


| Basic Information | |
|---|---|
| Family ID | F066032 |
| Family Type | Metagenome |
| Number of Sequences | 127 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAEPRRKSGHFQIHVAYSFDRLLEPKLAQAYEILVPCRER |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.43 % |
| % of genes near scaffold ends (potentially truncated) | 92.13 % |
| % of genes from short scaffolds (< 2000 bps) | 88.98 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.276 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.370 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.331 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 10.24 |
| PF08388 | GIIM | 8.66 |
| PF01402 | RHH_1 | 7.09 |
| PF02585 | PIG-L | 0.79 |
| PF04030 | ALO | 0.79 |
| PF04366 | Ysc84 | 0.79 |
| PF00069 | Pkinase | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.15 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.79 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.79 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.28 % |
| Unclassified | root | N/A | 4.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000893|AP72_2010_repI_A001DRAFT_1057082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300001431|F14TB_100763306 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300001593|JGI12635J15846_10796237 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300001686|C688J18823_10655682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300002560|JGI25383J37093_10166438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300004633|Ga0066395_10797311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300005332|Ga0066388_106806368 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005436|Ga0070713_100192978 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300005450|Ga0066682_10232002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1186 | Open in IMG/M |
| 3300005468|Ga0070707_101321229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300005556|Ga0066707_10575728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300005587|Ga0066654_10557578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300005764|Ga0066903_104526297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300005764|Ga0066903_108310464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300006028|Ga0070717_10097153 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300006028|Ga0070717_11724651 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006052|Ga0075029_100526903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300006059|Ga0075017_101295988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300006102|Ga0075015_100044990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2067 | Open in IMG/M |
| 3300006174|Ga0075014_100108834 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300006804|Ga0079221_10594685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300009012|Ga0066710_101659064 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300009038|Ga0099829_11153996 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009089|Ga0099828_11875332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009162|Ga0075423_12832461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300010048|Ga0126373_11846267 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010162|Ga0131853_10834489 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300010359|Ga0126376_12876079 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010366|Ga0126379_12931560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300010369|Ga0136643_10859564 | Not Available | 521 | Open in IMG/M |
| 3300010376|Ga0126381_100192718 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
| 3300010376|Ga0126381_102941780 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010376|Ga0126381_103358444 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010376|Ga0126381_104340132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300010399|Ga0134127_12925808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300011120|Ga0150983_16073570 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012205|Ga0137362_11235513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae | 632 | Open in IMG/M |
| 3300012205|Ga0137362_11251613 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012206|Ga0137380_11254183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012532|Ga0137373_10969020 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012927|Ga0137416_11062319 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012971|Ga0126369_11414442 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012971|Ga0126369_12264106 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012975|Ga0134110_10082298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300014154|Ga0134075_10324655 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300014164|Ga0181532_10185121 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300016270|Ga0182036_10163635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1597 | Open in IMG/M |
| 3300016270|Ga0182036_10205740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1446 | Open in IMG/M |
| 3300016270|Ga0182036_10375890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1101 | Open in IMG/M |
| 3300016341|Ga0182035_10136024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1864 | Open in IMG/M |
| 3300016341|Ga0182035_10978027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 749 | Open in IMG/M |
| 3300016341|Ga0182035_12087592 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300016371|Ga0182034_10260907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
| 3300016371|Ga0182034_11232770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300016371|Ga0182034_11341437 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300016387|Ga0182040_10798741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300016404|Ga0182037_11675052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300016422|Ga0182039_11469302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300016422|Ga0182039_11882940 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300016445|Ga0182038_11478686 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300019361|Ga0173482_10663167 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300020170|Ga0179594_10276617 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021088|Ga0210404_10715754 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021358|Ga0213873_10198408 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300021372|Ga0213877_10175375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300021420|Ga0210394_11837817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300021439|Ga0213879_10118791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300021475|Ga0210392_10456917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300021477|Ga0210398_11234773 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021478|Ga0210402_10097800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2631 | Open in IMG/M |
| 3300021560|Ga0126371_12203046 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021976|Ga0193742_1132144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300025910|Ga0207684_10789541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300025928|Ga0207700_10136585 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300026557|Ga0179587_10931642 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027034|Ga0209730_1021820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300027371|Ga0209418_1065085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300027376|Ga0209004_1056467 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027548|Ga0209523_1083137 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027667|Ga0209009_1103381 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300027737|Ga0209038_10172018 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300027829|Ga0209773_10415806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300028798|Ga0302222_10386081 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300030618|Ga0311354_10311021 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300030618|Ga0311354_11264019 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031545|Ga0318541_10556099 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031545|Ga0318541_10667223 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031561|Ga0318528_10509974 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031573|Ga0310915_11009628 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031679|Ga0318561_10486502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300031680|Ga0318574_10771580 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031719|Ga0306917_11537378 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031770|Ga0318521_10332317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300031821|Ga0318567_10649332 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031821|Ga0318567_10761334 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031833|Ga0310917_10783656 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031879|Ga0306919_11196112 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031890|Ga0306925_11531828 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031910|Ga0306923_10797012 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300031941|Ga0310912_10969512 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031945|Ga0310913_10354624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300031946|Ga0310910_10918175 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031947|Ga0310909_10042032 | All Organisms → cellular organisms → Bacteria | 3462 | Open in IMG/M |
| 3300031947|Ga0310909_10406124 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300031947|Ga0310909_11161041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300031954|Ga0306926_10134420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3058 | Open in IMG/M |
| 3300031954|Ga0306926_11991499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300031954|Ga0306926_12002602 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032001|Ga0306922_12175389 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032035|Ga0310911_10579587 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032035|Ga0310911_10670558 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032042|Ga0318545_10238482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300032044|Ga0318558_10467099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300032044|Ga0318558_10495646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300032059|Ga0318533_11408466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300032066|Ga0318514_10700961 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032076|Ga0306924_11697572 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300032091|Ga0318577_10024483 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300032094|Ga0318540_10415798 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300032160|Ga0311301_10220755 | All Organisms → cellular organisms → Bacteria | 3197 | Open in IMG/M |
| 3300032174|Ga0307470_11255255 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300034268|Ga0372943_0163873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1360 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.15% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.57% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.57% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A001DRAFT_10570821 | 3300000893 | Forest Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPCREHPVG |
| F14TB_1007633063 | 3300001431 | Soil | MAEPRLKSGSWQIHVSYSFDRLLEXKLAQAYDILVPTREHPVGG |
| JGI12635J15846_107962372 | 3300001593 | Forest Soil | MAEPHPRGDPFRIHIAYAFDRLLEAKITQAYEILVPRR |
| C688J18823_106556821 | 3300001686 | Soil | MAEPHRKSGHFQVDVSYSFDRLLESKLAQAYEILVPCRERPVGAPV |
| JGI25383J37093_101664382 | 3300002560 | Grasslands Soil | MAEPRPKGGPLQIHVSYSFDRLLESKLAQAYDILVPTRERPIGGRVKE |
| Ga0066395_107973111 | 3300004633 | Tropical Forest Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRERPVG |
| Ga0066388_1068063681 | 3300005332 | Tropical Forest Soil | MAEPHRKSGSFQVHASYSFDRLLEPKLAQAYEILVPCRERPVGA |
| Ga0070713_1001929784 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPPAKSGPWQIHVSYSFDRLFESKLAQAYEILVPARERPVA |
| Ga0066682_102320023 | 3300005450 | Soil | MAEPRLKSGSWQIHVSYSFDRLLESKLARAYDILVPTREQP |
| Ga0070707_1013212291 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPRPKGGPLQIHVAYSFDRLLESKLAQAYDILVPRRERPVGG |
| Ga0066707_105757281 | 3300005556 | Soil | MAEPRPKGGPLQIHVSYSFDRLLESKLAQAYDILVPTR |
| Ga0066654_105575782 | 3300005587 | Soil | MAEPHRKSGHFQVEVSYSFDRLLESKLAQAYEILVHAVSAPSAHP* |
| Ga0066903_1045262971 | 3300005764 | Tropical Forest Soil | MAEPHRKSGHSQVQVSYSFDRLLEPKLAQAYEILV |
| Ga0066903_1083104641 | 3300005764 | Tropical Forest Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPC |
| Ga0070717_100971536 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPRPKSGSFQIHVSYSFDRLLEPKLAQAYDILVP |
| Ga0070717_117246511 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPHRKSGHFQVDVSYSFDRLLESKLAQAYEILVPCRKRPV |
| Ga0075029_1005269032 | 3300006052 | Watersheds | MAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCREHP |
| Ga0075017_1012959881 | 3300006059 | Watersheds | MAEPRLKSGAWQIHVSYSFDRLLESKLAQAYDILVPTRE |
| Ga0075015_1000449904 | 3300006102 | Watersheds | MPFCALCKGMAEPRHKSGPFQIQVSFSFDRLLALKLAQAYEILVPCRE |
| Ga0075014_1001088344 | 3300006174 | Watersheds | MPEPRQNRGAFQIQVSYSFDRLLEPKLAQAYELLVP |
| Ga0075014_1007447492 | 3300006174 | Watersheds | MAEPRARSGPLQIQVDYAFDRLLESKLAQAYDILVPRRERPVGAPVK |
| Ga0079221_105946853 | 3300006804 | Agricultural Soil | MAEPHRKSGSFQIQVSYSFDRLLELKLAQAYDILVP |
| Ga0066710_1016590641 | 3300009012 | Grasslands Soil | MAEPHRKSGHFQVEVSYSFDRLLESKLAQAYEILVPCRERPVGAPVK |
| Ga0099829_111539961 | 3300009038 | Vadose Zone Soil | MAEPRQKSGSFQIHVSYSFDRLLEPKLAQAYDILVPC |
| Ga0099828_118753321 | 3300009089 | Vadose Zone Soil | MAEPGQKSGSFQIHVSYSFDRLLEPKLAQAYDILVPC |
| Ga0075423_128324611 | 3300009162 | Populus Rhizosphere | MAEPRPKSGPLQIHVSYSFDRLLESKLAQAHDILVPLRERPVGGR |
| Ga0126373_118462673 | 3300010048 | Tropical Forest Soil | MAEPRQNSGAFHIHISYSFDRLLEPKLAQAYEILVPCRE |
| Ga0131853_108344891 | 3300010162 | Termite Gut | MAEPQRRSGPFRIHIAYSFDRLLETKLAQAYETLVPCCER |
| Ga0126376_128760791 | 3300010359 | Tropical Forest Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRE |
| Ga0126379_129315601 | 3300010366 | Tropical Forest Soil | MAEPRRKSGHFQIHVAYSFDRLLEPKLAQAYEILVPCRER |
| Ga0136643_108595641 | 3300010369 | Termite Gut | MAEPQRKSGPFRIDIAYCFDRLLETKLAQAYETLVPCRERF |
| Ga0126381_1001927181 | 3300010376 | Tropical Forest Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILV |
| Ga0126381_1029417803 | 3300010376 | Tropical Forest Soil | MAEPRQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVG |
| Ga0126381_1033584441 | 3300010376 | Tropical Forest Soil | MAEPRRKSGHFQIQVAYSFDRLLEPKLAQAYEILVP |
| Ga0126381_1043401322 | 3300010376 | Tropical Forest Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCR |
| Ga0134127_129258082 | 3300010399 | Terrestrial Soil | MAEPRLKSGSWQIHVSYSFDRLLESKLAQAYDILVPTREQPVGGCLVDA* |
| Ga0150983_160735703 | 3300011120 | Forest Soil | MPEPRQNRDAFQIQVSYLFDRLLEPKLARAYEILVPCREHPVGARVK |
| Ga0137391_111120321 | 3300011270 | Vadose Zone Soil | MAEPRARSGPFQIYVDYAFDRLRESKLAQAYDILVPRRERPVGG |
| Ga0137362_112355133 | 3300012205 | Vadose Zone Soil | MAEPRPKSGPLQIHVSYSFDRLLESKLAQAYDILVPSRERPV |
| Ga0137362_112516133 | 3300012205 | Vadose Zone Soil | MAEPRRKSDSFQIHISYSFDRLLEAKLAQAYDILV |
| Ga0137380_112541831 | 3300012206 | Vadose Zone Soil | MAEPRPKSSPLQIHVTYSFDRLLESKLAQAYDILVPSRERPVG |
| Ga0137373_109690201 | 3300012532 | Vadose Zone Soil | MAEPRRKSSRFQIRVSYSFDRLLEPKLAQAYDILVPCRERPV |
| Ga0137416_110623191 | 3300012927 | Vadose Zone Soil | MAEPRPKSGPLQIHVAYSFDRLLESKLAQAYDILVPRRERPVG |
| Ga0126369_114144423 | 3300012971 | Tropical Forest Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILV |
| Ga0126369_122641063 | 3300012971 | Tropical Forest Soil | MAEPHRKSGSFQIHVSYSFDRLLEPKLARAYEILVPCRERP |
| Ga0134110_100822983 | 3300012975 | Grasslands Soil | MAEPRRKSGPFQIHASYSFDRLLEPKLAQAYDILVP |
| Ga0134075_103246551 | 3300014154 | Grasslands Soil | MAEPLGRSGPLQIQIDYAFDRLCESKLAQAYSILVPCRERPMGEHVKEFAH |
| Ga0181532_101851211 | 3300014164 | Bog | MAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCRE |
| Ga0182036_101636351 | 3300016270 | Soil | MAEPQRKSGPFRVHIAYSFDRLLEAKLAQAYEILVP |
| Ga0182036_102057401 | 3300016270 | Soil | MAEPHPRSGPFRIHIAYSFDRLLEAKLAQAYEILV |
| Ga0182036_103758901 | 3300016270 | Soil | MAEPRQKSGPFQIHVAYWFDRLLEPKLAQAYNILVPCRERPIGVR |
| Ga0182035_101360241 | 3300016341 | Soil | MAEPRAKSGPLQIQVDYVFDRLLESKLAQAYDILVPRRERPVGGRVKE |
| Ga0182035_109780271 | 3300016341 | Soil | MAEPRRTSGPLQIHVAYWLDRLLEPKLAQAYELLVPCRERPVG |
| Ga0182035_120875922 | 3300016341 | Soil | MAEPRLKSGLWQIHVSYSFDRLLESKLAQAYDILVPTREY |
| Ga0182034_102609071 | 3300016371 | Soil | MAEPRLKSGLWQIQVSYSFDRLLESKLAQAYDILVPTREYPVG |
| Ga0182034_112327701 | 3300016371 | Soil | MAEPRQSRGPFQIQVSYSFDRWLEPKLAQAYDILVPC |
| Ga0182034_113414372 | 3300016371 | Soil | MAEPHPKSGPFRIHIAYSFDRLLEAKLAQAYEILVPC |
| Ga0182040_107987411 | 3300016387 | Soil | MAEPRSKSGPFQIQISYSFDRLLESKLAQAYDILVPCRERPVG |
| Ga0182037_116750522 | 3300016404 | Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRER |
| Ga0182039_114693022 | 3300016422 | Soil | MAEPQRKSGPFRVHIAYSFDRLLEAKLAQAYEILV |
| Ga0182039_118829401 | 3300016422 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCREHPV |
| Ga0182038_114786861 | 3300016445 | Soil | MAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVG |
| Ga0173482_106631671 | 3300019361 | Soil | MAEPHRKSGHFQVHVSYSFDRLLESKLAQAYEILVPCRERLVGAR |
| Ga0179594_102766171 | 3300020170 | Vadose Zone Soil | MADPRPKSGSFQIHVSYSFDRLLEAKLAQAYDILVPCRERPVGVRVK |
| Ga0210404_107157541 | 3300021088 | Soil | MAEPRPKSGPLQIHVSFSFDRLLESKLAQAYDILVPLRE |
| Ga0213873_101984081 | 3300021358 | Rhizosphere | MAEPHRKSGHFQVHVSYSFDRLLESKLEQAYEILVPCRERLVGAR |
| Ga0213877_101753753 | 3300021372 | Bulk Soil | MAEPRQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPV |
| Ga0210386_116379541 | 3300021406 | Soil | MAEPRSRSGPLQIHVDYVFDRLLESKLAQAYDLLV |
| Ga0210394_118378172 | 3300021420 | Soil | MAEARLRSGVWQIHISYSFDRLLESKLAQAYDILVPTRERPVGG |
| Ga0213879_101187911 | 3300021439 | Bulk Soil | MAEPYRKSGHFHVNVSYSFDRLLEPKLAQAYEILVPCRERPVGASVK |
| Ga0210392_104569171 | 3300021475 | Soil | MAEPHPRDDPFRIHIAYAFDRLLEAKLTQAYEILVP |
| Ga0210398_112347731 | 3300021477 | Soil | MAEPHPRGDPFRVHIAYSFDRLLESKLTQAYEILVPCRERPVGV |
| Ga0210402_100978003 | 3300021478 | Soil | MAEPHRKSGSFQIQVSYSFDRLLELKLAQAYDILTE |
| Ga0126371_122030461 | 3300021560 | Tropical Forest Soil | MAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVP |
| Ga0193742_11321443 | 3300021976 | Soil | MAEPRLKSGLWQIHVSYSFDRLLESKLAQAYDILAPTREEPVGGCL |
| Ga0207684_107895413 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEQHRKSASFQIQVSYSFDRLLELKLAQAYDILVPCRERPVG |
| Ga0207700_101365854 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCRAHPV |
| Ga0179587_109316421 | 3300026557 | Vadose Zone Soil | MAEPRQNRDAFQIQVSYSFDRLLEPKLVRAYEILVPCREHPVG |
| Ga0209730_10218201 | 3300027034 | Forest Soil | MAESRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCR |
| Ga0209418_10650852 | 3300027371 | Forest Soil | MAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDREVGM |
| Ga0209004_10564673 | 3300027376 | Forest Soil | MAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDILVPC |
| Ga0209523_10831373 | 3300027548 | Forest Soil | MAEPRQNRGAFQIQVSYLFDRLLDPKLAQAYELLVPCREHPVGARV |
| Ga0209009_11033811 | 3300027667 | Forest Soil | MAEPRPKSGPLQIHVAYSFDRLLESKLAQAYDILVPR |
| Ga0209038_101720181 | 3300027737 | Bog Forest Soil | MAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDILVPCRER |
| Ga0209773_104158062 | 3300027829 | Bog Forest Soil | MAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDILVPCRERPVGG |
| Ga0302222_103860811 | 3300028798 | Palsa | MAEPRPRGDPYRVHIAYSFDRLLESKLTQAYEILVPCRERAVGVG |
| Ga0311354_103110214 | 3300030618 | Palsa | MAEQRLKSGAWQIHVSYSFDRLLESKLAQAYNILAPTRERPVGGKESE |
| Ga0311354_112640191 | 3300030618 | Palsa | MAEPRPRGDPYRIHIAYSFDRLLESKPTQAYEILVPCRERVIG |
| Ga0318541_105560992 | 3300031545 | Soil | MAESHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRERPVGACLK |
| Ga0318541_106672231 | 3300031545 | Soil | MAEPRCKSGPLEIHVAFVFDRLLESKLAQAYSILVPTRERPVE |
| Ga0318538_107865201 | 3300031546 | Soil | MADPRARSSPLQIKVDYAFDRLLQSKLAQAYDILVPLRERPVGG |
| Ga0318528_105099743 | 3300031561 | Soil | MAEPRLKSGLWQIHVSYSFDRLLESKLAQAYDILVPTREYPVGGCVK |
| Ga0310915_110096282 | 3300031573 | Soil | MAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVGVK |
| Ga0318561_104865023 | 3300031679 | Soil | MAEPGRKSGPLQIHVAYWFDRLLEPKLAQAYEILVPCRER |
| Ga0318574_107715801 | 3300031680 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPRRDIPSGRA |
| Ga0306917_115373782 | 3300031719 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCRE |
| Ga0318521_103323171 | 3300031770 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPRREHP |
| Ga0318567_106493321 | 3300031821 | Soil | MAEPRQSRGPFQIQVSYSFDRWLEPKLAQAYDILVPCRE |
| Ga0318567_107613343 | 3300031821 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPC |
| Ga0310917_101741553 | 3300031833 | Soil | MAEPRAKSGPLQIQVDYVFDRLLESKLAQAYDILV |
| Ga0310917_107836562 | 3300031833 | Soil | MAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLV |
| Ga0306919_111961122 | 3300031879 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPRREHPVGARVKE |
| Ga0306925_115318282 | 3300031890 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCREHP |
| Ga0306923_107970123 | 3300031910 | Soil | MAEPQRKSGPFRIHIAYSFDRLLDPKLTQAYDILVPCRERAV |
| Ga0310912_109695121 | 3300031941 | Soil | MAEPRSKSGPFQIQISYSFDRLLESKLAQAYDILVPCR |
| Ga0310913_103546241 | 3300031945 | Soil | MAEPRQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVGVK |
| Ga0310910_109181753 | 3300031946 | Soil | MAEPHPRSGPFRIHIAYSFDRLLEAKLAQAYEILVPC |
| Ga0310909_100420321 | 3300031947 | Soil | MAEPGRKSGPLQIHVAYWFDRLLEPKLAQAYEILVPCRERP |
| Ga0310909_104061242 | 3300031947 | Soil | MAEPRSKSGPLEIHVAYVFDRLLESKLAQAYSILVPTRECPVERVKECDH |
| Ga0310909_111610411 | 3300031947 | Soil | MAEPRQNSGAFQIHVSYSFDRLLEPKLAQAYEILVPCR |
| Ga0306926_101344203 | 3300031954 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPCRETPCRGAREGVRR |
| Ga0306926_119914991 | 3300031954 | Soil | MAEPHRRGGPFRIHIAYSFDRLLEAKLAQAYEILV |
| Ga0306926_120026021 | 3300031954 | Soil | MAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPC |
| Ga0306922_121753891 | 3300032001 | Soil | MAEPRLKSGSWQIHVSYSFDRLLESKLAQAYDLLVP |
| Ga0310911_105795871 | 3300032035 | Soil | MAEPHRKSGSIQVHVSYSFDRLLEPKLAQAYEILVPCRERP |
| Ga0310911_106705581 | 3300032035 | Soil | MAEPRCKSGPLEIHVAFVFDRLLESKLAQAYSILVPTRERPVERVKECD |
| Ga0318545_102384821 | 3300032042 | Soil | MAEPRQSRGPFQIQVSYSFDRWLEPKLAQAYDILVPCRERPL |
| Ga0318558_104670992 | 3300032044 | Soil | MAEPRQNRDPFQIQVSYSFDRLLEPKLAQAYEILVPRREHPVG |
| Ga0318558_104956461 | 3300032044 | Soil | MAEPHRKSGSIQVHVSYSFDRLLEPKLAQAYEILVPCRERPVGACVK |
| Ga0318533_114084661 | 3300032059 | Soil | MAEPRQNSGAFQIHVSYSFDRLLEPKLAQAYEILVPCRECPAGVRV |
| Ga0318514_107009612 | 3300032066 | Soil | MAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCRERPVGVK |
| Ga0306924_116975721 | 3300032076 | Soil | MAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCRE |
| Ga0318577_100244831 | 3300032091 | Soil | MAEPRQSRGPFQIQVSYSFDRLLEPKLAQAYDILVPCRE |
| Ga0318540_104157982 | 3300032094 | Soil | MAEPRCKSGPLEIHVAFVFDRLLESKLAQAYSILVPTRERPVERVK |
| Ga0311301_102207553 | 3300032160 | Peatlands Soil | MAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCREEYEILCDST |
| Ga0307470_112552552 | 3300032174 | Hardwood Forest Soil | MAEPHRKSGSFQIQVSYSFDRLLELKLAQAYDILVPCRERPVGVKE |
| Ga0372943_0163873_2_109 | 3300034268 | Soil | MAEPHRKSGHFQVDVSYSFDRLLESKLAQAYEILVP |
| ⦗Top⦘ |