


| Basic Information | |
|---|---|
| Family ID | F065994 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSX |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 54.33 % |
| % of genes near scaffold ends (potentially truncated) | 90.55 % |
| % of genes from short scaffolds (< 2000 bps) | 97.64 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.402 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.535 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.071 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.118 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.44% β-sheet: 0.00% Coil/Unstructured: 80.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.40 |
| PF01135 | PCMT | 0.80 |
| PF00233 | PDEase_I | 0.80 |
| PF13518 | HTH_28 | 0.80 |
| PF01527 | HTH_Tnp_1 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.40 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.80 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.40 % |
| Unclassified | root | N/A | 12.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000660|JGI12415J11908_10344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 529 | Open in IMG/M |
| 3300000699|JGI12536J11923_103630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 542 | Open in IMG/M |
| 3300000701|JGI12340J11893_100397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 1272 | Open in IMG/M |
| 3300000725|JGI12588J11881_103362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 691 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1058897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300001108|JGI12647J13326_102445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300001155|JGI12625J13251_10168 | Not Available | 1046 | Open in IMG/M |
| 3300001383|JGI20194J14741_1011810 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300001661|JGI12053J15887_10419093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101083140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 688 | Open in IMG/M |
| 3300003351|JGI26346J50198_1014867 | Not Available | 754 | Open in IMG/M |
| 3300003569|Ga0007420J51693_1039488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 577 | Open in IMG/M |
| 3300004082|Ga0062384_101394619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 516 | Open in IMG/M |
| 3300004281|Ga0066397_10076551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300004633|Ga0066395_10449334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 735 | Open in IMG/M |
| 3300004800|Ga0058861_12020399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 899 | Open in IMG/M |
| 3300004801|Ga0058860_12213357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300005178|Ga0066688_10220110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1209 | Open in IMG/M |
| 3300005180|Ga0066685_10428337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 919 | Open in IMG/M |
| 3300005363|Ga0008090_14265320 | Not Available | 555 | Open in IMG/M |
| 3300005454|Ga0066687_10207973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1072 | Open in IMG/M |
| 3300005556|Ga0066707_11017121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 505 | Open in IMG/M |
| 3300005574|Ga0066694_10374949 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005618|Ga0068864_101225046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 749 | Open in IMG/M |
| 3300005713|Ga0066905_101113407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300005764|Ga0066903_105134173 | Not Available | 693 | Open in IMG/M |
| 3300005764|Ga0066903_107032038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300005947|Ga0066794_10192218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300006086|Ga0075019_10781393 | Not Available | 607 | Open in IMG/M |
| 3300006175|Ga0070712_101811344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 534 | Open in IMG/M |
| 3300006755|Ga0079222_10452064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300006864|Ga0066797_1208143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300010043|Ga0126380_11467497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010048|Ga0126373_11284664 | Not Available | 798 | Open in IMG/M |
| 3300010101|Ga0127481_1062717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 554 | Open in IMG/M |
| 3300010152|Ga0126318_10070760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 553 | Open in IMG/M |
| 3300010154|Ga0127503_10722245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 534 | Open in IMG/M |
| 3300010358|Ga0126370_11480853 | Not Available | 644 | Open in IMG/M |
| 3300010361|Ga0126378_13360364 | Not Available | 508 | Open in IMG/M |
| 3300010854|Ga0126360_1041804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 588 | Open in IMG/M |
| 3300010855|Ga0126355_1131184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 529 | Open in IMG/M |
| 3300010858|Ga0126345_1052633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 586 | Open in IMG/M |
| 3300010862|Ga0126348_1214960 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010865|Ga0126346_1183469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012212|Ga0150985_116251942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 585 | Open in IMG/M |
| 3300012212|Ga0150985_118407640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 596 | Open in IMG/M |
| 3300012469|Ga0150984_101211110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 560 | Open in IMG/M |
| 3300012929|Ga0137404_12018334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 538 | Open in IMG/M |
| 3300012971|Ga0126369_11879315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium genosp. SA-3 | 687 | Open in IMG/M |
| 3300012971|Ga0126369_13596634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 508 | Open in IMG/M |
| 3300012984|Ga0164309_10791908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 762 | Open in IMG/M |
| 3300012984|Ga0164309_10791908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 762 | Open in IMG/M |
| 3300013306|Ga0163162_11616684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300014164|Ga0181532_10809857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 502 | Open in IMG/M |
| 3300016294|Ga0182041_10826669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 829 | Open in IMG/M |
| 3300016294|Ga0182041_12166508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 519 | Open in IMG/M |
| 3300018072|Ga0184635_10216681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 762 | Open in IMG/M |
| 3300018072|Ga0184635_10216681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 762 | Open in IMG/M |
| 3300019161|Ga0184602_126467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300019165|Ga0184589_126315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 576 | Open in IMG/M |
| 3300019185|Ga0184587_122336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 577 | Open in IMG/M |
| 3300019187|Ga0184584_130709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 524 | Open in IMG/M |
| 3300019242|Ga0181502_1183086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300019284|Ga0187797_1480157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 679 | Open in IMG/M |
| 3300019284|Ga0187797_1772692 | Not Available | 542 | Open in IMG/M |
| 3300020070|Ga0206356_10929893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 699 | Open in IMG/M |
| 3300021307|Ga0179585_1083915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 551 | Open in IMG/M |
| 3300021374|Ga0213881_10600334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 502 | Open in IMG/M |
| 3300021560|Ga0126371_11075157 | Not Available | 944 | Open in IMG/M |
| 3300021855|Ga0213854_1141945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300021855|Ga0213854_1347630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1567 | Open in IMG/M |
| 3300021860|Ga0213851_1347350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 535 | Open in IMG/M |
| 3300021861|Ga0213853_10970485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 685 | Open in IMG/M |
| 3300022195|Ga0222625_1213815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300023046|Ga0233356_1017581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300023656|Ga0247547_103774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 514 | Open in IMG/M |
| 3300025432|Ga0208821_1067726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 608 | Open in IMG/M |
| 3300025457|Ga0208850_1002699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4186 | Open in IMG/M |
| 3300025481|Ga0208079_1096799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300025852|Ga0209124_10225091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 732 | Open in IMG/M |
| 3300025901|Ga0207688_10623744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 680 | Open in IMG/M |
| 3300025925|Ga0207650_11143689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 663 | Open in IMG/M |
| 3300026271|Ga0209880_1077028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 697 | Open in IMG/M |
| 3300026285|Ga0209438_1189495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 545 | Open in IMG/M |
| 3300026481|Ga0257155_1058144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 610 | Open in IMG/M |
| 3300026490|Ga0257153_1082449 | Not Available | 644 | Open in IMG/M |
| 3300026860|Ga0207823_111005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 624 | Open in IMG/M |
| 3300026990|Ga0207824_1034092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300027061|Ga0209729_1037084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 612 | Open in IMG/M |
| 3300027181|Ga0208997_1027811 | Not Available | 815 | Open in IMG/M |
| 3300027680|Ga0207826_1105535 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300027680|Ga0207826_1167385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300028828|Ga0307312_11028621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300029951|Ga0311371_11840094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 652 | Open in IMG/M |
| 3300030509|Ga0302183_10319368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 599 | Open in IMG/M |
| 3300030738|Ga0265462_11510002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 626 | Open in IMG/M |
| 3300030763|Ga0265763_1009091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 898 | Open in IMG/M |
| 3300030763|Ga0265763_1013522 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300030863|Ga0265766_1016798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300030903|Ga0308206_1138221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300030987|Ga0308155_1031012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031018|Ga0265773_1015438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300031043|Ga0265779_110224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 574 | Open in IMG/M |
| 3300031082|Ga0308192_1078387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031092|Ga0308204_10166682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 665 | Open in IMG/M |
| 3300031123|Ga0308195_1071082 | Not Available | 540 | Open in IMG/M |
| 3300031226|Ga0307497_10662869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300031543|Ga0318516_10438359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 751 | Open in IMG/M |
| 3300031546|Ga0318538_10519694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300031663|Ga0307484_113754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 571 | Open in IMG/M |
| 3300031679|Ga0318561_10530477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 648 | Open in IMG/M |
| 3300031679|Ga0318561_10584118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300031753|Ga0307477_10378919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 970 | Open in IMG/M |
| 3300031780|Ga0318508_1225855 | Not Available | 537 | Open in IMG/M |
| 3300031781|Ga0318547_10893433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 554 | Open in IMG/M |
| 3300031782|Ga0318552_10301812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 814 | Open in IMG/M |
| 3300031798|Ga0318523_10386294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 696 | Open in IMG/M |
| 3300031833|Ga0310917_10961556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 573 | Open in IMG/M |
| 3300031866|Ga0316049_114504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300031941|Ga0310912_11168613 | Not Available | 586 | Open in IMG/M |
| 3300032001|Ga0306922_10054721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4136 | Open in IMG/M |
| 3300032063|Ga0318504_10197116 | Not Available | 939 | Open in IMG/M |
| 3300032068|Ga0318553_10325906 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300032076|Ga0306924_11220571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300032094|Ga0318540_10406732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300033289|Ga0310914_10043828 | All Organisms → cellular organisms → Bacteria | 3657 | Open in IMG/M |
| 3300034447|Ga0370544_16370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 3.15% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.36% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.57% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.57% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000660 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 | Environmental | Open in IMG/M |
| 3300000699 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 79 | Environmental | Open in IMG/M |
| 3300000701 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 | Environmental | Open in IMG/M |
| 3300000725 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001108 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 | Environmental | Open in IMG/M |
| 3300001155 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 | Environmental | Open in IMG/M |
| 3300001383 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003569 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_36 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010855 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019187 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300023656 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12415J11908_103443 | 3300000660 | Tropical Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPD |
| JGI12536J11923_1036301 | 3300000699 | Tropical Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSX |
| JGI12340J11893_1003973 | 3300000701 | Tropical Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPDL* |
| JGI12588J11881_1033621 | 3300000725 | Tropical Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARV |
| AP72_2010_repI_A001DRAFT_10588971 | 3300000893 | Forest Soil | MPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRG |
| JGI12647J13326_1024453 | 3300001108 | Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPD |
| JGI12625J13251_101681 | 3300001155 | Forest Soil | MPVERRGQVTDVGSESTGNRRSSNSRREAAAFVRWHEPDD |
| JGI20194J14741_10118103 | 3300001383 | Arctic Peat Soil | MPAERRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSDSG* |
| JGI12053J15887_104190931 | 3300001661 | Forest Soil | MPVEQREQVIDAESEPTGDRMSSNSRRKAAAFVRWHEPDDARVSSPDL*AARGE |
| JGIcombinedJ26739_1010831401 | 3300002245 | Forest Soil | MPAEQREQVIGVGSEPTGNRMSSNSRRKAAAFVRWHEPDDARVSSPDL* |
| JGI26346J50198_10148672 | 3300003351 | Bog Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAXVRWHEPDDARVSSP |
| Ga0007420J51693_10394882 | 3300003569 | Avena Fatua Rhizosphere | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP |
| Ga0062384_1013946192 | 3300004082 | Bog Forest Soil | MPVERRGQVTDVGSGPTGNRMSSNSRRKAAAFVRWHEPDDARVSSPD |
| Ga0066397_100765513 | 3300004281 | Tropical Forest Soil | MPAERRGQVIAVGIEPTGHRTSSISRRKAAAFKRWHEPDDARVSRPESVSGSG* |
| Ga0066395_104493342 | 3300004633 | Tropical Forest Soil | MPAEQRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSGSG |
| Ga0058861_120203994 | 3300004800 | Host-Associated | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDLC |
| Ga0058860_122133572 | 3300004801 | Host-Associated | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL* |
| Ga0066688_102201102 | 3300005178 | Soil | MPVERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDDARVSSPDL* |
| Ga0066685_104283372 | 3300005180 | Soil | MPVERRGQVTDVGSEPTGNRKSSNSRREAAAFVRWHEPDDARVSSPDL* |
| Ga0008090_142653201 | 3300005363 | Tropical Rainforest Soil | MPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGLRPVL |
| Ga0066687_102079731 | 3300005454 | Soil | SGVMPVERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDDARVSSPDL* |
| Ga0066707_110171211 | 3300005556 | Soil | MPVERRGQVTDVGSEPTGNSSNSRREAAAFVRWHEPDDARVSSPDL* |
| Ga0066694_103749491 | 3300005574 | Soil | MPVERRGQVTDVGSEPTGNRRSSNSQRKAAAFVRWHEPD |
| Ga0068864_1012250462 | 3300005618 | Switchgrass Rhizosphere | VERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL |
| Ga0066905_1011134071 | 3300005713 | Tropical Forest Soil | VERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEP |
| Ga0066903_1051341731 | 3300005764 | Tropical Forest Soil | VERRGWVTRAWIGEPTGNRRSSLIERKAAAFGEWHE |
| Ga0066903_1070320382 | 3300005764 | Tropical Forest Soil | VMPVERRGWVTRAWIGEPTGNRRSSLIERKAAAFGEWHEPYKSRGLRTVL* |
| Ga0066794_101922181 | 3300005947 | Soil | MLVERRGQVTDVGSEPTGNRRSSNSRRKATAFAWWHEPDEARVSSPESVRG |
| Ga0075019_107813931 | 3300006086 | Watersheds | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRW |
| Ga0070712_1018113441 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVERRGQVTDVGSESTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL* |
| Ga0079222_104520642 | 3300006755 | Agricultural Soil | MPVEQRGQVTDVGREPTGDRMSSNFRRKAAAFVSVARAG* |
| Ga0066797_12081431 | 3300006864 | Soil | MPVEQRGQVTDVGSEPTGDRMSSNFRRKAAAFVSVARA |
| Ga0126380_114674971 | 3300010043 | Tropical Forest Soil | MPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRW |
| Ga0126373_112846641 | 3300010048 | Tropical Forest Soil | RSGVIPVERRGQVTGVEIDRSTGNGMNRLSWRKAAAFTRWHEPDKLRGLCPVL* |
| Ga0127481_10627171 | 3300010101 | Grasslands Soil | VERRGQVTDVGSEPTGNRKSSNSRREAAAFVRWHEPDDA |
| Ga0126318_100707601 | 3300010152 | Soil | VERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSS |
| Ga0127503_107222451 | 3300010154 | Soil | VERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDDARVS |
| Ga0126370_114808531 | 3300010358 | Tropical Forest Soil | MPVERRGQVTDVESGPTGNRKSPISRREAAAFVRWHEPD |
| Ga0126378_133603641 | 3300010361 | Tropical Forest Soil | MPAEQSGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEP |
| Ga0126360_10418041 | 3300010854 | Boreal Forest Soil | VEQREQVIDVGREPTGNRMSSKSRRKAAAFVRWHEPDDARVSR |
| Ga0126355_11311841 | 3300010855 | Boreal Forest Soil | MPAEQREQVIGVGSEPTGNRMNSSSRRKAAAFVRWHEPDDMRVSSPD |
| Ga0126345_10526331 | 3300010858 | Boreal Forest Soil | VERRGQVTDVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARVSSP |
| Ga0126348_12149601 | 3300010862 | Boreal Forest Soil | VEQREQVIDAESEPTGNRMSSNSRRKAAAFVSVARA |
| Ga0126346_11834691 | 3300010865 | Boreal Forest Soil | MPVEQREQVIDAEIEPTGDRMSSKSRRKAAAFVRWHEPDDARVSSPD |
| Ga0150985_1162519421 | 3300012212 | Avena Fatua Rhizosphere | MPVEQRGQVTDVGSEPTGNRRSSDSRRKAAAFVRWHEPDDARVSSPDL |
| Ga0150985_1184076401 | 3300012212 | Avena Fatua Rhizosphere | VERRGQVTDVGSEPTGNRRSSNSRRKAAAFARWHEPDDARVSSPD |
| Ga0150984_1012111101 | 3300012469 | Avena Fatua Rhizosphere | VERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDAR |
| Ga0137404_120183341 | 3300012929 | Vadose Zone Soil | EAGVMLVERRGQVIAVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARVSSPDL* |
| Ga0126369_118793151 | 3300012971 | Tropical Forest Soil | SDEAGVMPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGLRPVL* |
| Ga0126369_135966341 | 3300012971 | Tropical Forest Soil | MGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSGSGRNS |
| Ga0164309_107919081 | 3300012984 | Soil | SGVMPVEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHEPDDARVSSPDL* |
| Ga0164309_107919082 | 3300012984 | Soil | VEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHE |
| Ga0163162_116166841 | 3300013306 | Switchgrass Rhizosphere | ERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL* |
| Ga0181532_108098571 | 3300014164 | Bog | VEQREPVIDVGSGPTGNRMSSNSRRKAAAFARWHEPDDARVSSPESVRG |
| Ga0182041_108266691 | 3300016294 | Soil | MAVERRGQVTGVEIDRSTGNGRNHWSWRKAAAFTRWHEPDKLRG |
| Ga0182041_121665081 | 3300016294 | Soil | MPAERREQVIDVEIEPTGNRMSSMSQWKAAAFMRWHEPDDARVSRPE |
| Ga0184635_102166811 | 3300018072 | Groundwater Sediment | VEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDAR |
| Ga0184635_102166812 | 3300018072 | Groundwater Sediment | VEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDARVSSPDL |
| Ga0184602_1264673 | 3300019161 | Soil | MLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPDDTRV |
| Ga0184589_1263151 | 3300019165 | Soil | MPAERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPD |
| Ga0184587_1223362 | 3300019185 | Soil | MLVERRGQVTDVGREPTANGRSSNSRLKAAAFARWHEPDDTRVS |
| Ga0184584_1307093 | 3300019187 | Soil | MLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPDDTRVSR |
| Ga0181502_11830862 | 3300019242 | Peatland | MPVEQREQVIDAGSGPTGNRMISNPRRKAAAFVRWHEP |
| Ga0187797_14801571 | 3300019284 | Peatland | VEQRGQVTDVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARVSSP |
| Ga0187797_17726921 | 3300019284 | Peatland | MPVEQRGQVIDVGSEPTGDRRSSNSRRKAAAFNRWHEPDEARASCP |
| Ga0206356_109298931 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVS |
| Ga0179585_10839151 | 3300021307 | Vadose Zone Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDA |
| Ga0213881_106003341 | 3300021374 | Exposed Rock | MPAEQRGQVIDVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSGSGRN |
| Ga0126371_110751572 | 3300021560 | Tropical Forest Soil | MGWVIDAEIRSTGNRKSLMSWRKAAAFKRWHEPDDARVSRPESV |
| Ga0213854_11419451 | 3300021855 | Watersheds | MLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPDDTRVSRP |
| Ga0213854_13476302 | 3300021855 | Watersheds | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL |
| Ga0213851_13473501 | 3300021860 | Watersheds | MPVERREQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP |
| Ga0213853_109704851 | 3300021861 | Watersheds | MPVEQREQVIDVGSEPTGNRMSSNSPRKAAAFVRWHEPDDARVSSP |
| Ga0222625_12138151 | 3300022195 | Groundwater Sediment | VEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHEPDDARVSSP |
| Ga0233356_10175812 | 3300023046 | Soil | MPAEQREQVIGVGSEPTGNRMSSNSRRKAAAFVRWHEPD |
| Ga0247547_1037742 | 3300023656 | Soil | MLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPDDTRVS |
| Ga0208821_10677261 | 3300025432 | Peatland | MLVERRGQVTDVGREPTGNGRSSNSRRKAAAFTAIIT |
| Ga0208850_10026994 | 3300025457 | Arctic Peat Soil | MPAERRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVSDSG |
| Ga0208079_10967991 | 3300025481 | Arctic Peat Soil | MLVEQRGQVTDVGSEPTGNRRSSNSRRKATAFAWWHEPDEARVSS |
| Ga0209124_102250911 | 3300025852 | Arctic Peat Soil | MPAEQRGQVIGVGKEPTVKGRSFKSQRKAAAFVRRHEPDDARVSRPESVSD |
| Ga0207688_106237441 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSVRICERLGVK |
| Ga0207650_111436891 | 3300025925 | Switchgrass Rhizosphere | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSS |
| Ga0209880_10770281 | 3300026271 | Soil | MPAERRGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRPESVS |
| Ga0209438_11894951 | 3300026285 | Grasslands Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPDL |
| Ga0257155_10581441 | 3300026481 | Soil | MPVERRGQATDVGSEPTGNRRSSNSRRKAAAFARWHEPDDA |
| Ga0257153_10824491 | 3300026490 | Soil | VERRGQVTDVGSEPTGNRRSSNSRWEAAAFVRWHEPDD |
| Ga0207823_1110051 | 3300026860 | Tropical Forest Soil | VERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARV |
| Ga0207824_10340922 | 3300026990 | Tropical Forest Soil | MLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARGHEPDD |
| Ga0209729_10370841 | 3300027061 | Forest Soil | MPAERRGQVIGVGKEPTVKGKSFKSQRKAAAFVRWHEPDDAR |
| Ga0208997_10278112 | 3300027181 | Forest Soil | MPVERRGQVTDVESEPTGNRRSSDSRREAAAFVRWHEPDD |
| Ga0207826_11055351 | 3300027680 | Tropical Forest Soil | MPVEQRGQVTDVGSEPTGNRRSSNSRRKAAAFAQWHEPDDARVSSPDVCPVKASMYSR |
| Ga0207826_11673851 | 3300027680 | Tropical Forest Soil | MPAERRGQVIAVGIEPTGHRTSSISRRKAAAFKRWHEPDDARVSRPEAV |
| Ga0307312_110286211 | 3300028828 | Soil | VEQRGQVTDVGSEPTGNRRSSNSRRKAAAFVRWHEPDDARV |
| Ga0311371_118400941 | 3300029951 | Palsa | VEQREQVIDAGSGPTGNRMSSNPRRKAAAFVRWHEPDDARVSSPDL |
| Ga0302183_103193681 | 3300030509 | Palsa | VEQREQVIDAGSGPTGNRMSSNPRRKAAAFVRWHEPDDARV |
| Ga0265462_115100021 | 3300030738 | Soil | MLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPDDTRVS |
| Ga0265763_10090912 | 3300030763 | Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVS |
| Ga0265763_10135222 | 3300030763 | Soil | MPAERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVS |
| Ga0265766_10167981 | 3300030863 | Soil | MPAEQREQVIGVGSEPTGNSMSSNSRRKAAAFVRWHEPDDARVS |
| Ga0308206_11382211 | 3300030903 | Soil | VEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDARVSSP |
| Ga0308155_10310121 | 3300030987 | Soil | VEQRGQVTEVGSEPTGDRRSSNSRRKAAAFGWWHEPDDARVS |
| Ga0265773_10154382 | 3300031018 | Soil | MLVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPD |
| Ga0265779_1102241 | 3300031043 | Soil | MPAERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP |
| Ga0308192_10783871 | 3300031082 | Soil | VEQRGQVTEVGSGPTGDRRSSNSRRKAAAFGWWHEPDDARV |
| Ga0308204_101666821 | 3300031092 | Soil | VERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSP |
| Ga0308195_10710821 | 3300031123 | Soil | MPVERRGQVTDVGREPTGNGRSSNSRRKAAAFARWHEPDES |
| Ga0307497_106628691 | 3300031226 | Soil | VERRGQVTDVGSESTGNRRSSNSRRKAAAFRRWHEPDDAR |
| Ga0318516_104383591 | 3300031543 | Soil | VERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGL |
| Ga0318538_105196941 | 3300031546 | Soil | VERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHE |
| Ga0307484_1137541 | 3300031663 | Hardwood Forest Soil | MPAERRGQVIDVGSEPTDNRRSSNSRREAAAFIRWHEPDDARVSSPD |
| Ga0318561_105304771 | 3300031679 | Soil | MPAEQSGQVIGVGKEPTVKGRSFKSQRKAAAFVRWHEPDDARVSRLDL |
| Ga0318561_105841181 | 3300031679 | Soil | VERRGQVTDVESEPTGNRRSSNSRRKAAAFAQWHEPDDARVSS |
| Ga0307477_103789191 | 3300031753 | Hardwood Forest Soil | MPVERRGQVTDVGSEPTGNRRSSNSRREAAVFARWHEPDDARVSRP |
| Ga0318508_12258551 | 3300031780 | Soil | VERRGQVTGVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGL |
| Ga0318547_108934332 | 3300031781 | Soil | MPAERREQVIDVEIEPTGNRMSSMSQWKAAAFMRWHEPDDAR |
| Ga0318552_103018121 | 3300031782 | Soil | MPTERREQVIDVEIEPTGNRTSSMFQRKAAAFIRWHEPDDARVSRPESVSGSG |
| Ga0318523_103862941 | 3300031798 | Soil | VERRGQVTDVGSEPTGNRRSSNSRRKAAAFARWHEPDDTRVSSPDLV |
| Ga0310917_109615562 | 3300031833 | Soil | VERRGQVTDVGSEPTGNRRSFNSRREAAAFVRWHEPDDARVSSPDL |
| Ga0316049_1145042 | 3300031866 | Soil | MLVERRGQVTDVGREPTGNGRSSNSRLKAAAFARWHEPD |
| Ga0310912_111686131 | 3300031941 | Soil | MAVERRGQVTGVEIDRSTGNGRNHWSWRKAAAFTR |
| Ga0306922_100547211 | 3300032001 | Soil | MPVERRGQITDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPDL |
| Ga0318504_101971161 | 3300032063 | Soil | MPVERRGQVTGVEIESTGNRRSSISRRKAAAFKRWHEPEKSRGLRPVL |
| Ga0318553_103259062 | 3300032068 | Soil | VEPRGQVIDVETEPTGNRTSSIFQRKAAAFNRWHEPDKSRG |
| Ga0306924_112205711 | 3300032076 | Soil | VERRGQVTGVEIESTGNRRSSISRRKAAAFKRWHEPEKS |
| Ga0318540_104067322 | 3300032094 | Soil | MPVERRGQVTDVEIESTGNRRSSISRRKAAAFKRWHEPEKSR |
| Ga0310914_100438281 | 3300033289 | Soil | MPVKRRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSSPD |
| Ga0370544_16370_2_133 | 3300034447 | Soil | MEQRGQVTEVGSEPTGDRRSSNSRREAAAFVRWHEPDDARVSSP |
| ⦗Top⦘ |