


| Basic Information | |
|---|---|
| Family ID | F065977 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 96.85 % |
| % of genes from short scaffolds (< 2000 bps) | 90.55 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.268 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.858 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.646 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF08245 | Mur_ligase_M | 62.20 |
| PF01225 | Mur_ligase | 25.98 |
| PF02190 | LON_substr_bdg | 6.30 |
| PF00535 | Glycos_transf_2 | 1.57 |
| PF01680 | SOR_SNZ | 0.79 |
| PF01963 | TraB_PrgY_gumN | 0.79 |
| PF00456 | Transketolase_N | 0.79 |
| PF00534 | Glycos_transf_1 | 0.79 |
| PF01075 | Glyco_transf_9 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 25.98 |
| COG0770 | UDP-N-acetylmuramyl pentapeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 25.98 |
| COG0773 | UDP-N-acetylmuramate-alanine ligase MurC and related ligases, MurC/Mpl family | Cell wall/membrane/envelope biogenesis [M] | 25.98 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.79 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.79 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.79 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.27 % |
| Unclassified | root | N/A | 41.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10414838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005171|Ga0066677_10709604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300005180|Ga0066685_10029001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3411 | Open in IMG/M |
| 3300005444|Ga0070694_100254921 | Not Available | 1329 | Open in IMG/M |
| 3300005458|Ga0070681_11885591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300005529|Ga0070741_10251316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Ectothiorhodospira | 1684 | Open in IMG/M |
| 3300005539|Ga0068853_101521026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300005842|Ga0068858_101391216 | Not Available | 691 | Open in IMG/M |
| 3300005843|Ga0068860_102827952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300006034|Ga0066656_10368147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300006046|Ga0066652_101765479 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006176|Ga0070765_100324095 | Not Available | 1428 | Open in IMG/M |
| 3300006579|Ga0074054_11447824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300006796|Ga0066665_10855760 | Not Available | 710 | Open in IMG/M |
| 3300006893|Ga0073928_10310171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300006904|Ga0075424_100486183 | Not Available | 1318 | Open in IMG/M |
| 3300007255|Ga0099791_10071057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1578 | Open in IMG/M |
| 3300009012|Ga0066710_100058777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4833 | Open in IMG/M |
| 3300009792|Ga0126374_11261252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300009826|Ga0123355_11264908 | Not Available | 745 | Open in IMG/M |
| 3300009826|Ga0123355_11342331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 713 | Open in IMG/M |
| 3300010046|Ga0126384_12005210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300010162|Ga0131853_11348726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300010360|Ga0126372_13039540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300010362|Ga0126377_12248429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300010371|Ga0134125_10377510 | Not Available | 1573 | Open in IMG/M |
| 3300010376|Ga0126381_102344562 | Not Available | 766 | Open in IMG/M |
| 3300012203|Ga0137399_10172136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1743 | Open in IMG/M |
| 3300012362|Ga0137361_10542231 | Not Available | 1067 | Open in IMG/M |
| 3300012685|Ga0137397_10424289 | Not Available | 991 | Open in IMG/M |
| 3300012924|Ga0137413_10205785 | Not Available | 1326 | Open in IMG/M |
| 3300012924|Ga0137413_11606670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300012984|Ga0164309_11595850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300015372|Ga0132256_101978861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300016319|Ga0182033_11362522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300016341|Ga0182035_10317050 | Not Available | 1284 | Open in IMG/M |
| 3300016357|Ga0182032_10684607 | Not Available | 860 | Open in IMG/M |
| 3300016371|Ga0182034_10718807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300016387|Ga0182040_10990552 | Not Available | 700 | Open in IMG/M |
| 3300016404|Ga0182037_12020555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300017947|Ga0187785_10200625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300017970|Ga0187783_10292146 | Not Available | 1189 | Open in IMG/M |
| 3300018060|Ga0187765_10841563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300020022|Ga0193733_1004476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4035 | Open in IMG/M |
| 3300020170|Ga0179594_10308586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300021088|Ga0210404_10682816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300021168|Ga0210406_10146774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1981 | Open in IMG/M |
| 3300021171|Ga0210405_10767224 | Not Available | 741 | Open in IMG/M |
| 3300021377|Ga0213874_10120037 | Not Available | 892 | Open in IMG/M |
| 3300021402|Ga0210385_10746916 | Not Available | 750 | Open in IMG/M |
| 3300021407|Ga0210383_10786485 | Not Available | 815 | Open in IMG/M |
| 3300021432|Ga0210384_10280018 | Not Available | 1501 | Open in IMG/M |
| 3300021477|Ga0210398_10310573 | Not Available | 1286 | Open in IMG/M |
| 3300021477|Ga0210398_11607312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300021559|Ga0210409_11664857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300021560|Ga0126371_13050169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300021560|Ga0126371_13693337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300023079|Ga0247758_1230917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300025905|Ga0207685_10848580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300025915|Ga0207693_11389723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group | 522 | Open in IMG/M |
| 3300025941|Ga0207711_10588349 | Not Available | 1038 | Open in IMG/M |
| 3300025960|Ga0207651_10267324 | Not Available | 1407 | Open in IMG/M |
| 3300025981|Ga0207640_10669881 | Not Available | 886 | Open in IMG/M |
| 3300026116|Ga0207674_12169812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300026285|Ga0209438_1185222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300026295|Ga0209234_1267749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300026325|Ga0209152_10080411 | Not Available | 1198 | Open in IMG/M |
| 3300026547|Ga0209156_10429229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300027480|Ga0208993_1075714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300027546|Ga0208984_1009595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1828 | Open in IMG/M |
| 3300027669|Ga0208981_1175260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300027738|Ga0208989_10176427 | Not Available | 712 | Open in IMG/M |
| 3300027884|Ga0209275_10478780 | Not Available | 708 | Open in IMG/M |
| 3300027889|Ga0209380_10303324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300027895|Ga0209624_10966338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300028047|Ga0209526_10460919 | Not Available | 835 | Open in IMG/M |
| 3300028573|Ga0265334_10320755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300028786|Ga0307517_10403267 | Not Available | 723 | Open in IMG/M |
| 3300028792|Ga0307504_10005277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2679 | Open in IMG/M |
| 3300028794|Ga0307515_10844460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300029943|Ga0311340_10482591 | Not Available | 1113 | Open in IMG/M |
| 3300031544|Ga0318534_10004918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 6244 | Open in IMG/M |
| 3300031561|Ga0318528_10334359 | Not Available | 813 | Open in IMG/M |
| 3300031561|Ga0318528_10504760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300031680|Ga0318574_10421277 | Not Available | 780 | Open in IMG/M |
| 3300031708|Ga0310686_103186054 | Not Available | 685 | Open in IMG/M |
| 3300031720|Ga0307469_11417284 | Not Available | 663 | Open in IMG/M |
| 3300031724|Ga0318500_10566366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300031736|Ga0318501_10297259 | Not Available | 861 | Open in IMG/M |
| 3300031744|Ga0306918_10061684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2537 | Open in IMG/M |
| 3300031747|Ga0318502_10160594 | Not Available | 1286 | Open in IMG/M |
| 3300031751|Ga0318494_10505997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300031763|Ga0318537_10404695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300031764|Ga0318535_10497133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300031765|Ga0318554_10437536 | Not Available | 741 | Open in IMG/M |
| 3300031769|Ga0318526_10003398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4413 | Open in IMG/M |
| 3300031771|Ga0318546_10069085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2250 | Open in IMG/M |
| 3300031771|Ga0318546_10753068 | Not Available | 685 | Open in IMG/M |
| 3300031778|Ga0318498_10004111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5381 | Open in IMG/M |
| 3300031779|Ga0318566_10073288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1656 | Open in IMG/M |
| 3300031781|Ga0318547_10910194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300031782|Ga0318552_10357468 | Not Available | 744 | Open in IMG/M |
| 3300031823|Ga0307478_10382098 | Not Available | 1164 | Open in IMG/M |
| 3300031823|Ga0307478_10706538 | Not Available | 844 | Open in IMG/M |
| 3300031894|Ga0318522_10421618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300031897|Ga0318520_10411789 | Not Available | 827 | Open in IMG/M |
| 3300031912|Ga0306921_11111061 | Not Available | 885 | Open in IMG/M |
| 3300031942|Ga0310916_10963930 | Not Available | 713 | Open in IMG/M |
| 3300031945|Ga0310913_10505667 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031947|Ga0310909_10942160 | Not Available | 707 | Open in IMG/M |
| 3300031954|Ga0306926_11915013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300032008|Ga0318562_10016825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3731 | Open in IMG/M |
| 3300032009|Ga0318563_10333059 | Not Available | 821 | Open in IMG/M |
| 3300032043|Ga0318556_10126691 | Not Available | 1308 | Open in IMG/M |
| 3300032051|Ga0318532_10348750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300032054|Ga0318570_10392878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300032055|Ga0318575_10433587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300032060|Ga0318505_10097860 | Not Available | 1325 | Open in IMG/M |
| 3300032068|Ga0318553_10414705 | Not Available | 705 | Open in IMG/M |
| 3300032091|Ga0318577_10222388 | Not Available | 903 | Open in IMG/M |
| 3300032094|Ga0318540_10379293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300032180|Ga0307471_103912027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300032205|Ga0307472_100906941 | Not Available | 816 | Open in IMG/M |
| 3300032261|Ga0306920_101761322 | Not Available | 875 | Open in IMG/M |
| 3300032828|Ga0335080_10017542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales | 7679 | Open in IMG/M |
| 3300032829|Ga0335070_11693787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.36% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.57% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.79% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023079 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_104148382 | 3300001867 | Forest Soil | IVKAALEWSAGSSVALVILETLAGWLVQSALFPPVKT* |
| Ga0066677_107096042 | 3300005171 | Soil | LLIWVIAVNSHVVKAALEWSSSSSVALVILQTLAGNLLVLALFPTSG* |
| Ga0066685_100290011 | 3300005180 | Soil | LLLIIWLVAASSQIVKAALEWSSPASVVLVILQIFTGRLLVLALFPPVKA* |
| Ga0070694_1002549211 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | IFGIILLIWLIAANSHIVKAALEWSGGASVALVILQILAAELLRRALFPAGQG* |
| Ga0070681_118855911 | 3300005458 | Corn Rhizosphere | FIWIVAANSHIVKAALEWSMAPSVALVILQTLVGELLALTLFQS* |
| Ga0070741_102513161 | 3300005529 | Surface Soil | FAVLVWVIAANSHITKAALEWSMPTSVAVVILQTLTSQLVALSIFPLPPNA* |
| Ga0068853_1015210261 | 3300005539 | Corn Rhizosphere | AANSHIVKAALEWSGGASVALVILQILAAELLRRALFPAGQG* |
| Ga0068858_1013912161 | 3300005842 | Switchgrass Rhizosphere | WVIAANSHVVKAALEWSSAASVFLVILQILAGQLVLFALFPATPT* |
| Ga0068860_1028279521 | 3300005843 | Switchgrass Rhizosphere | AILIWMITANSHIVKAALEWSMPQSVALVILQTLAVNLLVLSLFPIPHS* |
| Ga0066656_103681471 | 3300006034 | Soil | ASLLLLIWLIAAYSQIVKAALEWSSPASVVLAILQVLTGQMLLVALFPSAKA* |
| Ga0066652_1017654792 | 3300006046 | Soil | LIIWLVAASSQIVKAALEWSAPASVVLVILQILTGRLLVFALFPPVKA* |
| Ga0070765_1003240951 | 3300006176 | Soil | IVVVWIIAANSLIVKSALEWSGAASVALVILQFLASVLLSHAVFFAPKG* |
| Ga0074054_114478241 | 3300006579 | Soil | FGIILLIWLIAANSHIVKAALEWSGGASVALVILQILAAELLRRALFPAGQG* |
| Ga0066665_108557602 | 3300006796 | Soil | LVAASSQIVKAALEWSGPASVVLVILQILTGRLLVLALFPPVKA* |
| Ga0073928_103101712 | 3300006893 | Iron-Sulfur Acid Spring | LIWIIAANSHIVKTALEWSMPPSVALVILQTLAGNLLVLALFPIPTSG* |
| Ga0075424_1004861832 | 3300006904 | Populus Rhizosphere | WVIAANSHIVKAALGWSATSSVALVILQTLAGWLLLAALFPAVKA* |
| Ga0099791_100710572 | 3300007255 | Vadose Zone Soil | SQIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA* |
| Ga0066710_1000587771 | 3300009012 | Grasslands Soil | SSQIVKAALEWSSPASVVLVILQIFTGRLLVLALFPPVKA |
| Ga0126374_112612521 | 3300009792 | Tropical Forest Soil | NSHVVKAALEWSATSSVALVILQTLVGWLLQLALLPAVKT* |
| Ga0123355_112649082 | 3300009826 | Termite Gut | VRAALEWSAAPSVALVILQTLASWLVQVALFPPVKA* |
| Ga0123355_113423311 | 3300009826 | Termite Gut | NSHIVRAALEWPAASSVALVILQTLASWLLQFALFPPVKP* |
| Ga0126384_120052101 | 3300010046 | Tropical Forest Soil | LFAWVIAANSHIVKAALDWSATSSVALVILQTLAGWLLLSALFAPVKA* |
| Ga0131853_113487261 | 3300010162 | Termite Gut | WMIAANSYIVRAALEWSATSSVVLVILQAVAGGLLLAALFPPIRA* |
| Ga0126372_130395401 | 3300010360 | Tropical Forest Soil | IAANSQIVKAALEWSMPPSVALVILQTLASNLVVLALFPIPNS* |
| Ga0126377_122484293 | 3300010362 | Tropical Forest Soil | KAALEWSMAQSVALVILQTAAGILLAISLFPIPNS* |
| Ga0134125_103775101 | 3300010371 | Terrestrial Soil | SHIVKAALEWSMPPSVALVILQTLAGNLLVLALFPIPTP* |
| Ga0126381_1023445622 | 3300010376 | Tropical Forest Soil | ANSHVVKAALEWSATSSVALVILQTLAGWLLQLALLPPVKA* |
| Ga0137399_101721361 | 3300012203 | Vadose Zone Soil | LALLIWVIAVNSHVVKAALEWSSSSSVALVILQTLAGNLLVLALFPISTP* |
| Ga0137361_105422312 | 3300012362 | Vadose Zone Soil | CAGLLLIIWLVAANSQIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA* |
| Ga0137397_104242892 | 3300012685 | Vadose Zone Soil | SLALLIWIIAANSHIVKAALEWSMPPSVALVILQTLAGNLLVLALFPISTP* |
| Ga0137413_102057852 | 3300012924 | Vadose Zone Soil | IIAANSHIVKAALEWSMAPSVALVILQTLAGDLLILTLFPSSTS* |
| Ga0137413_116066702 | 3300012924 | Vadose Zone Soil | LLIWIIAANSHIVKAALEWSMPPSVALVILQTLAGNLLVLALFPISTP* |
| Ga0164309_115958501 | 3300012984 | Soil | IVKAALDWSATSSVALVILQTLAGWLLLSALFPPVKA* |
| Ga0132256_1019788612 | 3300015372 | Arabidopsis Rhizosphere | GLLLLFAWVIAANSHIVKAALGWSATSSVALVILQTLAGWLLLWALFPAVKA* |
| Ga0182033_113625221 | 3300016319 | Soil | HIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0182035_103170502 | 3300016341 | Soil | IAANSHVVKAALEWSATSSVALVILQTLAGWLLQLALLPPVKA |
| Ga0182032_106846072 | 3300016357 | Soil | TCAGLLLLVWLIAANSHVVKAALEWSATSSVALVILQTLAGWLLQLAMLPAVKA |
| Ga0182034_107188072 | 3300016371 | Soil | VWLIAANSHVVKAALEWSATSSVALVILETLAGWLLQLALLPPVKA |
| Ga0182040_109905521 | 3300016387 | Soil | IAANSHVVKAALEWSATSSVALVILQTLAGWLLQLAVLPPAKA |
| Ga0182037_120205552 | 3300016404 | Soil | IAANSHVVKAALEWSATSSVALVILQTLVGWMLLFALFPPVKA |
| Ga0187785_102006252 | 3300017947 | Tropical Peatland | AANSHIVRAALEWSAGASVALVILQILAGELLRRGLFPAAAG |
| Ga0187783_102921461 | 3300017970 | Tropical Peatland | NSHVVKAALEWSGSASVALVILQTLVGWLVEFALFPPART |
| Ga0187765_108415632 | 3300018060 | Tropical Peatland | NSYIVKVALEWSVSSSVVLVILETLVGWLLQLALLPPVKT |
| Ga0193733_10044761 | 3300020022 | Soil | QIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0179594_103085861 | 3300020170 | Vadose Zone Soil | IWVIAVNSYVVKAALEWSSSSSVALVILQTLAGNLLVLALFPTPG |
| Ga0210404_106828161 | 3300021088 | Soil | VKAALEWSAASSVALVILQILAGWLLLSALFPQVKA |
| Ga0210406_101467741 | 3300021168 | Soil | LALLIWIITANSHIVKAALEWTMPPSVALVILQTLAGNLLVLALFPIPTS |
| Ga0210405_107672241 | 3300021171 | Soil | VLFGIVLLAWFVAANSHIVKAALEWSLGASVALVILQILAGELLQRALFPITQG |
| Ga0213874_101200372 | 3300021377 | Plant Roots | FAWVIAANSHIVKAALEWSATSSVALVILQTLAGWLLLSALFPAVKA |
| Ga0210385_107469161 | 3300021402 | Soil | TELFGFVVVVWIVAANSLIVKSALELSVAASVALVILQFLASVLLSHAVFSSLQG |
| Ga0210383_107864852 | 3300021407 | Soil | VWIIAANSFIVKSALEWSGGASVALVILQFLASVLLSHAVFSSLQG |
| Ga0210384_102800182 | 3300021432 | Soil | ALAILALAVWLIAANSHIVRAALEWSSAASVALVILQTCSGQLLLLALFPSAKS |
| Ga0210398_103105732 | 3300021477 | Soil | LFIWLIAANSHVVKAALEWSNLASVALVILQFLAEQLVLLGLFPVSTT |
| Ga0210398_116073122 | 3300021477 | Soil | FIWLIAANSHVVKAALEWSNLASVALVIMQFLAEQLVLLGLFPVSTT |
| Ga0210409_116648571 | 3300021559 | Soil | ANSHIVRAALEWSSAASVALVILQTCSGQLLLLALFPSAKS |
| Ga0126371_130501691 | 3300021560 | Tropical Forest Soil | NSHIVKHALDWSTAASVALVILQVVSGELVVLALFPPAAAA |
| Ga0126371_136933372 | 3300021560 | Tropical Forest Soil | IAANSHIVRAALEWSAASSVALVILQTLAGWLLQFALFPPVKA |
| Ga0247758_12309171 | 3300023079 | Plant Litter | MLAWSIAVNSHVVKAALEWSTASSVALVILQVIVMQLVLFSIFPSAR |
| Ga0207685_108485801 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | IWLIAANSHIVKAALEWSGGASVALVILQILAAELLRRALFPAGQG |
| Ga0207693_113897231 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GHIVKAALEWSLGPSVALVLLQILAGELLQRALFPITQG |
| Ga0207711_105883491 | 3300025941 | Switchgrass Rhizosphere | SHIVKAALEWSMAPSVALVILQTLVGELLALTLFQS |
| Ga0207651_102673241 | 3300025960 | Switchgrass Rhizosphere | IAANSHIVKAALEWSGGASVALVILQILAAELLRRALFPAGQG |
| Ga0207640_106698812 | 3300025981 | Corn Rhizosphere | FIWIVAANSHIVKAALEWSMAPSVALVILQTLVGELLALTLFQS |
| Ga0207674_121698122 | 3300026116 | Corn Rhizosphere | NSHVVKSALEWSSTASVFLVILQIVAGQIVLAALFPPPPVAGPTS |
| Ga0209438_11852221 | 3300026285 | Grasslands Soil | ANSQIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0209234_12677491 | 3300026295 | Grasslands Soil | IAAYSQIVKAALEWSSPASVVMVILQTLTGRMLLVALFPSAKA |
| Ga0209152_100804112 | 3300026325 | Soil | IIWLVAASSQIVKAALEWSSPASVVLVILQIFTGRLLVLALFPPVKA |
| Ga0209156_104292292 | 3300026547 | Soil | LIIWLVAASSQIVKAALEWSSPASVVLVILQIFTGRLLVLALFPPVKA |
| Ga0208993_10757141 | 3300027480 | Forest Soil | WIIAANSHIVKAALEWSMPPSVALVILQTLAGNLLVLALFPISTP |
| Ga0208984_10095953 | 3300027546 | Forest Soil | AANSQIVKAALEWSSPASVVLVILQIFTGRVLLFALFPPVKA |
| Ga0208981_11752601 | 3300027669 | Forest Soil | GLLLIIWLVAANSQIVKPALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0208989_101764272 | 3300027738 | Forest Soil | LALLIWIIAANSHIVKAALEWSMPPSVALVILQTLAGNLLVLALFPISTP |
| Ga0209275_104787801 | 3300027884 | Soil | VKSALEWSGGASVALVILQFLASVLLSHAVFSSLQG |
| Ga0209380_103033241 | 3300027889 | Soil | LIGAGLLLIVWLVAANSQIVKAALEWSSPASVVLVILQIFTGRVLLFALFPPVKA |
| Ga0209624_109663382 | 3300027895 | Forest Soil | ANSFIVKSALEWSGGASVALVILQFLASVLLSHAVFSSLQG |
| Ga0209526_104609191 | 3300028047 | Forest Soil | LLLIIWLVAANSQIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0265334_103207552 | 3300028573 | Rhizosphere | LIAANSHVVKSALEWSSTASVFLVILQIVAGQIVLAALFPPPPTAGPTS |
| Ga0307517_104032671 | 3300028786 | Ectomycorrhiza | NSHVVKAALEWSMAPSVALVILQTLAGDILVLTLFHSSTS |
| Ga0307504_100052771 | 3300028792 | Soil | VKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0307515_108444602 | 3300028794 | Ectomycorrhiza | AVNSHVVKAALEWSTASSVALVILQVIVMQLVLFSFFPAAR |
| Ga0311340_104825911 | 3300029943 | Palsa | ANSHIVKSALEWSSTASVALVILQMVFCGLLLLTLFAPTQA |
| Ga0318534_100049188 | 3300031544 | Soil | MCLVLLLFAWVIAANSYIVRAALEWSVTSSVVLVILQAVAGGLLLAALFPPIRA |
| Ga0318528_103343591 | 3300031561 | Soil | IVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318528_105047602 | 3300031561 | Soil | RAALEWSATSSVVLVILQEVTGGLLLFALFPPLKA |
| Ga0310915_105515131 | 3300031573 | Soil | TCAGLLLFVWLVAANSHIVRAALEWSATSSVALVILQTLAGWLLQLAMLPAVKA |
| Ga0318574_104212772 | 3300031680 | Soil | VWLVAANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0310686_1031860542 | 3300031708 | Soil | VKAALEWSSPASVVLVILQIFTGRLVVFALFPPVKA |
| Ga0307469_114172841 | 3300031720 | Hardwood Forest Soil | ANSHVVKAALEWSSAASVFLVILQILAGQLVLFALFPVTTT |
| Ga0318500_105663661 | 3300031724 | Soil | IVKAALDWSATSSVALVILQTLAGWLVLSALFPPVKA |
| Ga0318501_102972591 | 3300031736 | Soil | LFVWLVAANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0306918_100616844 | 3300031744 | Soil | GLLLFVWLVAANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318502_101605942 | 3300031747 | Soil | VIAANSYIVRSALDWSATSSVALVILETLAGWLLQIALFAPVKA |
| Ga0318494_105059971 | 3300031751 | Soil | CAGLLLFVWLIAINSHVVKAALEWSATSSVALVILQTLAGWLLQFALFPPVKA |
| Ga0318537_104046951 | 3300031763 | Soil | VIAANSYIVRAALEWSVTSSVVLVILQAVAGGLLLAALFPPIRA |
| Ga0318535_104971331 | 3300031764 | Soil | CVVLLLFAWVNAANSYIVRAALEWSVTSSVVLVILQAVAGGLLLAALFPPIRA |
| Ga0318554_104375362 | 3300031765 | Soil | ILKAALEWSATSSVALVILETLAGWLLQVALFVPVKA |
| Ga0318526_100033986 | 3300031769 | Soil | LAWMIAANSYIVRAALEWSATSSVVLVILQEVTGGLLLFALFPPLKA |
| Ga0318546_100690851 | 3300031771 | Soil | NSHVVKAALEWSATSSVALVILQTLAGWLLQLALLPPVKA |
| Ga0318546_107530681 | 3300031771 | Soil | NRHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318498_100041111 | 3300031778 | Soil | LIAANSHVVKAALEWSATSSVALVILQTLAGWLLQLALLPPVKA |
| Ga0318566_100732881 | 3300031779 | Soil | TCAGLLLFVWLVAANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318547_109101942 | 3300031781 | Soil | ANSHIVRAALEWSAASSVALVILQTLASGLLQIALFPPVKP |
| Ga0318552_103574681 | 3300031782 | Soil | VAGLSLVIWLIAANTHVVKAALEWSSITSVALVILQVLVGEVLQIALFPPGPA |
| Ga0307478_103820982 | 3300031823 | Hardwood Forest Soil | WLIAANGHVVKAALDWSSATSVTLVILQIVAGQLLLFALFPPNG |
| Ga0307478_107065381 | 3300031823 | Hardwood Forest Soil | PIFVVSMALLIWTIAANSHIVKAALEWSMPPSVVLVVVQTLADWRLATALFPVPTTG |
| Ga0318522_104216181 | 3300031894 | Soil | LLFAWVIAANSHIVKAALDWSATSSVALVILQTLAGWLVLSALFPPVKA |
| Ga0318520_104117891 | 3300031897 | Soil | HIVKAALDWSATSSVALVILQTLAGWLVLSALFPPVKA |
| Ga0306921_111110611 | 3300031912 | Soil | FVWLVAANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0310916_109639301 | 3300031942 | Soil | LVWLIAANSHVVKAALEWSATSSVALVILQTLAGWLLQLAVLPPAKA |
| Ga0310913_105056671 | 3300031945 | Soil | LLLLAWMIAANSYIVRAALEWSATSSVVLVILQEVTGGLLLFALFPPLKA |
| Ga0310909_109421602 | 3300031947 | Soil | SHIVKAALDWSATSSVALVILQTLAGWLVLSALFPPVKA |
| Ga0306926_119150132 | 3300031954 | Soil | SHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318562_100168251 | 3300032008 | Soil | ANSHVVKAALEWSATSSVALVILQTLAGWLLQLALLPPVKA |
| Ga0318563_103330591 | 3300032009 | Soil | IAANSHIVKAALDWSATSSVALVILQTLAGWLVLSALFPPVKA |
| Ga0318556_101266911 | 3300032043 | Soil | NSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318532_103487502 | 3300032051 | Soil | ANSHIVKAALDWSATSSVALVILQTLAGWLVLSALFPPVKA |
| Ga0318570_103928781 | 3300032054 | Soil | NSYIVRAALEWSVTSSVVLVILQAVAGGLLLAALFPPIRA |
| Ga0318575_104335871 | 3300032055 | Soil | AANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318505_100978602 | 3300032060 | Soil | VAANSHIVKAALEWSATSSVALVILQTLAGWLLQFALFPPVNS |
| Ga0318553_104147052 | 3300032068 | Soil | YIVRAALEWSVTSSVVLVILQAVAGGLLLAALFPPIRA |
| Ga0318577_102223881 | 3300032091 | Soil | NSHVVKAALEWSATSSVALVILQTLAGWLLQLAMLPAVKA |
| Ga0318540_103792931 | 3300032094 | Soil | AANSYIVRAALEWSATSSVVLVILQEVTGGLLLFALFPPLKA |
| Ga0307471_1039120271 | 3300032180 | Hardwood Forest Soil | GLLLIIWLVAANSQIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0307472_1009069411 | 3300032205 | Hardwood Forest Soil | VAANSQIVKAALEWSSPASVVLVILQIFTGRLLLFALFPPVKA |
| Ga0306920_1017613222 | 3300032261 | Soil | LLLFAWVIAANSYIVRSALDWSATSSVALVILETLAGWLLQIALFAPVKA |
| Ga0335080_100175428 | 3300032828 | Soil | YVVKAALDWSSASSVALVILQIVAAQLLVFALFPAGPA |
| Ga0335070_116937872 | 3300032829 | Soil | LLAWLIAANSHIVKSALEWSGPASVALVILQMLASWMVVAALFPPAKV |
| ⦗Top⦘ |