


| Basic Information | |
|---|---|
| Family ID | F066070 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 49 residues |
| Representative Sequence | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.34 % |
| % of genes near scaffold ends (potentially truncated) | 13.39 % |
| % of genes from short scaffolds (< 2000 bps) | 75.59 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (19.685 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.433 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (39.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.35% β-sheet: 0.00% Coil/Unstructured: 50.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF03061 | 4HBT | 49.61 |
| PF14317 | YcxB | 9.45 |
| PF09670 | Cas_Cas02710 | 3.94 |
| PF05635 | 23S_rRNA_IVP | 1.57 |
| PF07110 | EthD | 1.57 |
| PF01546 | Peptidase_M20 | 0.79 |
| PF08238 | Sel1 | 0.79 |
| PF04365 | BrnT_toxin | 0.79 |
| PF00202 | Aminotran_3 | 0.79 |
| PF04191 | PEMT | 0.79 |
| PF00565 | SNase | 0.79 |
| PF00903 | Glyoxalase | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002121|C687J26615_10027550 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1405 | Open in IMG/M |
| 3300004062|Ga0055500_10076859 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005172|Ga0066683_10554048 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 701 | Open in IMG/M |
| 3300005178|Ga0066688_10360960 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 941 | Open in IMG/M |
| 3300005180|Ga0066685_10043518 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300005289|Ga0065704_10482140 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 681 | Open in IMG/M |
| 3300005294|Ga0065705_10778967 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005365|Ga0070688_100104098 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1876 | Open in IMG/M |
| 3300005440|Ga0070705_100065916 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300005444|Ga0070694_100238170 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1372 | Open in IMG/M |
| 3300005445|Ga0070708_100187854 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300005468|Ga0070707_100099402 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300005518|Ga0070699_101539470 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 609 | Open in IMG/M |
| 3300005526|Ga0073909_10367182 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005536|Ga0070697_100023353 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 4917 | Open in IMG/M |
| 3300005540|Ga0066697_10693684 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005546|Ga0070696_101741851 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 537 | Open in IMG/M |
| 3300005549|Ga0070704_100712471 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 891 | Open in IMG/M |
| 3300005557|Ga0066704_10113586 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300005568|Ga0066703_10029934 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| 3300005576|Ga0066708_10280461 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005598|Ga0066706_10626429 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 854 | Open in IMG/M |
| 3300006032|Ga0066696_10215164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1231 | Open in IMG/M |
| 3300006173|Ga0070716_100406399 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006237|Ga0097621_102277126 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006794|Ga0066658_10398549 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 746 | Open in IMG/M |
| 3300006796|Ga0066665_11357088 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 548 | Open in IMG/M |
| 3300006797|Ga0066659_10089532 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300006845|Ga0075421_102679480 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 516 | Open in IMG/M |
| 3300007255|Ga0099791_10297978 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300007258|Ga0099793_10024168 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2525 | Open in IMG/M |
| 3300009012|Ga0066710_100307650 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300009012|Ga0066710_100560917 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300009038|Ga0099829_10010423 | All Organisms → cellular organisms → Bacteria | 6010 | Open in IMG/M |
| 3300009081|Ga0105098_10614111 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 568 | Open in IMG/M |
| 3300009157|Ga0105092_10367397 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 816 | Open in IMG/M |
| 3300009597|Ga0105259_1007407 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2091 | Open in IMG/M |
| 3300009805|Ga0105079_1030538 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 566 | Open in IMG/M |
| 3300010304|Ga0134088_10332499 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 736 | Open in IMG/M |
| 3300010391|Ga0136847_12107710 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 520 | Open in IMG/M |
| 3300011107|Ga0151490_1118695 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300011395|Ga0137315_1025367 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300011397|Ga0137444_1007238 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1395 | Open in IMG/M |
| 3300011398|Ga0137348_1026627 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300011420|Ga0137314_1099563 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300011427|Ga0137448_1003640 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300011429|Ga0137455_1141783 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300011437|Ga0137429_1094031 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300011444|Ga0137463_1116700 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300012034|Ga0137453_1008012 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1453 | Open in IMG/M |
| 3300012035|Ga0137445_1113837 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 550 | Open in IMG/M |
| 3300012039|Ga0137421_1018477 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1678 | Open in IMG/M |
| 3300012096|Ga0137389_10335721 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1284 | Open in IMG/M |
| 3300012159|Ga0137344_1051972 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012160|Ga0137349_1030456 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012164|Ga0137352_1022475 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012174|Ga0137338_1028588 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1124 | Open in IMG/M |
| 3300012202|Ga0137363_10154711 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1804 | Open in IMG/M |
| 3300012203|Ga0137399_10657851 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012225|Ga0137434_1005265 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300012226|Ga0137447_1008583 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1339 | Open in IMG/M |
| 3300012226|Ga0137447_1031166 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 883 | Open in IMG/M |
| 3300012226|Ga0137447_1043065 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 792 | Open in IMG/M |
| 3300012685|Ga0137397_10945833 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012918|Ga0137396_10561374 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012922|Ga0137394_10719836 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012923|Ga0137359_10422423 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300012944|Ga0137410_10484621 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1009 | Open in IMG/M |
| 3300014863|Ga0180060_1059380 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 536 | Open in IMG/M |
| 3300014873|Ga0180066_1020948 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1200 | Open in IMG/M |
| 3300014873|Ga0180066_1094529 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300014873|Ga0180066_1096357 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 609 | Open in IMG/M |
| 3300014878|Ga0180065_1020840 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1331 | Open in IMG/M |
| 3300015170|Ga0120098_1009424 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300015358|Ga0134089_10242608 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 735 | Open in IMG/M |
| 3300017997|Ga0184610_1050460 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1228 | Open in IMG/M |
| 3300018028|Ga0184608_10381514 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 615 | Open in IMG/M |
| 3300018031|Ga0184634_10057944 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300018063|Ga0184637_10788564 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 508 | Open in IMG/M |
| 3300018070|Ga0184631_10047965 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300018071|Ga0184618_10001327 | All Organisms → cellular organisms → Bacteria | 6083 | Open in IMG/M |
| 3300018071|Ga0184618_10003404 | All Organisms → cellular organisms → Bacteria | 4207 | Open in IMG/M |
| 3300018077|Ga0184633_10029218 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2760 | Open in IMG/M |
| 3300018084|Ga0184629_10008838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3862 | Open in IMG/M |
| 3300018084|Ga0184629_10064797 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1709 | Open in IMG/M |
| 3300018084|Ga0184629_10641114 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 539 | Open in IMG/M |
| 3300019249|Ga0184648_1365568 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 532 | Open in IMG/M |
| 3300019360|Ga0187894_10006527 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 11415 | Open in IMG/M |
| 3300019866|Ga0193756_1025956 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300019882|Ga0193713_1004329 | All Organisms → cellular organisms → Bacteria | 4527 | Open in IMG/M |
| 3300019997|Ga0193711_1047051 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 519 | Open in IMG/M |
| 3300020059|Ga0193745_1002247 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3986 | Open in IMG/M |
| 3300020063|Ga0180118_1166737 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 627 | Open in IMG/M |
| 3300020186|Ga0163153_10000569 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 64696 | Open in IMG/M |
| 3300021051|Ga0206224_1001964 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2042 | Open in IMG/M |
| 3300021051|Ga0206224_1003798 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1544 | Open in IMG/M |
| 3300021080|Ga0210382_10362138 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 641 | Open in IMG/M |
| 3300021081|Ga0210379_10021232 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2460 | Open in IMG/M |
| 3300021081|Ga0210379_10120045 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1103 | Open in IMG/M |
| 3300021432|Ga0210384_11759373 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300025934|Ga0207686_10880680 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300026301|Ga0209238_1016908 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2814 | Open in IMG/M |
| 3300026301|Ga0209238_1157687 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300026507|Ga0257165_1040724 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300026550|Ga0209474_10312360 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 914 | Open in IMG/M |
| 3300027722|Ga0209819_10104606 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 988 | Open in IMG/M |
| 3300027846|Ga0209180_10001771 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 10791 | Open in IMG/M |
| 3300027909|Ga0209382_12097412 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 539 | Open in IMG/M |
| 3300028792|Ga0307504_10013025 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1925 | Open in IMG/M |
| 3300029636|Ga0222749_10083862 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1470 | Open in IMG/M |
| 3300031057|Ga0170834_103209787 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1034 | Open in IMG/M |
| 3300031576|Ga0247727_10012547 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 14519 | Open in IMG/M |
| 3300031576|Ga0247727_10414043 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1082 | Open in IMG/M |
| 3300031720|Ga0307469_10027246 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3243 | Open in IMG/M |
| 3300031820|Ga0307473_11297790 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 545 | Open in IMG/M |
| 3300031834|Ga0315290_10081344 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2698 | Open in IMG/M |
| 3300031949|Ga0214473_10086445 | All Organisms → cellular organisms → Bacteria | 3663 | Open in IMG/M |
| 3300032163|Ga0315281_10423239 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1430 | Open in IMG/M |
| 3300032174|Ga0307470_10831815 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 718 | Open in IMG/M |
| 3300032180|Ga0307471_100392060 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1513 | Open in IMG/M |
| 3300032180|Ga0307471_101939748 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 737 | Open in IMG/M |
| 3300032342|Ga0315286_10005737 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 12013 | Open in IMG/M |
| 3300033233|Ga0334722_10001229 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 33075 | Open in IMG/M |
| 3300033433|Ga0326726_10048226 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3722 | Open in IMG/M |
| 3300034090|Ga0326723_0047178 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1816 | Open in IMG/M |
| 3300034113|Ga0364937_001147 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2939 | Open in IMG/M |
| 3300034176|Ga0364931_0046610 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 19.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.15% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.57% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.57% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.57% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.57% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.79% |
| Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.79% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26615_100275503 | 3300002121 | Soil | METEWVGFGMASLGSWLMIAGWTIGLFVLGWWFFMPNPMDRDRKNKKKP* |
| Ga0055500_100768592 | 3300004062 | Natural And Restored Wetlands | METEWVGFGMSLGSWLIMAGMVIGVFVLGWWFFMPNPMAQDRKDRNKKP* |
| Ga0066683_105540482 | 3300005172 | Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKRQ* |
| Ga0066688_103609602 | 3300005178 | Soil | MEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNNKP* |
| Ga0066685_100435183 | 3300005180 | Soil | MDWVGFGLPPLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKDKDKKKP* |
| Ga0065704_104821402 | 3300005289 | Switchgrass Rhizosphere | MDWVGFGLPPLGSLIIIAGMTIGVFVLGWWFYMPNPMDKDKKNRKKP* |
| Ga0065705_107789672 | 3300005294 | Switchgrass Rhizosphere | MDWVGFGLPPLGSLIIIAGMTIGVFVLGWWFYMPNPMAKDKKNRKKP* |
| Ga0070688_1001040982 | 3300005365 | Switchgrass Rhizosphere | METEWVGFGMAGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS* |
| Ga0070705_1000659162 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKKKKP* |
| Ga0070694_1002381701 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | METETGWLSFGMAGLGSWIIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP* |
| Ga0070708_1001878544 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSVIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKQQ* |
| Ga0070707_1000994025 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSVIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKQQQ* |
| Ga0070699_1015394701 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSVIIIVVMTIGVFVLGWWFYMPNPMAKDKSKKKKQQ* |
| Ga0073909_103671821 | 3300005526 | Surface Soil | MDWVGFGLPPLGSVIIIVVMTIGVFVLGWWFYLPNPMAKDKGKKKKQQ* |
| Ga0070697_1000233537 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKSKKKKQQQ* |
| Ga0066697_106936842 | 3300005540 | Soil | MDWVGFGLPPLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKGKKKKRQ* |
| Ga0070696_1017418511 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSLIIIAGMTIGVFVLGWWFYMPNPMGKDKDKKKRP* |
| Ga0070704_1007124711 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | METETGWLSFGMPGLGSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP* |
| Ga0066704_101135863 | 3300005557 | Soil | MEWVGFGMAGLGSWLIIAGMTIGVFVLGWWFYMPNPMAKDRKKEKKENKKQP* |
| Ga0066703_100299344 | 3300005568 | Soil | MDWVGFGLPPFGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKKKKP* |
| Ga0066708_102804613 | 3300005576 | Soil | MDWVGFGLPPFGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDK |
| Ga0066706_106264292 | 3300005598 | Soil | MAGLGSWLIIAGMTIGVFVLGWWFYLPNPMAKDGKKEKKENKKQP* |
| Ga0066696_102151641 | 3300006032 | Soil | PLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKDKDKKKP* |
| Ga0070716_1004063991 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDGKKEKKENKKQP* |
| Ga0097621_1022771261 | 3300006237 | Miscanthus Rhizosphere | METEWVGFGMAGLGSWLIMAGWTIGLALLAWWFYMPNPMAKD |
| Ga0066658_103985492 | 3300006794 | Soil | METETGWLSFGMAGLGSWLLIAAWTIGIALLAWWFYMPNPMAKDRKDRNKEP* |
| Ga0066665_113570882 | 3300006796 | Soil | MEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKKEKKENKKQP* |
| Ga0066659_100895323 | 3300006797 | Soil | MDWVGFGLPPFGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKDKKKKKP* |
| Ga0075421_1026794802 | 3300006845 | Populus Rhizosphere | MDWVGFGLPPLGSLIIIAAMTIGVFVLGWWFYMPNPMDKDKKNRKKP* |
| Ga0099791_102979782 | 3300007255 | Vadose Zone Soil | MDWVGFGLPPLGSVIIIVVMTIGVFVLGWWFYLPNPMAKDGKKEKKENKKQP* |
| Ga0099793_100241684 | 3300007258 | Vadose Zone Soil | MEWVGFGMAGLGSWLIIAGMTIGVFVLGWWFYLPNPMAKDGKKEKKENKKQP* |
| Ga0066710_1003076502 | 3300009012 | Grasslands Soil | MEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNNKP |
| Ga0066710_1005609173 | 3300009012 | Grasslands Soil | MDWVGFGLPPFGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKDKDKKKP |
| Ga0099829_100104235 | 3300009038 | Vadose Zone Soil | MEWVGFGMAGLGSWLIIAGMTIGVFVLGWWFYMPNPMAKDGKKEKKENKKQP* |
| Ga0105098_106141112 | 3300009081 | Freshwater Sediment | METGWVSYGLPPLGSLLMVAGWTIGIIVLGWWFFMPNPMAKDRKNRKKP* |
| Ga0105092_103673972 | 3300009157 | Freshwater Sediment | METEWVGYGMSLGSWLIMAGMAIGVFLLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0105259_10074074 | 3300009597 | Soil | METEWVGFGMSLGSWLIMAGMAIGVVVLGWWFFLPNPMDKDRKDRNKKP* |
| Ga0105079_10305382 | 3300009805 | Groundwater Sand | METEWVSFGMAGLGSWLIMAGWTIGLAILAWWFYMPNPMAKDGKKDKKKP* |
| Ga0134088_103324991 | 3300010304 | Grasslands Soil | GLGSWLIIAGMTIGVFVLGWWFYMPNQMAKDGKKEKKENKKQP* |
| Ga0136847_121077101 | 3300010391 | Freshwater Sediment | METEWVGYGLAGLGSWLIIAAWTIGIAVLGWWFYMPNPMAKDRKNKKKP* |
| Ga0151490_11186951 | 3300011107 | Soil | MEMEWVGYGMSLGSWLIMAGMAIGVVILGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137315_10253672 | 3300011395 | Soil | METEWVGYGMSLGSWLIMAGMAIGVVVLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137444_10072382 | 3300011397 | Soil | METGWVSFGMPSLGSWLMIAGWTIGIAVLGWWFYMPNPMAKDRKDKKKP* |
| Ga0137348_10266273 | 3300011398 | Soil | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137314_10995632 | 3300011420 | Soil | METGWVSFGMSLGSWLIMAGMAIGVVVLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137448_10036405 | 3300011427 | Soil | METEWVGFGIAGLGSWLMIAGWTIGLAILAWWFYMPNPMAK |
| Ga0137455_11417832 | 3300011429 | Soil | METEWVGFGIAGLGSWLMIAGWTIGLAILAWWFYMPNPMAKDRKDKKKP* |
| Ga0137429_10940313 | 3300011437 | Soil | METGWVSFGMPSLGSWLMIAGWTIGIAVLGWWFYMPNPMDRDRKNKKKP* |
| Ga0137463_11167002 | 3300011444 | Soil | MDWVGFGLPPLGSLIMIAGMTIGVFVLGWWFYMPNPMDKDKKNRKKP* |
| Ga0137453_10080123 | 3300012034 | Soil | METGWVSFGMPSLGSWLMIAGWTIGIAVLGWWFYMPNPMAKDRKNKKKP* |
| Ga0137445_11138371 | 3300012035 | Soil | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFFIPNPMAKDRKDRNKKP* |
| Ga0137421_10184773 | 3300012039 | Soil | METEWVGFGMSLGSWLIMAGMAIGVVVLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137389_103357211 | 3300012096 | Vadose Zone Soil | IMAGMAIGVCVLGWWFVVENPMAKDKKNKENKKRP* |
| Ga0137344_10519722 | 3300012159 | Soil | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFYMPNPMAKDRKNKKKP* |
| Ga0137349_10304562 | 3300012160 | Soil | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKS* |
| Ga0137352_10224751 | 3300012164 | Soil | METEWVGFGMSLGSWLIMAGMAIGIVVLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137338_10285882 | 3300012174 | Soil | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP* |
| Ga0137363_101547112 | 3300012202 | Vadose Zone Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKQQ* |
| Ga0137399_106578511 | 3300012203 | Vadose Zone Soil | VGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP* |
| Ga0137434_10052651 | 3300012225 | Soil | METEWVGYGMSLGSWLIMAGMAIGVFVLGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137447_10085831 | 3300012226 | Soil | METEWVGYGLAGLGSWLIIAAWTIGLIVLGWWFFMPNPMAKDKKDKKKP* |
| Ga0137447_10311662 | 3300012226 | Soil | METEWVGFGISLGSWLIMAGMAIGVFILGWWFFLPNPMAKDRKDRNKKP* |
| Ga0137447_10430651 | 3300012226 | Soil | METGWVSFGMPSLGSWLMIAGWTIGLFVLGWWFFMPNPMDRDRKNKKKP* |
| Ga0137397_109458331 | 3300012685 | Vadose Zone Soil | METEWVGYGISLGGWLIMAGMAIGVFVLGWWFYVPNPMAKDRKDRNKKP* |
| Ga0137396_105613742 | 3300012918 | Vadose Zone Soil | LETEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP* |
| Ga0137394_107198362 | 3300012922 | Vadose Zone Soil | METEWVGYGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP* |
| Ga0137359_104224232 | 3300012923 | Vadose Zone Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKQQQ* |
| Ga0137410_104846212 | 3300012944 | Vadose Zone Soil | MEWVGFGMAGLGSWVIIAGMTIGVFVLGWWFYLPNPMAKDGKKEKKENKKQP* |
| Ga0180060_10593801 | 3300014863 | Soil | CRIKIPSSIRSHEMETEWVGFGMAGLGSWLMIAGWTIGLAILAWWFYMPNPMAKDRKDKKKP* |
| Ga0180066_10209483 | 3300014873 | Soil | METEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRN |
| Ga0180066_10945291 | 3300014873 | Soil | METEWVGYGMSLGSWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP* |
| Ga0180066_10963572 | 3300014873 | Soil | METEWVGFGMASLGSWLMIAGWTIGISVLGWWFFMPNPMDRDRKNKKKP* |
| Ga0180065_10208402 | 3300014878 | Soil | METEWVGYGMSLGSWLIMAGMAIGVFVLGWWFFMPNPMAKDRKDRNKKP* |
| Ga0120098_10094241 | 3300015170 | Fossill | METEWVGFGMSLGSWLILAGMVIGVFVLGWWFFMPNPMAQDRKDRNKKP* |
| Ga0134089_102426081 | 3300015358 | Grasslands Soil | METEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP* |
| Ga0184610_10504602 | 3300017997 | Groundwater Sediment | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP |
| Ga0184608_103815141 | 3300018028 | Groundwater Sediment | MDWVGFGLPPLGSLIIIAGMTIGVFVLGWWFYMPNPMDKDKKNRKKP |
| Ga0184634_100579444 | 3300018031 | Groundwater Sediment | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFFMPNPMAKDRKDRNKKP |
| Ga0184637_107885641 | 3300018063 | Groundwater Sediment | RSHKMETEWVGFGMSLGSWLIMAGMAIGVFVLGWWFFIPNPMAKDRKDRNKKP |
| Ga0184631_100479654 | 3300018070 | Groundwater Sediment | METEWVGYGMSLGSWLMIAGWTIGIFVLGWWFFMPNPMAKDKKNKKKP |
| Ga0184618_1000132710 | 3300018071 | Groundwater Sediment | METEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP |
| Ga0184618_100034047 | 3300018071 | Groundwater Sediment | MDWVGFGLPPLGSLIIIAVMTIGVFVLGWWFYMPNAMAKDKDKKKKP |
| Ga0184633_100292182 | 3300018077 | Groundwater Sediment | METEWVGFGMASLGSWLIMAGMAIGVFILGWWFFMPNPMAKDRKDRNKKP |
| Ga0184629_100088382 | 3300018084 | Groundwater Sediment | MEWVGFGMASLGSWLMIAGWTIGIFVLGWWFFMPNPMAKDKKNKKKP |
| Ga0184629_100647971 | 3300018084 | Groundwater Sediment | MSLGSWLIMAGMAIGVVVLGWWFFLPNPMAKDRKDRNKKP |
| Ga0184629_106411142 | 3300018084 | Groundwater Sediment | METEWVGYGMSLGSWLIMAGMAIGVFVLGWWFFMPNPMAQDRKDRNKKP |
| Ga0184648_13655681 | 3300019249 | Groundwater Sediment | METEWVGYGMSLGSWLIMAGMAIGVVVLGWWFFLPNPMAKDRKDRNKKP |
| Ga0187894_100065277 | 3300019360 | Microbial Mat On Rocks | METGWVGFGMSLGSWLILAGMVICIFILGWWFFMPNPMAQDRKDRNKKL |
| Ga0193756_10259562 | 3300019866 | Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKQQ |
| Ga0193713_10043293 | 3300019882 | Soil | MDWVGFGLPPLGSVIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKQQ |
| Ga0193711_10470511 | 3300019997 | Soil | MDWVGFGLPPLGSLIIIAGMTIGVFVLGWWFYMPNPMDKDKKNRKKS |
| Ga0193745_10022476 | 3300020059 | Soil | METEWVSFGMAGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDSKRDKKKS |
| Ga0180118_11667371 | 3300020063 | Groundwater Sediment | METEWVGYGMSLGSWLIMAGMAIGIVVLGWWFFLPNPMAKDRKDRNKKP |
| Ga0163153_1000056930 | 3300020186 | Freshwater Microbial Mat | METEWVGFGMASLGSWLMIAGWTIGLFVLGWWFFMPNPMDRDRKNKKKP |
| Ga0206224_10019642 | 3300021051 | Deep Subsurface Sediment | METEWVGFGMAGLGSWLMIAGWTIGLAILAWWFYMPNPMAKDRKDKKKP |
| Ga0206224_10037983 | 3300021051 | Deep Subsurface Sediment | METEWVGFGMSLGSWLIMAGMAIGVFVLGWWFFMPNPMAEDRKDRNKKP |
| Ga0210382_103621381 | 3300021080 | Groundwater Sediment | MDWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNENP |
| Ga0210379_100212322 | 3300021081 | Groundwater Sediment | METGWVSFGMPSLGSWLMIAGWTIGIAVLGWWFYMPNPMAKDRKNKKKP |
| Ga0210379_101200451 | 3300021081 | Groundwater Sediment | SIRSHKMETEWVGYGMSLGSWLIMAGMAIGVFVLGWWFFMPNPMAQDRKDRNKKP |
| Ga0210384_117593732 | 3300021432 | Soil | MEWVGFGMAGLGSWLIIAGMTIGVFVLGWWFYLPNPMAKDGKKEKKENKKQP |
| Ga0207686_108806802 | 3300025934 | Miscanthus Rhizosphere | METEWVGFGMAGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS |
| Ga0209238_10169086 | 3300026301 | Grasslands Soil | MDWVGFGLPPLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKKKKP |
| Ga0209238_11576872 | 3300026301 | Grasslands Soil | MDWVGFGLPPLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKDKAKKKP |
| Ga0257165_10407241 | 3300026507 | Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPN |
| Ga0209474_103123602 | 3300026550 | Soil | PLGSLIIIAVMTIGVFVLGWWFYMPNPMAKDKDKDKDKKKP |
| Ga0209819_101046062 | 3300027722 | Freshwater Sediment | METEWVGYGMSLGSWLIMAGMAIGVFLLGWWFFLPNPMAKDRKDRNKKP |
| Ga0209180_100017712 | 3300027846 | Vadose Zone Soil | MEWVGFGMAGLGSWLIIAGMTIGVFVLGWWFYMPNPMAKDGKKEKKENKKQP |
| Ga0209382_120974122 | 3300027909 | Populus Rhizosphere | MDWVGFGLPPLGSLIIIAAMTIGVFVLGWWFYMPNPMDKDKKNRKKP |
| Ga0307504_100130253 | 3300028792 | Soil | MEAEWVGFGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP |
| Ga0222749_100838621 | 3300029636 | Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLAWWFYMPNPMAKDKGKKKKQQ |
| Ga0170834_1032097872 | 3300031057 | Forest Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKSKKKKQQ |
| Ga0247727_100125472 | 3300031576 | Biofilm | METGWVGFGLPSLGSWLIMAGMAIGVFVLGWWFYMPNPMDKDRKDKNKKP |
| Ga0247727_104140433 | 3300031576 | Biofilm | METEWVGYGISLGSWLIMAGMAIGVFILGWWFFLPNPMAKDRKDRNKKP |
| Ga0307469_100272466 | 3300031720 | Hardwood Forest Soil | METEWVGYGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKKP |
| Ga0307473_112977901 | 3300031820 | Hardwood Forest Soil | ETEWVGYGISLGGWLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNKNP |
| Ga0315290_100813442 | 3300031834 | Sediment | METEWVGFGMAGLGSWLMIAGWTIGLALLAWWFYMPNPMAKDRKDRNKKP |
| Ga0214473_100864455 | 3300031949 | Soil | METEWVGFGMASLGSWLMIAGWTIGISVLGWWFFMPNPMDRDKKDKKKP |
| Ga0315281_104232394 | 3300032163 | Sediment | MEWVGYGMASLGSWLMIAAWTIGIFVLGWWFFLPNPMAKDKKNKKKP |
| Ga0307470_108318152 | 3300032174 | Hardwood Forest Soil | MDWVGFGLPPLGSLIIIVVMTIGVFVLGWWFYMPNPMAKDKGKKKKQQQ |
| Ga0307471_1003920602 | 3300032180 | Hardwood Forest Soil | MEWVGFGMPGLGSWLIIAGMTIGVFVLGWWFYIPNPMDKDGKKEKKENKKQP |
| Ga0307471_1019397482 | 3300032180 | Hardwood Forest Soil | MDWVGFGLPPLGSLIIIAGMTIGVFVLGWWFYMPNPMGKDKDKKKGP |
| Ga0315286_1000573713 | 3300032342 | Sediment | MEWVGYGIASLGSWLIIAAWTIGIFVLGWWFFMPNPMAKDSRKNKKKP |
| Ga0334722_100012294 | 3300033233 | Sediment | MEWVGFGMASLGSWLMVAGWTIGIFVLGWWFFMPNPMAKDSRKDKKKQ |
| Ga0326726_100482267 | 3300033433 | Peat Soil | METETGWLSFGMAGLGSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP |
| Ga0326723_0047178_1082_1240 | 3300034090 | Peat Soil | METETGWLSFGMAGLGSWIIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP |
| Ga0364937_001147_2315_2464 | 3300034113 | Sediment | METEWVGFGMSLGSWLIMAGMAIGVVVLGWWFFLPNPMAKDRKDRNKKP |
| Ga0364931_0046610_605_754 | 3300034176 | Sediment | METEWVGYGMSLGSWLIMAGMAIGVFVLGWWFFLPNPMAKDRKDRNKKP |
| ⦗Top⦘ |