSKEGTAQKFGVTGVNVLARKP* |
| Ga0182033_113252392 | 3300016319 | Soil | VALLGHLGFADVIVKERFDCFRGTSKERVAMKYGVVGVNVYARKPR |
| Ga0134112_101602821 | 3300017656 | Grasslands Soil | MTLLTQIGFQRVVVKERFDCFRGTSKEGVAKKYGVSGVNLYAAKPKPEAP |
| Ga0184612_103410452 | 3300018078 | Groundwater Sediment | VLAGVGFEAVELRERFDCFRGTTKEGVARKYGVTGVNVYARKPDRTA |
| Ga0184639_101233374 | 3300018082 | Groundwater Sediment | ALNGIGFHDVEVRERFDPFRGTSKERIARKFGVLGVNVYARKPDPTAAEPRGRHR |
| Ga0066655_102862582 | 3300018431 | Grasslands Soil | VLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR |
| Ga0066667_112525862 | 3300018433 | Grasslands Soil | VALLTQLGFQGVVVKERFDCFRGTSKEGVARKYGVIGVNVHASKPDRR |
| Ga0066662_101997482 | 3300018468 | Grasslands Soil | MTLLTEIGFQGVVVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP |
| Ga0190274_101463203 | 3300018476 | Soil | VGLIDIRVTDRFECFRGTSKERTALKYGVIGVNVYARKPTAP |
| Ga0190271_106615942 | 3300018481 | Soil | VTLLGHLGFEEVVVKERFDCFRGTSKERVAAKYGVVGVNVYARKPR |
| Ga0066669_107942322 | 3300018482 | Grasslands Soil | VRLLTQLGFESVAVKERFDCFRGTSKEDVARKYGVVGVNVHASRPDRR |
| Ga0187894_100436723 | 3300019360 | Microbial Mat On Rocks | LRATGFEHVAVRKQFDCFRGSSKERTAKKYGVVGVNVYARKPMCTEVRSIR |
| Ga0187894_105027301 | 3300019360 | Microbial Mat On Rocks | VLGRVGFAAVREVERFDCFQGTTKERTARKYGVMGVNVYARKD |
| Ga0173479_101676392 | 3300019362 | Soil | GHLSFDDVVVTERFDCFRGTSKEGVARKYGVVGVNVYAHKPAVTLKVIS |
| Ga0209320_102198312 | 3300025155 | Soil | MEILSGIGFKDVEFRGRFDPFRTTTKESVARKFGVIGVNVYARKPN |
| Ga0209108_101643283 | 3300025165 | Soil | LTAAGFEQVAIPERFDCFRGTTKERTARKYGVMGVNVYAVKPE |
| Ga0209642_105919331 | 3300025167 | Soil | EAELVQLLNDLGFRDVRVVQRFDCFRATSKERTARNYGVRGVNVLARKPHSLTRSRY |
| Ga0209520_105427542 | 3300025319 | Soil | MEILSGIGFQDVELRARFDPFRATTKEPVARKFGVIGVNVFARKPN |
| Ga0209641_102009474 | 3300025322 | Soil | IGFKDVEFRGRFDPFRTTTKESVARKFGVIGVNVYARKPN |
| Ga0209640_102122132 | 3300025324 | Soil | MVGFEQVEIRERFDCFRGTTKERTARKYGVMGVNVYAAKPM |
| Ga0207671_101898622 | 3300025914 | Corn Rhizosphere | VLTQAGFSNVRALDHFDCFRQTSKERTARKYGVMGVNVYARKA |
| Ga0207646_113689901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGRVGLSDVRVTDRYDCFRGTSKEGVARKYGVIGVNVYARKPELP |
| Ga0207650_101599692 | 3300025925 | Switchgrass Rhizosphere | VLLGHLGFDEVDVKERFDCFRGTSKEGVARKYGVVGVNVYARKPLSTVR |
| Ga0207708_101290063 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VALLEQIGFSDVVIRQRFDCFRGTSKEGVATKYGVVGVNLYAHKANRL |
| Ga0209470_13386122 | 3300026324 | Soil | PEAELVGLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR |
| Ga0209157_13190882 | 3300026537 | Soil | VGLLTQLGFQGVVAKERFDCFRGTSKEGVARKYGVVGVNVHACKPVG |
| Ga0209376_11723704 | 3300026540 | Soil | VLSQIGFTDVVVRDRFDCFRGTSKEGVAKKYGVVGVNVYASKGRDGAPKN |
| Ga0209999_10636931 | 3300027543 | Arabidopsis Thaliana Rhizosphere | VALLEQIGFSGVVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRL |
| Ga0256865_12252322 | 3300027657 | Soil | IAGALPEAELLALLGQIGFSDVVVKDRYACFRGTSKEGVAAKYGVVGVNVYARRPN |
| Ga0209726_100110867 | 3300027815 | Groundwater | MEILRGIGFQDVELRRRFDPFRATTKEAVARKFGVVGVNVYARKPN |
| Ga0209726_100996791 | 3300027815 | Groundwater | MTTILSQIGFRDVEVRERFDPFRSTSKEQVARKFGVMGVNVYARKPEVNL |
| Ga0209706_102389011 | 3300027818 | Freshwater Sediment | VAELVEALGSAGLSDVRVDRSFDCFRGTSKENVASKYGVRGVNVYGRKRA |
| Ga0209580_1000020111 | 3300027842 | Surface Soil | VAELLNVLSAVGFGQVEVRERFDCFRGTTKERTARKYGVMGVNVHARKPA |
| Ga0209382_101835254 | 3300027909 | Populus Rhizosphere | VALLEQIGFSDIVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRP |
| Ga0247825_104507652 | 3300028812 | Soil | VTLLGRLGFEEVVVKERFDCFRGTSKERVAAKYGVVGVNVYARKPR |
| Ga0307468_1017021271 | 3300031740 | Hardwood Forest Soil | RVGFSDVRVTDRYDCFRGTSKEGVARKFGVIGVNVYARKP |
| Ga0318521_107588901 | 3300031770 | Soil | HLGFEDVVIKERFDCFRGTSKERTALKYGVIGVNVHARRPR |
| Ga0318576_103457802 | 3300031796 | Soil | ELVALLGHLGFDDVVVKERFDCFRATSKERVAMKYRVVGVNVYARKLR |
| Ga0307473_112926702 | 3300031820 | Hardwood Forest Soil | VLTRVGFSGVRVTDRYDCFRGTSKENVARTFGVIGVNVHARKPSRR |
| Ga0307412_104374931 | 3300031911 | Rhizosphere | AELVALLGHLGFNDVVVKERFDCFRGTAKEAVARKYRVVGVNVSARKPR |
| Ga0306926_102669274 | 3300031954 | Soil | AELVALLGHLGFADVIVKERFDCFRGTSKERVAMKYGVVGVNVYARKPR |
| Ga0306926_117953222 | 3300031954 | Soil | LLGHLGFEDVVIKERFDCFRGTSKERTALKYGVIGVNVHARRPR |
| Ga0326597_101318506 | 3300031965 | Soil | MEILRGIGFQDVELRRRFDPFRATTKEAVARKFGVIGVNVYARKPN |
| Ga0326597_101916133 | 3300031965 | Soil | VLTAVGFGQVEIRGRFDCFRGTTKERTARKYGVIGVNVYARKPVGQS |
| Ga0326597_106819042 | 3300031965 | Soil | MVSGLTEAGFAGVRVVERFDCYRGTPKEKVARQYGVHGVNVYARKP |
| Ga0306922_117502061 | 3300032001 | Soil | VELLGHIGLEGVAVQERFDCFRGTSKERVAMKYGVVGVNVYARKPR |
| Ga0310906_105606221 | 3300032013 | Soil | VALLGHLGFDDVVVKERFDCFRGTSKERVAMKYGVVGVNVYARKPLSTLR |
| Ga0318519_106520383 | 3300033290 | Soil | FDDVVVKERFDCFRATSKERVAMKYRVVGVNVYARKLR |
| ⦗Top⦘ |