


| Basic Information | |
|---|---|
| Family ID | F065965 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVVLLL |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 62.20 % |
| % of genes near scaffold ends (potentially truncated) | 33.86 % |
| % of genes from short scaffolds (< 2000 bps) | 81.89 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.118 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.685 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.307 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.205 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 2.94% Coil/Unstructured: 54.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00425 | Chorismate_bind | 13.39 |
| PF04715 | Anth_synt_I_N | 4.72 |
| PF03466 | LysR_substrate | 3.94 |
| PF01321 | Creatinase_N | 2.36 |
| PF00496 | SBP_bac_5 | 1.57 |
| PF13624 | SurA_N_3 | 1.57 |
| PF08811 | DUF1800 | 0.79 |
| PF04392 | ABC_sub_bind | 0.79 |
| PF05378 | Hydant_A_N | 0.79 |
| PF13379 | NMT1_2 | 0.79 |
| PF13592 | HTH_33 | 0.79 |
| PF02538 | Hydantoinase_B | 0.79 |
| PF00175 | NAD_binding_1 | 0.79 |
| PF04055 | Radical_SAM | 0.79 |
| PF03776 | MinE | 0.79 |
| PF01757 | Acyl_transf_3 | 0.79 |
| PF04355 | SmpA_OmlA | 0.79 |
| PF08874 | DUF1835 | 0.79 |
| PF04892 | VanZ | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 9.45 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 2.36 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.57 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.57 |
| COG0851 | Septum formation topological specificity factor MinE | Cell cycle control, cell division, chromosome partitioning [D] | 0.79 |
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.79 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.12 % |
| All Organisms | root | All Organisms | 44.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10145708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
| 3300004633|Ga0066395_10000007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 57657 | Open in IMG/M |
| 3300004633|Ga0066395_10082817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1507 | Open in IMG/M |
| 3300005332|Ga0066388_100369789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 2080 | Open in IMG/M |
| 3300005332|Ga0066388_101536666 | Not Available | 1167 | Open in IMG/M |
| 3300005332|Ga0066388_103410659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300005332|Ga0066388_104264790 | Not Available | 729 | Open in IMG/M |
| 3300005332|Ga0066388_104325910 | Not Available | 724 | Open in IMG/M |
| 3300005531|Ga0070738_10001038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 65333 | Open in IMG/M |
| 3300005533|Ga0070734_10004752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12630 | Open in IMG/M |
| 3300005713|Ga0066905_100138517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1732 | Open in IMG/M |
| 3300005764|Ga0066903_100127860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3560 | Open in IMG/M |
| 3300005764|Ga0066903_101292145 | Not Available | 1362 | Open in IMG/M |
| 3300006047|Ga0075024_100056693 | Not Available | 1646 | Open in IMG/M |
| 3300006047|Ga0075024_100104314 | Not Available | 1247 | Open in IMG/M |
| 3300006052|Ga0075029_100848885 | Not Available | 624 | Open in IMG/M |
| 3300006057|Ga0075026_100239836 | Not Available | 969 | Open in IMG/M |
| 3300006086|Ga0075019_10185331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1227 | Open in IMG/M |
| 3300006176|Ga0070765_101089201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
| 3300007255|Ga0099791_10307225 | Not Available | 757 | Open in IMG/M |
| 3300007258|Ga0099793_10245025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 864 | Open in IMG/M |
| 3300007258|Ga0099793_10460871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300009038|Ga0099829_10621268 | Not Available | 898 | Open in IMG/M |
| 3300009088|Ga0099830_10105081 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300009089|Ga0099828_11094495 | Not Available | 708 | Open in IMG/M |
| 3300009143|Ga0099792_10264484 | Not Available | 1007 | Open in IMG/M |
| 3300009143|Ga0099792_10316652 | Not Available | 931 | Open in IMG/M |
| 3300009523|Ga0116221_1093243 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300009764|Ga0116134_1068600 | Not Available | 1320 | Open in IMG/M |
| 3300009792|Ga0126374_10124097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1516 | Open in IMG/M |
| 3300009792|Ga0126374_10831463 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009792|Ga0126374_10916342 | Not Available | 680 | Open in IMG/M |
| 3300010043|Ga0126380_10060061 | Not Available | 2103 | Open in IMG/M |
| 3300010043|Ga0126380_11141985 | Not Available | 667 | Open in IMG/M |
| 3300010046|Ga0126384_11002892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300010046|Ga0126384_12388129 | Not Available | 512 | Open in IMG/M |
| 3300010047|Ga0126382_12410594 | Not Available | 511 | Open in IMG/M |
| 3300010049|Ga0123356_13729795 | Not Available | 527 | Open in IMG/M |
| 3300010358|Ga0126370_10664192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
| 3300010359|Ga0126376_11639842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300010361|Ga0126378_10082647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3116 | Open in IMG/M |
| 3300010361|Ga0126378_10218205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1990 | Open in IMG/M |
| 3300010361|Ga0126378_10496025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1336 | Open in IMG/M |
| 3300010362|Ga0126377_12625877 | Not Available | 579 | Open in IMG/M |
| 3300010366|Ga0126379_11012744 | Not Available | 936 | Open in IMG/M |
| 3300010376|Ga0126381_103184072 | Not Available | 649 | Open in IMG/M |
| 3300010398|Ga0126383_11614650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300011120|Ga0150983_10875386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1271 | Open in IMG/M |
| 3300011120|Ga0150983_12730852 | Not Available | 593 | Open in IMG/M |
| 3300011120|Ga0150983_12985479 | Not Available | 859 | Open in IMG/M |
| 3300011120|Ga0150983_13386642 | Not Available | 799 | Open in IMG/M |
| 3300011120|Ga0150983_15241416 | Not Available | 929 | Open in IMG/M |
| 3300011269|Ga0137392_11080189 | Not Available | 658 | Open in IMG/M |
| 3300011271|Ga0137393_11688446 | Not Available | 522 | Open in IMG/M |
| 3300012189|Ga0137388_10490277 | Not Available | 1141 | Open in IMG/M |
| 3300012189|Ga0137388_11696128 | Not Available | 566 | Open in IMG/M |
| 3300012205|Ga0137362_10030471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4268 | Open in IMG/M |
| 3300012211|Ga0137377_10029453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4959 | Open in IMG/M |
| 3300012361|Ga0137360_10209793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis | 1581 | Open in IMG/M |
| 3300012361|Ga0137360_10363855 | Not Available | 1213 | Open in IMG/M |
| 3300012362|Ga0137361_10921378 | Not Available | 792 | Open in IMG/M |
| 3300012930|Ga0137407_11972884 | Not Available | 557 | Open in IMG/M |
| 3300012971|Ga0126369_10006524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8693 | Open in IMG/M |
| 3300012971|Ga0126369_10447948 | Not Available | 1339 | Open in IMG/M |
| 3300014164|Ga0181532_10165616 | Not Available | 1318 | Open in IMG/M |
| 3300016319|Ga0182033_11644531 | Not Available | 581 | Open in IMG/M |
| 3300017932|Ga0187814_10362913 | Not Available | 560 | Open in IMG/M |
| 3300017961|Ga0187778_11185377 | Not Available | 534 | Open in IMG/M |
| 3300017970|Ga0187783_10094912 | Not Available | 2198 | Open in IMG/M |
| 3300017970|Ga0187783_10677996 | Not Available | 744 | Open in IMG/M |
| 3300017972|Ga0187781_10900323 | Not Available | 644 | Open in IMG/M |
| 3300019258|Ga0181504_1041021 | Not Available | 698 | Open in IMG/M |
| 3300020170|Ga0179594_10379627 | Not Available | 536 | Open in IMG/M |
| 3300020581|Ga0210399_10218537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1587 | Open in IMG/M |
| 3300021086|Ga0179596_10013587 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300021086|Ga0179596_10701567 | Not Available | 512 | Open in IMG/M |
| 3300021170|Ga0210400_10411019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
| 3300021178|Ga0210408_10236996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1453 | Open in IMG/M |
| 3300021404|Ga0210389_10175717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1666 | Open in IMG/M |
| 3300021420|Ga0210394_10984791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300021476|Ga0187846_10027749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 2586 | Open in IMG/M |
| 3300021560|Ga0126371_10918282 | Not Available | 1019 | Open in IMG/M |
| 3300021560|Ga0126371_12114212 | Not Available | 678 | Open in IMG/M |
| 3300022504|Ga0242642_1082329 | Not Available | 543 | Open in IMG/M |
| 3300022507|Ga0222729_1048311 | Not Available | 583 | Open in IMG/M |
| 3300022530|Ga0242658_1042486 | Not Available | 931 | Open in IMG/M |
| 3300022533|Ga0242662_10250678 | Not Available | 575 | Open in IMG/M |
| 3300022709|Ga0222756_1012600 | Not Available | 992 | Open in IMG/M |
| 3300022711|Ga0242674_1044405 | Not Available | 595 | Open in IMG/M |
| 3300022715|Ga0242678_1074009 | Not Available | 532 | Open in IMG/M |
| 3300022716|Ga0242673_1056448 | Not Available | 674 | Open in IMG/M |
| 3300022722|Ga0242657_1233714 | Not Available | 521 | Open in IMG/M |
| 3300022724|Ga0242665_10327584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300022726|Ga0242654_10173480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300022726|Ga0242654_10280393 | Not Available | 607 | Open in IMG/M |
| 3300026304|Ga0209240_1029345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2100 | Open in IMG/M |
| 3300026320|Ga0209131_1156160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1145 | Open in IMG/M |
| 3300026355|Ga0257149_1001687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2262 | Open in IMG/M |
| 3300026489|Ga0257160_1006005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis | 1575 | Open in IMG/M |
| 3300026494|Ga0257159_1049186 | Not Available | 715 | Open in IMG/M |
| 3300026497|Ga0257164_1093552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300027635|Ga0209625_1042438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1016 | Open in IMG/M |
| 3300027773|Ga0209810_1003994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 14729 | Open in IMG/M |
| 3300027826|Ga0209060_10007983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6782 | Open in IMG/M |
| 3300027862|Ga0209701_10233139 | Not Available | 1083 | Open in IMG/M |
| 3300027874|Ga0209465_10000355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 21791 | Open in IMG/M |
| 3300027898|Ga0209067_10421820 | Not Available | 749 | Open in IMG/M |
| 3300027903|Ga0209488_10099091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2183 | Open in IMG/M |
| 3300027903|Ga0209488_10168780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1653 | Open in IMG/M |
| 3300027905|Ga0209415_10045851 | All Organisms → cellular organisms → Bacteria | 5765 | Open in IMG/M |
| 3300027915|Ga0209069_10087831 | Not Available | 1490 | Open in IMG/M |
| 3300028536|Ga0137415_10010295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9276 | Open in IMG/M |
| 3300029701|Ga0222748_1019455 | Not Available | 976 | Open in IMG/M |
| 3300030730|Ga0307482_1120377 | Not Available | 738 | Open in IMG/M |
| 3300031057|Ga0170834_104143515 | Not Available | 555 | Open in IMG/M |
| 3300031561|Ga0318528_10161824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis | 1194 | Open in IMG/M |
| 3300031572|Ga0318515_10651610 | Not Available | 558 | Open in IMG/M |
| 3300031718|Ga0307474_11275043 | Not Available | 580 | Open in IMG/M |
| 3300031719|Ga0306917_10328211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1186 | Open in IMG/M |
| 3300031720|Ga0307469_10011118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4424 | Open in IMG/M |
| 3300031740|Ga0307468_102264224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens | 527 | Open in IMG/M |
| 3300031823|Ga0307478_11805124 | Not Available | 503 | Open in IMG/M |
| 3300031890|Ga0306925_11201254 | Not Available | 760 | Open in IMG/M |
| 3300032089|Ga0318525_10475393 | Not Available | 640 | Open in IMG/M |
| 3300032205|Ga0307472_100330475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1241 | Open in IMG/M |
| 3300032515|Ga0348332_10794076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 651 | Open in IMG/M |
| 3300032515|Ga0348332_12108067 | Not Available | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.15% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.57% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.79% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.79% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.79% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_101457082 | 3300002914 | Grasslands Soil | MSRNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI* |
| Ga0066395_1000000737 | 3300004633 | Tropical Forest Soil | MSQNVYLRITADGRFFGLNSGDWTVLVGGFVLVALMILLL* |
| Ga0066395_100828173 | 3300004633 | Tropical Forest Soil | MSPNMHLRITADGRLFGLNSGDWTVLLGGFALVALVILLL* |
| Ga0066388_1003697893 | 3300005332 | Tropical Forest Soil | MSSNVYLRITSEGRLFGLNSGDWMMLLGGFALVALVVLLL* |
| Ga0066388_1015366661 | 3300005332 | Tropical Forest Soil | MSQNVGLRITAERRLFGLDSGDWTMLVGGFALVALVILVLS* |
| Ga0066388_1034106591 | 3300005332 | Tropical Forest Soil | NMSRNVGLRITAEGRLFGLNSGDWMMLLGGFALAAAAVLLL* |
| Ga0066388_1042647901 | 3300005332 | Tropical Forest Soil | MSPNVYLRIAAERRLFGLTSGDWTLLVGGYALIALMVLLL* |
| Ga0066388_1043259102 | 3300005332 | Tropical Forest Soil | MSRNVGLRITADGRLFGLNSGDWTVLVGGFALVTLVILLL* |
| Ga0070738_1000103849 | 3300005531 | Surface Soil | MSPNVDLRVMAEGRLLGLNSGDWLMLAGGFALVALLIFLL* |
| Ga0070734_100047525 | 3300005533 | Surface Soil | MSQNVYLRIAAEGRLFGLSPGDWTILVGGFALVALLVLLL* |
| Ga0066905_1001385172 | 3300005713 | Tropical Forest Soil | MSQNIGFRITPEGRLLGLNSGDWMLLVGGFAAVALVVLLI* |
| Ga0066903_1001278604 | 3300005764 | Tropical Forest Soil | MSPNVYLRITSEGRLFGLNSGDWMVLLGGFALVALVVLLL* |
| Ga0066903_1012921453 | 3300005764 | Tropical Forest Soil | VSNGLDQGTHMSRNVGLRITAEGRLFGLNSGDWMMLASGFALVAAIVLLL* |
| Ga0075024_1000566932 | 3300006047 | Watersheds | MLQNVYGSMTAEGRLFGLNSGDWTMLLGGFALVALVALLL* |
| Ga0075024_1001043143 | 3300006047 | Watersheds | MSVRFDQGTLMSQNVYLRITAEGRLFGLNSGDWTLLFGGFALVALLVMLL* |
| Ga0075029_1008488851 | 3300006052 | Watersheds | SQNVYLRITAEGRLFGLSPGDWTILIGGFALVALVVLLL* |
| Ga0075026_1002398362 | 3300006057 | Watersheds | VATPMSVRFDQGTLMSQNVYLRITAERRLFGLNSGDWTLLFGGFALVALLVMLL* |
| Ga0075019_101853311 | 3300006086 | Watersheds | MSQNVYLRITAEGRLFGLSPGDWTILIGGFALVALVVLLL* |
| Ga0070765_1010892013 | 3300006176 | Soil | MYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL* |
| Ga0099791_103072252 | 3300007255 | Vadose Zone Soil | MVLDQGTHMSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI* |
| Ga0099793_102450252 | 3300007258 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI* |
| Ga0099793_104608711 | 3300007258 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV* |
| Ga0099829_106212682 | 3300009038 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVILLL* |
| Ga0099830_101050812 | 3300009088 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVILLV* |
| Ga0099828_110944952 | 3300009089 | Vadose Zone Soil | MSQNAGLRITAEGRLFGLDSGDWTMLFGGFALVALVVLLV* |
| Ga0099792_102644841 | 3300009143 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVVLL |
| Ga0099792_103166521 | 3300009143 | Vadose Zone Soil | QGTHMSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV* |
| Ga0116221_10932433 | 3300009523 | Peatlands Soil | GRMTAEGRLLGLSPGDWSMLIGGFVLVALVVLLL* |
| Ga0116134_10686001 | 3300009764 | Peatland | MSLNLYARMTAERRLYGLNPGDWTVLLGGVALVALVVFLL* |
| Ga0126374_101240973 | 3300009792 | Tropical Forest Soil | MSQNVGLRITAEGRLFGLDSGDWTMLVGGFAFVALVILLI* |
| Ga0126374_108314631 | 3300009792 | Tropical Forest Soil | MSHNVYLRITADGRFFGLNSGDWTVLVGGFVLLALVILLL* |
| Ga0126374_109163421 | 3300009792 | Tropical Forest Soil | MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV* |
| Ga0126380_100600611 | 3300010043 | Tropical Forest Soil | IGFRITPEGRLLGLNSGDWMLLVGGFAAVALVVLLI* |
| Ga0126380_111419851 | 3300010043 | Tropical Forest Soil | MSQNVYLRFAAEGRLFGLTSGDWTVLVGGFALVALMIFL |
| Ga0126384_110028921 | 3300010046 | Tropical Forest Soil | MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI* |
| Ga0126384_123881292 | 3300010046 | Tropical Forest Soil | MSQNVYLRTAAERRLFGLTCGDWTVLVGGFALITLVILLL* |
| Ga0126382_124105941 | 3300010047 | Tropical Forest Soil | TMSRNAGLRIAAEGRLFGLNSGDWMMLAGGFALAAAVVLLL* |
| Ga0123356_137297951 | 3300010049 | Termite Gut | MGRNGDLRITTEGRLLGLNSGDWLILVGGFALAALVVLLL* |
| Ga0126370_106641922 | 3300010358 | Tropical Forest Soil | MSQNVHLRIVADGRFFGLTAGDWTVLVGGFGLVALVVLLL* |
| Ga0126376_116398422 | 3300010359 | Tropical Forest Soil | MSQNVHLRIIVADGRFFGLTAGDWTVLVGGFGLVALVVLLL* |
| Ga0126378_100826472 | 3300010361 | Tropical Forest Soil | MHLRITADGRLFGLNSGDWTVLLGGFALVALVILLL* |
| Ga0126378_102182053 | 3300010361 | Tropical Forest Soil | MSRNVGLRITAEGRLFGLNSGDWMMLLGGFALAAAAVLLL* |
| Ga0126378_104960252 | 3300010361 | Tropical Forest Soil | MSQNVYLRFAAEGRLFGLTSGDWTVLVGGFALVALMIFLL* |
| Ga0126377_126258771 | 3300010362 | Tropical Forest Soil | MYLRTAVERRLFGLTSGDWTVLVGGFALITLVILLL* |
| Ga0126379_110127441 | 3300010366 | Tropical Forest Soil | MSRNVGLRITAEGRLFGLNSGDWMMLVCGFALAAAAVL |
| Ga0126381_1031840721 | 3300010376 | Tropical Forest Soil | MSRNVGLRITAEGRLFGLNSGDWMMLASGFALVAAIVLLL* |
| Ga0126383_116146501 | 3300010398 | Tropical Forest Soil | MSQNVHLRIVADGRFFGLTAGDWTVLVGGFGLVTLMVLLL* |
| Ga0150983_108753861 | 3300011120 | Forest Soil | MYQSVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL* |
| Ga0150983_127308521 | 3300011120 | Forest Soil | GASMYQNVFGRITAEGRLLGLNPGDWSMLIGGFVLVALVVLLL* |
| Ga0150983_129854791 | 3300011120 | Forest Soil | QNVFGRITAEGRLLGLNPGDWSMLIGGFVLVALVVLLL* |
| Ga0150983_133866421 | 3300011120 | Forest Soil | QKGAVMYQSVFGRMTAEGRLLGLNPGDWSLLIGGFVLVALVVLLL* |
| Ga0150983_152414162 | 3300011120 | Forest Soil | SQKGASMYQSVFGRMTAEGRLLGLNPGDWSLLIGGFVLVVLVVLLL* |
| Ga0137392_110801892 | 3300011269 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALV |
| Ga0137393_116884461 | 3300011271 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVVLLV* |
| Ga0137388_104902772 | 3300012189 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVILLV* |
| Ga0137388_116961281 | 3300012189 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWTMLVGGFVFVALVVLLV* |
| Ga0137362_100304711 | 3300012205 | Vadose Zone Soil | QNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI* |
| Ga0137377_100294533 | 3300012211 | Vadose Zone Soil | MGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV* |
| Ga0137360_102097932 | 3300012361 | Vadose Zone Soil | SQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI* |
| Ga0137360_103638551 | 3300012361 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALV |
| Ga0137361_109213782 | 3300012362 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALIILLI* |
| Ga0137407_119728841 | 3300012930 | Vadose Zone Soil | MYQSVFGRMTAEGRLLGLNPGDWSLLIGGFVLVALVALLL* |
| Ga0126369_100065241 | 3300012971 | Tropical Forest Soil | LRITADGRLFGLNSGDWTVLLGGFALVALVILLL* |
| Ga0126369_104479483 | 3300012971 | Tropical Forest Soil | MSQNIGFHITPEGRLLGLNSGDWMLLVGGFAVVALVVLLI* |
| Ga0181532_101656161 | 3300014164 | Bog | MSLNLYARMTAERRLFGLNPGDWTVLLGGVALVALVVFLL* |
| Ga0182033_116445311 | 3300016319 | Soil | MSFDQETLMSPNVHLRITAEGRLLGLNSGDWTLLLGGFALIALMLLLL |
| Ga0187814_103629131 | 3300017932 | Freshwater Sediment | MLPNVDLRITAEGRLLGLNSGDWMLLVGGFALVALVIFLL |
| Ga0187778_111853771 | 3300017961 | Tropical Peatland | MHMSPNVDLRITAEGRLLGLNSGDWMMLVGGFALVALVIFVL |
| Ga0187783_100949122 | 3300017970 | Tropical Peatland | MSQNVGLRITAEGRLFGLDSGDWMVLIGGFALVALVVLVL |
| Ga0187783_106779961 | 3300017970 | Tropical Peatland | MSPNVDLRITAEGRLLGLNSGDWMMLVGGFALVALVILLL |
| Ga0187781_109003231 | 3300017972 | Tropical Peatland | MSQNVGLRITAEGRLFGLDSGDWMVLIGGFALVALVVLLL |
| Ga0181504_10410211 | 3300019258 | Peatland | MSLNLYARMTAERRLFGLNPGDWTVLLGGVALVALVVFLL |
| Ga0179594_103796271 | 3300020170 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI |
| Ga0210399_102185373 | 3300020581 | Soil | MSQNVYLRITADGRFFGLNTGDWTILVGGFGLAALVVLLL |
| Ga0179596_100135873 | 3300021086 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV |
| Ga0179596_107015671 | 3300021086 | Vadose Zone Soil | MSQNVYLRITADGRFFGLNSGDWMMLLGGFALIALVVLLL |
| Ga0210400_104110193 | 3300021170 | Soil | RGTPMPQNVYLRITADGRFFGLNTGDWTILVGGFGLAALVVLLL |
| Ga0210408_102369962 | 3300021178 | Soil | MSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVILLL |
| Ga0210389_101757172 | 3300021404 | Soil | MSRNGELPMAEGRLLGLNSGDWMIIVGGFALVALIVLLL |
| Ga0210394_109847912 | 3300021420 | Soil | GALMDQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL |
| Ga0187846_100277493 | 3300021476 | Biofilm | MSQNVGLRLTADGRLLGLNSGDWMLLVGGFAVVALIVLLV |
| Ga0126371_109182822 | 3300021560 | Tropical Forest Soil | MHLRITADGRLFGLNSGDWTVLLGGFALVALVILLL |
| Ga0126371_121142122 | 3300021560 | Tropical Forest Soil | MSQNVYLRITADGRFFGLNSGDWTVLVGGFVLVALMILLL |
| Ga0242642_10823292 | 3300022504 | Soil | SMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVVLVVLLL |
| Ga0222729_10483111 | 3300022507 | Soil | SMYQNVFGRITAEGRLLGLNPGDWPMLIGGFVLVALVVLLL |
| Ga0242658_10424861 | 3300022530 | Soil | KGALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL |
| Ga0242662_102506782 | 3300022533 | Soil | LMYQNVFGRMTAEGRLLGLNPGDWSMLIGGMVLVVLVVLLL |
| Ga0222756_10126002 | 3300022709 | Soil | ALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL |
| Ga0242674_10444051 | 3300022711 | Soil | NVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL |
| Ga0242678_10740091 | 3300022715 | Soil | SMYQSVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL |
| Ga0242673_10564482 | 3300022716 | Soil | GALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL |
| Ga0242657_12337141 | 3300022722 | Soil | YQNVFGRITAEGRLLGLNPGDWSMLIGGFVLVALVVLLL |
| Ga0242665_103275842 | 3300022724 | Soil | GTLMSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVVLLL |
| Ga0242654_101734801 | 3300022726 | Soil | RGTPMSQNVYLRITADGRFFGLNTGDWTILVGGFGLAALVVLLL |
| Ga0242654_102803931 | 3300022726 | Soil | QGTHMSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV |
| Ga0209240_10293453 | 3300026304 | Grasslands Soil | MSRNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI |
| Ga0209131_11561601 | 3300026320 | Grasslands Soil | GTHMSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV |
| Ga0257149_10016873 | 3300026355 | Soil | MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVVLLV |
| Ga0257160_10060053 | 3300026489 | Soil | THMSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVILLV |
| Ga0257159_10491861 | 3300026494 | Soil | MSQNVYLRITAEGRLFGLNSGDWMMLVGGFALVALVVLLV |
| Ga0257164_10935522 | 3300026497 | Soil | DGLDQGTHMSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV |
| Ga0209625_10424382 | 3300027635 | Forest Soil | MSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVVLLL |
| Ga0209810_10039944 | 3300027773 | Surface Soil | MSPNVDLRVMAEGRLLGLNSGDWLMLAGGFALVALLIFLL |
| Ga0209060_100079833 | 3300027826 | Surface Soil | MSQNVYLRIAAEGRLFGLSPGDWTILVGGFALVALLVLLL |
| Ga0209701_102331391 | 3300027862 | Vadose Zone Soil | MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVILLV |
| Ga0209465_1000035513 | 3300027874 | Tropical Forest Soil | MSQNIGFHITPEGRLLGLNSGDWMLLVGGFAVVALVVLLI |
| Ga0209067_104218201 | 3300027898 | Watersheds | MSQNVYLRITAEGRLFGLSPGDWTILIGGFALVALVVLLL |
| Ga0209488_100990912 | 3300027903 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVILLV |
| Ga0209488_101687802 | 3300027903 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV |
| Ga0209415_100458514 | 3300027905 | Peatlands Soil | MYQNVFGRMTAEGRLLGLSPGDWSMLIGGFVLVALVVLLL |
| Ga0209069_100878312 | 3300027915 | Watersheds | MSVRFDQGTLMSQNVYLRITAEGRLFGLNSGDWTLLFGGFALVALLVMLL |
| Ga0137415_100102954 | 3300028536 | Vadose Zone Soil | MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLV |
| Ga0222748_10194552 | 3300029701 | Soil | PMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVVLVVLLL |
| Ga0307482_11203772 | 3300030730 | Hardwood Forest Soil | GASMYQNVFGRITAEGRLLGLNPGDWSILIGGFVLVALVVLLL |
| Ga0170834_1041435152 | 3300031057 | Forest Soil | MYQNAFGRMTAEGRLLGLSPGDWTVLIGGVVLVALIVLLL |
| Ga0318528_101618241 | 3300031561 | Soil | NDGFEQGTHMSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI |
| Ga0318515_106516101 | 3300031572 | Soil | MSPNVYLRITSEGRLFGLNSGDWMVLVSGFALVALVVLLL |
| Ga0307474_112750432 | 3300031718 | Hardwood Forest Soil | MSRNGDLPIMAEGRLLGLNSGDWMMLVGGFALVALVVLLL |
| Ga0306917_103282111 | 3300031719 | Soil | MSPNVYLRITSEGRLFGLNSGDWMMLLGGFALVALVVLLL |
| Ga0307469_100111184 | 3300031720 | Hardwood Forest Soil | MPENMYLRTAVERRLFGLTSGDWTVLVGGFALITLVILLL |
| Ga0307468_1022642242 | 3300031740 | Hardwood Forest Soil | LMPENMYLRTAAERRLFGLTSGDWTVLVGGFALITLVILLL |
| Ga0307478_118051241 | 3300031823 | Hardwood Forest Soil | MYQNVFGRITAEGRLLGLNPGDWSILIGGFVLVALVVLLL |
| Ga0306925_112012542 | 3300031890 | Soil | MSFDQETLMSPNVHLRITAEGRLLGLNSGDWTLLLGGFALIALMLLVL |
| Ga0318525_104753931 | 3300032089 | Soil | MSQNVGLRITAEGRLFGLDSGDWIVLVGGFALVALVILLI |
| Ga0307472_1003304752 | 3300032205 | Hardwood Forest Soil | MGFDRGTLMPENMYLRTAVERRLFGLTSGDWTVLVGGFALITLVILLL |
| Ga0348332_107940762 | 3300032515 | Plant Litter | MSQNMFGRMAAEGRLFGLNPGDWSVLLGGFALVALVVLLI |
| Ga0348332_121080672 | 3300032515 | Plant Litter | GALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL |
| ⦗Top⦘ |