


| Basic Information | |
|---|---|
| Family ID | F066099 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 54.84 % |
| % of genes near scaffold ends (potentially truncated) | 41.73 % |
| % of genes from short scaffolds (< 2000 bps) | 80.31 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.764 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.748 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.559 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.819 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF02627 | CMD | 33.86 |
| PF01557 | FAA_hydrolase | 14.17 |
| PF07883 | Cupin_2 | 2.36 |
| PF00072 | Response_reg | 1.57 |
| PF13343 | SBP_bac_6 | 1.57 |
| PF09298 | FAA_hydrolase_N | 1.57 |
| PF03401 | TctC | 0.79 |
| PF13356 | Arm-DNA-bind_3 | 0.79 |
| PF02615 | Ldh_2 | 0.79 |
| PF12697 | Abhydrolase_6 | 0.79 |
| PF04392 | ABC_sub_bind | 0.79 |
| PF03480 | DctP | 0.79 |
| PF00892 | EamA | 0.79 |
| PF00905 | Transpeptidase | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 33.86 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 33.86 |
| COG0179 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.57 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.79 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.79 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.76 % |
| Unclassified | root | N/A | 10.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16478999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0550985 | Not Available | 813 | Open in IMG/M |
| 3300000559|F14TC_101754500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1158 | Open in IMG/M |
| 3300000559|F14TC_105555940 | Not Available | 522 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1064829 | Not Available | 646 | Open in IMG/M |
| 3300000858|JGI10213J12805_11139778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300001305|C688J14111_10148011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300002906|JGI25614J43888_10005705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4003 | Open in IMG/M |
| 3300002917|JGI25616J43925_10032225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2316 | Open in IMG/M |
| 3300004267|Ga0066396_10094667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300004479|Ga0062595_101740424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300005167|Ga0066672_10233178 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300005184|Ga0066671_10391183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300005332|Ga0066388_101617354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300005332|Ga0066388_108061395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300005332|Ga0066388_108637731 | Not Available | 506 | Open in IMG/M |
| 3300005332|Ga0066388_108760164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300005363|Ga0008090_10057415 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005363|Ga0008090_10250539 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005434|Ga0070709_10068717 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
| 3300005435|Ga0070714_101354055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300005436|Ga0070713_100127258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2242 | Open in IMG/M |
| 3300005445|Ga0070708_101149592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300005518|Ga0070699_100019097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5896 | Open in IMG/M |
| 3300005553|Ga0066695_10635041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300005562|Ga0058697_10384308 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005713|Ga0066905_100345837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300005713|Ga0066905_100347054 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005713|Ga0066905_102229015 | Not Available | 511 | Open in IMG/M |
| 3300005764|Ga0066903_100457880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2136 | Open in IMG/M |
| 3300005764|Ga0066903_101451771 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300005764|Ga0066903_104658191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 730 | Open in IMG/M |
| 3300005764|Ga0066903_107483204 | Not Available | 563 | Open in IMG/M |
| 3300005843|Ga0068860_100109313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2642 | Open in IMG/M |
| 3300005937|Ga0081455_10004584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15440 | Open in IMG/M |
| 3300005981|Ga0081538_10101928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300006038|Ga0075365_10081928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2187 | Open in IMG/M |
| 3300006038|Ga0075365_10850864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300006172|Ga0075018_10563407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300006175|Ga0070712_100396130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
| 3300006178|Ga0075367_10800111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300006844|Ga0075428_100029454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6074 | Open in IMG/M |
| 3300006845|Ga0075421_100223623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2318 | Open in IMG/M |
| 3300006854|Ga0075425_100181162 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
| 3300006871|Ga0075434_100373072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1448 | Open in IMG/M |
| 3300009089|Ga0099828_11167956 | Not Available | 683 | Open in IMG/M |
| 3300009090|Ga0099827_10025348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4199 | Open in IMG/M |
| 3300009147|Ga0114129_11218950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300010046|Ga0126384_10122994 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300010048|Ga0126373_12318461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300010154|Ga0127503_10255268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300010154|Ga0127503_10438122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300010154|Ga0127503_10942178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300010303|Ga0134082_10535653 | Not Available | 514 | Open in IMG/M |
| 3300010358|Ga0126370_10502499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300010358|Ga0126370_10716658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300010358|Ga0126370_10840962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300010361|Ga0126378_11640983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300010362|Ga0126377_12261576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300010366|Ga0126379_10209788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1882 | Open in IMG/M |
| 3300010366|Ga0126379_11233322 | Not Available | 854 | Open in IMG/M |
| 3300010376|Ga0126381_100839068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1321 | Open in IMG/M |
| 3300011119|Ga0105246_12398319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300011271|Ga0137393_11511888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300012198|Ga0137364_10353397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300012200|Ga0137382_10453098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300012204|Ga0137374_10034675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5446 | Open in IMG/M |
| 3300012208|Ga0137376_11655098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300012923|Ga0137359_10145173 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300012951|Ga0164300_10200918 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300012986|Ga0164304_10325204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300014166|Ga0134079_10490464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300016357|Ga0182032_10400930 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300016387|Ga0182040_11139483 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018000|Ga0184604_10235600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300018468|Ga0066662_10567438 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300018482|Ga0066669_10607004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300020170|Ga0179594_10086761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300020580|Ga0210403_10608691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300020581|Ga0210399_11047464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300021168|Ga0210406_10129048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2133 | Open in IMG/M |
| 3300021560|Ga0126371_10345564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1622 | Open in IMG/M |
| 3300021560|Ga0126371_11232562 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300021953|Ga0213880_10097804 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300025910|Ga0207684_11552383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 537 | Open in IMG/M |
| 3300025915|Ga0207693_10489479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300025916|Ga0207663_10104575 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300025916|Ga0207663_10629588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300025938|Ga0207704_10439280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1039 | Open in IMG/M |
| 3300025961|Ga0207712_10359813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1212 | Open in IMG/M |
| 3300025981|Ga0207640_10082939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2197 | Open in IMG/M |
| 3300026078|Ga0207702_12449202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300026306|Ga0209468_1139127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300026310|Ga0209239_1002603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10716 | Open in IMG/M |
| 3300026494|Ga0257159_1063457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300026514|Ga0257168_1088078 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027873|Ga0209814_10094582 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300027907|Ga0207428_10725434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300028784|Ga0307282_10285295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300028885|Ga0307304_10589242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300030903|Ga0308206_1193757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300030905|Ga0308200_1017873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1103 | Open in IMG/M |
| 3300031091|Ga0308201_10188520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300031152|Ga0307501_10143535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300031184|Ga0307499_10138345 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300031543|Ga0318516_10000509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12444 | Open in IMG/M |
| 3300031544|Ga0318534_10405304 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031545|Ga0318541_10036350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2473 | Open in IMG/M |
| 3300031561|Ga0318528_10141118 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300031564|Ga0318573_10267600 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031640|Ga0318555_10125522 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300031680|Ga0318574_10728472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300031716|Ga0310813_10966950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300031740|Ga0307468_101241658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300031764|Ga0318535_10013426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2995 | Open in IMG/M |
| 3300031792|Ga0318529_10367058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300031794|Ga0318503_10037809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
| 3300031795|Ga0318557_10102383 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300031890|Ga0306925_10135409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2645 | Open in IMG/M |
| 3300031912|Ga0306921_11186277 | Not Available | 851 | Open in IMG/M |
| 3300031941|Ga0310912_11363389 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032009|Ga0318563_10359222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300032094|Ga0318540_10076670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
| 3300032180|Ga0307471_101154455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.36% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.57% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.57% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02266260 | 2088090014 | Soil | MGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR |
| ICChiseqgaiiDRAFT_05509852 | 3300000033 | Soil | MGVDDVDFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| F14TC_1017545001 | 3300000559 | Soil | MGVDNVLFLHRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| F14TC_1055559401 | 3300000559 | Soil | MGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRI |
| AF_2010_repII_A100DRAFT_10648292 | 3300000655 | Forest Soil | MGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| JGI10213J12805_111397782 | 3300000858 | Soil | MALSVGDGIGAEDVIFLQRLLLHYGVYRRYPLRPWPALKNAWRIVLR* |
| C688J14111_101480112 | 3300001305 | Soil | AEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR* |
| JGI25614J43888_100057052 | 3300002906 | Grasslands Soil | MGVEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| JGI25616J43925_100322252 | 3300002917 | Grasslands Soil | MGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0066396_100946672 | 3300004267 | Tropical Forest Soil | MGVNNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0062595_1017404242 | 3300004479 | Soil | PIMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR* |
| Ga0066672_102331782 | 3300005167 | Soil | MGVDNVFFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0066671_103911831 | 3300005184 | Soil | MGVDDVVYLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0066388_1016173542 | 3300005332 | Tropical Forest Soil | LDRAEWIGDNHVLTLRRLLLHYGVYRRYPLRPWPAFKNACRIVFR* |
| Ga0066388_1080613952 | 3300005332 | Tropical Forest Soil | MGVDDVFFLQRLLLHYGIYRRYPLRRWPAFKNAWRVAFR* |
| Ga0066388_1086377311 | 3300005332 | Tropical Forest Soil | MGVDDVVFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0066388_1087601641 | 3300005332 | Tropical Forest Soil | LALVDTEMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0008090_100574151 | 3300005363 | Tropical Rainforest Soil | MGVDHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0008090_102505392 | 3300005363 | Tropical Rainforest Soil | LALVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0070709_100687174 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR* |
| Ga0070714_1013540551 | 3300005435 | Agricultural Soil | YHWSDTVQFLERLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0070713_1001272581 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVNDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR* |
| Ga0070708_1011495921 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVEHVLFLQRLLLHYGVYRRYPLRPWPAFKNAWRIAFR* |
| Ga0070699_1000190977 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0066695_106350412 | 3300005553 | Soil | VLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0058697_103843082 | 3300005562 | Agave | VQFLERLLLHYGIYRRYPLKPWPALKNAWRIAFR* |
| Ga0066905_1003458371 | 3300005713 | Tropical Forest Soil | MGVDDVLFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0066905_1003470542 | 3300005713 | Tropical Forest Soil | MIGWNVHAGTALSVGDWDRAEDVVFLQRLLLHYGVYRRYPLRPWPALKNAWRIVVR* |
| Ga0066905_1022290151 | 3300005713 | Tropical Forest Soil | VTFFERLLLHYRVYRGYPLAPWPAFKNACRIVFR* |
| Ga0066903_1004578804 | 3300005764 | Tropical Forest Soil | MGVDHVRFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0066903_1014517712 | 3300005764 | Tropical Forest Soil | METIVLILQRLLLHYGVYRRYPLRRWPAFKNACRIVFR* |
| Ga0066903_1046581912 | 3300005764 | Tropical Forest Soil | MVAFLRRFSLHYGIYRRYPLRPLKALKNAWRIARD* |
| Ga0066903_1074832041 | 3300005764 | Tropical Forest Soil | VDTFNVGVDHVLFLQRLLLHYGIYRRYPLKPWPAFKN |
| Ga0068860_1001093133 | 3300005843 | Switchgrass Rhizosphere | LGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR* |
| Ga0081455_100045848 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LLFLERLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0081538_101019283 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VLFLQRLLLHYGIYRRYPLKPWPAFKNAWRVAFR* |
| Ga0081540_11368822 | 3300005983 | Tabebuia Heterophylla Rhizosphere | SMVSTDGADSERIGTAAPVPALLDTRLDTKIWSRTLLFLERLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0075365_100819282 | 3300006038 | Populus Endosphere | LAFRLKKTLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR* |
| Ga0075365_108508642 | 3300006038 | Populus Endosphere | DEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR* |
| Ga0075018_105634072 | 3300006172 | Watersheds | MPRMGVDHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRLAFR* |
| Ga0070712_1003961303 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR* |
| Ga0075367_108001111 | 3300006178 | Populus Endosphere | PAGQFWRLGEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR* |
| Ga0075428_1000294546 | 3300006844 | Populus Rhizosphere | MGVDNVLFLERLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0075421_1002236233 | 3300006845 | Populus Rhizosphere | VTFIDRLLLHYKVYRGYPLAPWPAFKNACRIVFR* |
| Ga0075425_1001811624 | 3300006854 | Populus Rhizosphere | LVDTHNGVDDVVFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0075434_1003730723 | 3300006871 | Populus Rhizosphere | VDTHNGVDDVVFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0099828_111679561 | 3300009089 | Vadose Zone Soil | VAFLERLLLHYKVYRRYPLARWPAFKNACRIVFR* |
| Ga0099827_100253483 | 3300009090 | Vadose Zone Soil | LLFFERLLLHYGIYRRYPLKPWPAFKNAWRIVLR* |
| Ga0114129_112189501 | 3300009147 | Populus Rhizosphere | MGVDNVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0126374_114527562 | 3300009792 | Tropical Forest Soil | MIGTIAPVSALVDTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0126384_101229942 | 3300010046 | Tropical Forest Soil | VALVDTEWESTNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0126373_123184612 | 3300010048 | Tropical Forest Soil | LVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0127503_102552682 | 3300010154 | Soil | NVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0127503_104381222 | 3300010154 | Soil | DDVLFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0127503_109421782 | 3300010154 | Soil | EHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0134082_105356531 | 3300010303 | Grasslands Soil | MGVDDVVYLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0126370_105024993 | 3300010358 | Tropical Forest Soil | GTIAPVSALVDTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0126370_107166582 | 3300010358 | Tropical Forest Soil | VALVDTEMGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0126370_108409622 | 3300010358 | Tropical Forest Soil | MGVDDVLFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0126378_116409831 | 3300010361 | Tropical Forest Soil | DVLFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0126377_122615761 | 3300010362 | Tropical Forest Soil | MGVDDVFFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0126379_102097882 | 3300010366 | Tropical Forest Soil | MIGTIAPVAALVDTPMGVDHVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0126379_112333221 | 3300010366 | Tropical Forest Soil | MGVDDVVFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR* |
| Ga0126381_1008390682 | 3300010376 | Tropical Forest Soil | MVAFLRRFSLHYGIYRRYPLRPFKALKNAWRIARD* |
| Ga0105246_123983192 | 3300011119 | Miscanthus Rhizosphere | EETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR* |
| Ga0137393_115118881 | 3300011271 | Vadose Zone Soil | NVLFLERLLLHYAIYRRYPLKPWPALKNAWRIVLR* |
| Ga0137364_103533971 | 3300012198 | Vadose Zone Soil | VLFLERLLLHYGIYRRYPLKPWPAFKNAWRIAFR* |
| Ga0137382_104530982 | 3300012200 | Vadose Zone Soil | MGVDNVLFLPPLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0137374_100346752 | 3300012204 | Vadose Zone Soil | VTFLERLLLHYRVYRRYPLAPWPAFKNACRIVLR* |
| Ga0137376_116550981 | 3300012208 | Vadose Zone Soil | IPTMGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0137359_101451732 | 3300012923 | Vadose Zone Soil | MGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR |
| Ga0164300_102009182 | 3300012951 | Soil | MGVDDVDCLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR* |
| Ga0164304_103252042 | 3300012986 | Soil | MGVDDVDFLQRLLLHYGIYRRYPLRRRPALKNAWRIAFR* |
| Ga0134079_104904641 | 3300014166 | Grasslands Soil | TMGVDNVFFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR* |
| Ga0182032_104009301 | 3300016357 | Soil | MGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0182040_111394832 | 3300016387 | Soil | MGVDHVFFLQRLVLHYGIYRRYPLKPWPAFKNAWRIAF |
| Ga0184604_102356001 | 3300018000 | Groundwater Sediment | LGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0066662_105674382 | 3300018468 | Grasslands Soil | MGVDNVLFLQRLLLHYGIYRRYPLSPWPAFKNAWRLAFS |
| Ga0066669_106070041 | 3300018482 | Grasslands Soil | PMGVDDVVYLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR |
| Ga0179594_100867612 | 3300020170 | Vadose Zone Soil | MGVEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR |
| Ga0210403_106086912 | 3300020580 | Soil | MGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRVAFR |
| Ga0210399_110474641 | 3300020581 | Soil | MGVDDVLFLQRLLLHYGIYRRYPLRRWPALKNAWRVAFR |
| Ga0210406_101290481 | 3300021168 | Soil | WIPTMGVDDVLFLQRLLLHYGIYRRYPLRRWPALKNAWRVAFR |
| Ga0126371_103455642 | 3300021560 | Tropical Forest Soil | MIGTIAPVAALVDTPMGVDHVFFLQRFLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0126371_112325622 | 3300021560 | Tropical Forest Soil | LALVDTEMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0213880_100978042 | 3300021953 | Exposed Rock | LGVDDVVFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR |
| Ga0207684_115523831 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | WSRDVPFLHRLLLHYGIYRRYPLRPWPALKNAWRVAWR |
| Ga0207693_104894791 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PIMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR |
| Ga0207663_101045751 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRI |
| Ga0207663_106295881 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR |
| Ga0207704_104392801 | 3300025938 | Miscanthus Rhizosphere | TDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0207712_103598133 | 3300025961 | Switchgrass Rhizosphere | DTDVQFLDRLMLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0207640_100829393 | 3300025981 | Corn Rhizosphere | EETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0207702_124492022 | 3300026078 | Corn Rhizosphere | DVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0209468_11391272 | 3300026306 | Soil | MGVDDVVYLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR |
| Ga0209239_10026032 | 3300026310 | Grasslands Soil | MGVDNVFFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR |
| Ga0257159_10634572 | 3300026494 | Soil | GVDHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRLAFR |
| Ga0257168_10880781 | 3300026514 | Soil | MGVEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRI |
| Ga0209814_100945822 | 3300027873 | Populus Rhizosphere | MGVDNVLFLERLLLHYGIYRRYPLRPWPAFKNAWRIAFR |
| Ga0207428_107254342 | 3300027907 | Populus Rhizosphere | DTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0307282_102852951 | 3300028784 | Soil | TLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0307304_105892421 | 3300028885 | Soil | PIMGVDDVVFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR |
| Ga0308206_11937572 | 3300030903 | Soil | PGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0308200_10178731 | 3300030905 | Soil | DVQFFDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0308201_101885202 | 3300031091 | Soil | TDVHFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR |
| Ga0307501_101435352 | 3300031152 | Soil | DVQFLDRLLLHYGIYRRYPLRPRPAFKNAWRISFR |
| Ga0307499_101383452 | 3300031184 | Soil | VWALSIGDEIGADDVIFLQRLLLHYGVYRRYPLRPWPALKNAWRIVLR |
| Ga0318516_100005096 | 3300031543 | Soil | MGGDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318534_104053041 | 3300031544 | Soil | LVGTPIRVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318541_100363502 | 3300031545 | Soil | MGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318528_101411182 | 3300031561 | Soil | VALVDTEMGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318573_102676001 | 3300031564 | Soil | MGGDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFS |
| Ga0318555_101255222 | 3300031640 | Soil | LALVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318574_107284721 | 3300031680 | Soil | VGTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0310813_109669502 | 3300031716 | Soil | LVDTHNGVDDVVFLQRLLLHYGIYRRWPAFKNAWRIAFR |
| Ga0307468_1012416582 | 3300031740 | Hardwood Forest Soil | RSRNVIFVQRLLLHYGVYRRYPLRPWPALKNAWRIVVR |
| Ga0318535_100134261 | 3300031764 | Soil | MGVNNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR |
| Ga0318521_101625694 | 3300031770 | Soil | HRAAVALVDTEMGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318529_103670581 | 3300031792 | Soil | PMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318503_100378091 | 3300031794 | Soil | GVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318557_101023833 | 3300031795 | Soil | ALVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0306925_101354092 | 3300031890 | Soil | MGVDNVLFLQRLLLYYGIYRRYPLRPWPAFKNAWRIAFR |
| Ga0306921_111862771 | 3300031912 | Soil | MVAFLRRFSLHYGIYRRYPLRPFKALKNAWRIARD |
| Ga0310912_113633892 | 3300031941 | Soil | MGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRI |
| Ga0318563_103592222 | 3300032009 | Soil | NVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0318540_100766703 | 3300032094 | Soil | TPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR |
| Ga0307471_1011544552 | 3300032180 | Hardwood Forest Soil | LTIGADDVQFLERLLLHYGIYRRYPLKPWPALKNAWRVATR |
| ⦗Top⦘ |