


| Basic Information | |
|---|---|
| Family ID | F065916 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.76 % |
| % of genes near scaffold ends (potentially truncated) | 38.58 % |
| % of genes from short scaffolds (< 2000 bps) | 77.17 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.268 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.961 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.220 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.929 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 5.51 |
| PF00034 | Cytochrom_C | 3.15 |
| PF00668 | Condensation | 3.15 |
| PF03237 | Terminase_6N | 2.36 |
| PF12850 | Metallophos_2 | 2.36 |
| PF13193 | AMP-binding_C | 2.36 |
| PF13545 | HTH_Crp_2 | 1.57 |
| PF07486 | Hydrolase_2 | 1.57 |
| PF13515 | FUSC_2 | 1.57 |
| PF17201 | Cache_3-Cache_2 | 1.57 |
| PF11391 | DUF2798 | 1.57 |
| PF00106 | adh_short | 0.79 |
| PF00501 | AMP-binding | 0.79 |
| PF13493 | DUF4118 | 0.79 |
| PF07386 | DUF1499 | 0.79 |
| PF06078 | DUF937 | 0.79 |
| PF01361 | Tautomerase | 0.79 |
| PF05227 | CHASE3 | 0.79 |
| PF09361 | Phasin_2 | 0.79 |
| PF10503 | Esterase_PHB | 0.79 |
| PF12576 | DUF3754 | 0.79 |
| PF04298 | Zn_peptidase_2 | 0.79 |
| PF03707 | MHYT | 0.79 |
| PF14342 | DUF4396 | 0.79 |
| PF13683 | rve_3 | 0.79 |
| PF02518 | HATPase_c | 0.79 |
| PF13442 | Cytochrome_CBB3 | 0.79 |
| PF00171 | Aldedh | 0.79 |
| PF02148 | zf-UBP | 0.79 |
| PF03466 | LysR_substrate | 0.79 |
| PF12833 | HTH_18 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.15 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.57 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.79 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.79 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.79 |
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.79 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.79 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.79 |
| COG4446 | Uncharacterized conserved protein, DUF1499 family | Function unknown [S] | 0.79 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.79 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.27 % |
| Unclassified | root | N/A | 41.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01DKYO3 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 527 | Open in IMG/M |
| 3300002070|JGI24750J21931_1013102 | Not Available | 1106 | Open in IMG/M |
| 3300004463|Ga0063356_101739889 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300004785|Ga0058858_1411625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 789 | Open in IMG/M |
| 3300004799|Ga0058863_11808773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1198 | Open in IMG/M |
| 3300005327|Ga0070658_10754964 | Not Available | 845 | Open in IMG/M |
| 3300005329|Ga0070683_101069455 | Not Available | 775 | Open in IMG/M |
| 3300005331|Ga0070670_100058933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3296 | Open in IMG/M |
| 3300005332|Ga0066388_102182614 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005339|Ga0070660_100107965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2212 | Open in IMG/M |
| 3300005354|Ga0070675_100486679 | Not Available | 1110 | Open in IMG/M |
| 3300005356|Ga0070674_100227980 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300005435|Ga0070714_100291616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1518 | Open in IMG/M |
| 3300005444|Ga0070694_101064547 | Not Available | 673 | Open in IMG/M |
| 3300005457|Ga0070662_100087876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2328 | Open in IMG/M |
| 3300005457|Ga0070662_100771048 | Not Available | 816 | Open in IMG/M |
| 3300005544|Ga0070686_101804633 | Not Available | 521 | Open in IMG/M |
| 3300005546|Ga0070696_100792308 | Not Available | 779 | Open in IMG/M |
| 3300005547|Ga0070693_101266720 | Not Available | 569 | Open in IMG/M |
| 3300005548|Ga0070665_100099218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2916 | Open in IMG/M |
| 3300005548|Ga0070665_100800297 | Not Available | 956 | Open in IMG/M |
| 3300005548|Ga0070665_102273934 | Not Available | 545 | Open in IMG/M |
| 3300005549|Ga0070704_100785921 | Not Available | 850 | Open in IMG/M |
| 3300005563|Ga0068855_101122594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 821 | Open in IMG/M |
| 3300005564|Ga0070664_100062505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3174 | Open in IMG/M |
| 3300005564|Ga0070664_100583379 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005577|Ga0068857_100013551 | All Organisms → cellular organisms → Bacteria | 7102 | Open in IMG/M |
| 3300005615|Ga0070702_100046446 | Not Available | 2461 | Open in IMG/M |
| 3300005615|Ga0070702_100212444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1289 | Open in IMG/M |
| 3300005713|Ga0066905_100127823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1787 | Open in IMG/M |
| 3300005718|Ga0068866_10071043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1840 | Open in IMG/M |
| 3300005764|Ga0066903_103605711 | Not Available | 834 | Open in IMG/M |
| 3300005764|Ga0066903_108052179 | Not Available | 540 | Open in IMG/M |
| 3300005841|Ga0068863_102333104 | Not Available | 545 | Open in IMG/M |
| 3300005844|Ga0068862_100571743 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300006196|Ga0075422_10282593 | Not Available | 706 | Open in IMG/M |
| 3300006804|Ga0079221_10457550 | Not Available | 813 | Open in IMG/M |
| 3300006806|Ga0079220_11650073 | Not Available | 558 | Open in IMG/M |
| 3300006844|Ga0075428_100397662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1477 | Open in IMG/M |
| 3300006844|Ga0075428_100631559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
| 3300006845|Ga0075421_102338874 | Not Available | 561 | Open in IMG/M |
| 3300006846|Ga0075430_100441672 | Not Available | 1074 | Open in IMG/M |
| 3300006847|Ga0075431_100525456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1172 | Open in IMG/M |
| 3300006852|Ga0075433_10417326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1183 | Open in IMG/M |
| 3300006852|Ga0075433_10675009 | Not Available | 905 | Open in IMG/M |
| 3300006871|Ga0075434_100658252 | Not Available | 1065 | Open in IMG/M |
| 3300006914|Ga0075436_100657046 | Not Available | 775 | Open in IMG/M |
| 3300006954|Ga0079219_10134575 | Not Available | 1288 | Open in IMG/M |
| 3300007076|Ga0075435_100060335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 3075 | Open in IMG/M |
| 3300007076|Ga0075435_100346204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
| 3300007076|Ga0075435_100958648 | Not Available | 747 | Open in IMG/M |
| 3300007076|Ga0075435_101568217 | Not Available | 578 | Open in IMG/M |
| 3300007076|Ga0075435_101949889 | Not Available | 516 | Open in IMG/M |
| 3300009011|Ga0105251_10053072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1928 | Open in IMG/M |
| 3300009094|Ga0111539_11310221 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 841 | Open in IMG/M |
| 3300009148|Ga0105243_10179361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1841 | Open in IMG/M |
| 3300009148|Ga0105243_11341984 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009156|Ga0111538_11018736 | Not Available | 1047 | Open in IMG/M |
| 3300009156|Ga0111538_11522360 | Not Available | 843 | Open in IMG/M |
| 3300009162|Ga0075423_11134856 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009167|Ga0113563_12553933 | Not Available | 617 | Open in IMG/M |
| 3300009553|Ga0105249_10362664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1471 | Open in IMG/M |
| 3300009553|Ga0105249_10782510 | Not Available | 1017 | Open in IMG/M |
| 3300010375|Ga0105239_12190483 | Not Available | 643 | Open in IMG/M |
| 3300010396|Ga0134126_10363834 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300011119|Ga0105246_10003183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9975 | Open in IMG/M |
| 3300011119|Ga0105246_10018371 | All Organisms → cellular organisms → Bacteria | 4456 | Open in IMG/M |
| 3300011119|Ga0105246_11099523 | Not Available | 726 | Open in IMG/M |
| 3300012489|Ga0157349_1030348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
| 3300012899|Ga0157299_10012638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1465 | Open in IMG/M |
| 3300012909|Ga0157290_10186181 | Not Available | 694 | Open in IMG/M |
| 3300012911|Ga0157301_10113262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300012951|Ga0164300_10013227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2670 | Open in IMG/M |
| 3300012951|Ga0164300_10506451 | Not Available | 691 | Open in IMG/M |
| 3300012957|Ga0164303_10005015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4153 | Open in IMG/M |
| 3300012957|Ga0164303_10014895 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300012957|Ga0164303_10016017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2766 | Open in IMG/M |
| 3300012957|Ga0164303_11232845 | Not Available | 549 | Open in IMG/M |
| 3300012958|Ga0164299_10091960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300012958|Ga0164299_10186918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium drakei | 1184 | Open in IMG/M |
| 3300012958|Ga0164299_11302645 | Not Available | 556 | Open in IMG/M |
| 3300012960|Ga0164301_10773550 | Not Available | 731 | Open in IMG/M |
| 3300012960|Ga0164301_11145216 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 621 | Open in IMG/M |
| 3300012984|Ga0164309_10048746 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300012985|Ga0164308_10873536 | Not Available | 790 | Open in IMG/M |
| 3300012985|Ga0164308_11733567 | Not Available | 580 | Open in IMG/M |
| 3300012988|Ga0164306_11206698 | Not Available | 635 | Open in IMG/M |
| 3300013297|Ga0157378_11741786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300013306|Ga0163162_10030224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5368 | Open in IMG/M |
| 3300013306|Ga0163162_10069206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3581 | Open in IMG/M |
| 3300013306|Ga0163162_12298945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300013307|Ga0157372_12934481 | Not Available | 546 | Open in IMG/M |
| 3300015371|Ga0132258_10073131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7958 | Open in IMG/M |
| 3300015371|Ga0132258_12218030 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 1378 | Open in IMG/M |
| 3300015373|Ga0132257_100119089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604 | 3065 | Open in IMG/M |
| 3300015373|Ga0132257_100146618 | All Organisms → cellular organisms → Bacteria | 2761 | Open in IMG/M |
| 3300015373|Ga0132257_102231785 | Not Available | 709 | Open in IMG/M |
| 3300015374|Ga0132255_101864377 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300015374|Ga0132255_104899059 | Not Available | 567 | Open in IMG/M |
| 3300017943|Ga0187819_10017311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4154 | Open in IMG/M |
| 3300017955|Ga0187817_10077173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2080 | Open in IMG/M |
| 3300018028|Ga0184608_10192734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 891 | Open in IMG/M |
| 3300018081|Ga0184625_10428474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 680 | Open in IMG/M |
| 3300022694|Ga0222623_10067249 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300024055|Ga0247794_10105189 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300025903|Ga0207680_10200783 | Not Available | 1359 | Open in IMG/M |
| 3300025908|Ga0207643_10050019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2369 | Open in IMG/M |
| 3300025908|Ga0207643_10584500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300025911|Ga0207654_10018001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3704 | Open in IMG/M |
| 3300025916|Ga0207663_10023143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3561 | Open in IMG/M |
| 3300025919|Ga0207657_10000470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 42653 | Open in IMG/M |
| 3300025933|Ga0207706_10882720 | Not Available | 756 | Open in IMG/M |
| 3300025936|Ga0207670_10457295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300025938|Ga0207704_10678268 | Not Available | 851 | Open in IMG/M |
| 3300025949|Ga0207667_10095101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3076 | Open in IMG/M |
| 3300025972|Ga0207668_11237050 | Not Available | 671 | Open in IMG/M |
| 3300026035|Ga0207703_10669640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300026067|Ga0207678_10285733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1416 | Open in IMG/M |
| 3300027703|Ga0207862_1018327 | Not Available | 2084 | Open in IMG/M |
| 3300028379|Ga0268266_10148957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2107 | Open in IMG/M |
| 3300031944|Ga0310884_10579305 | Not Available | 668 | Open in IMG/M |
| 3300032180|Ga0307471_100942522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
| 3300032180|Ga0307471_103218793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 579 | Open in IMG/M |
| 3300032205|Ga0307472_100975442 | Not Available | 792 | Open in IMG/M |
| 3300032205|Ga0307472_101154872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300032829|Ga0335070_10252035 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300033551|Ga0247830_11711743 | Not Available | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 7.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.57% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00489180 | 2170459010 | Grass Soil | GVPKRMENQKMLRRTFPYLKRPDVEFVLDCTSFIFFSVIFLHWVAHF |
| JGI24750J21931_10131022 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | MENKKMLKRXFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0063356_1017398892 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLAQARSQGEKQMLRRVFPLLKRPDVEFMLEYASFILFGAALLHWLAQF* |
| Ga0058858_14116252 | 3300004785 | Host-Associated | MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0058863_118087734 | 3300004799 | Host-Associated | MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF* |
| Ga0070658_107549642 | 3300005327 | Corn Rhizosphere | MENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF* |
| Ga0070683_1010694552 | 3300005329 | Corn Rhizosphere | MENQKMLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF* |
| Ga0070670_1000589334 | 3300005331 | Switchgrass Rhizosphere | MENKKMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0066388_1021826141 | 3300005332 | Tropical Forest Soil | MGLLLLESKMLKRILPYLNRPDVEFVLECVSFILFSAVFLNWVAHL* |
| Ga0070660_1001079652 | 3300005339 | Corn Rhizosphere | MLDGESKMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF* |
| Ga0070675_1004866792 | 3300005354 | Miscanthus Rhizosphere | MENQKMLKRIFPSLNRPDVEFALERASFILFSAVFLNWVAQF* |
| Ga0070674_1002279803 | 3300005356 | Miscanthus Rhizosphere | MENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAHF* |
| Ga0070714_1002916161 | 3300005435 | Agricultural Soil | KKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF* |
| Ga0070694_1010645471 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVALSNQLKFAF |
| Ga0070662_1000878761 | 3300005457 | Corn Rhizosphere | RDAWMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0070662_1007710482 | 3300005457 | Corn Rhizosphere | TSAKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL* |
| Ga0070686_1018046331 | 3300005544 | Switchgrass Rhizosphere | KKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL* |
| Ga0070696_1007923081 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KKMFRHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL* |
| Ga0070693_1012667201 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQDQCDAWIGESKMLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF* |
| Ga0070665_1000992182 | 3300005548 | Switchgrass Rhizosphere | MFKSIFPFLKRPDIEFALECASFIFFCAAFLHWVAQF* |
| Ga0070665_1008002972 | 3300005548 | Switchgrass Rhizosphere | MLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF* |
| Ga0070665_1022739341 | 3300005548 | Switchgrass Rhizosphere | MLRRMFPYLNRPDVEIVLDCTSFIFFSVIFLRWVAHF* |
| Ga0070704_1007859212 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | QGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL* |
| Ga0068855_1011225941 | 3300005563 | Corn Rhizosphere | DGESKMLRRVFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF* |
| Ga0070664_1000625059 | 3300005564 | Corn Rhizosphere | MLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0070664_1005833792 | 3300005564 | Corn Rhizosphere | MLKRIFPYLDRPDVEFVLECVSFILFSAVFLNWVAHF* |
| Ga0068857_1000135512 | 3300005577 | Corn Rhizosphere | MLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0070702_1000464461 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AKQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL* |
| Ga0070702_1002124441 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0066905_1001278231 | 3300005713 | Tropical Forest Soil | MEKKMLRRIVPYLKRPDVDFALDCVSFILFSVVFLYWVAHL* |
| Ga0068866_100710434 | 3300005718 | Miscanthus Rhizosphere | MLKRIFPSLNRPDVEFALERASFILFSAVFLNWVAQF* |
| Ga0066903_1036057111 | 3300005764 | Tropical Forest Soil | PPMGLLLLESKMLKRILPYLNRPDVEFVLECVSFILFSAAFLNWVAHL* |
| Ga0066903_1080521791 | 3300005764 | Tropical Forest Soil | MLRGVFPSLKRPDVEFALECASFIFFCAVFLHWIA |
| Ga0068863_1023331042 | 3300005841 | Switchgrass Rhizosphere | MEDQKMLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF* |
| Ga0068862_1005717433 | 3300005844 | Switchgrass Rhizosphere | MLRRIFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF* |
| Ga0075422_102825932 | 3300006196 | Populus Rhizosphere | MLKRIFPYLNRPDVEFVLECASFILFAAVFLHWVAHF* |
| Ga0079221_104575501 | 3300006804 | Agricultural Soil | MENQKMLKRIFPYLNRPDVEFVFSAIFLNWVAHF* |
| Ga0079220_116500731 | 3300006806 | Agricultural Soil | MENKKMLRRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0075428_1003976621 | 3300006844 | Populus Rhizosphere | MLRRVFPYFKRPDVEFVLECVSFILFSVVFMHWVAHF* |
| Ga0075428_1006315594 | 3300006844 | Populus Rhizosphere | LTQGAKQMLKRVFPFLKRSDVEFTLECTSFILFCAAALRWVAQF* |
| Ga0075421_1023388741 | 3300006845 | Populus Rhizosphere | KQMFRRVFPFLNRPDVEFTLECASFILFCAAFLYWLAQF* |
| Ga0075430_1004416722 | 3300006846 | Populus Rhizosphere | MFRHMFPFLMRPDVEFALDCASFIFFCAALLHWIAQL* |
| Ga0075431_1005254561 | 3300006847 | Populus Rhizosphere | KMFRHMFPFLMRPDVEFALDCASFIFFCAALLHWIAQL* |
| Ga0075433_104173262 | 3300006852 | Populus Rhizosphere | MENQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWVAHF* |
| Ga0075433_106750094 | 3300006852 | Populus Rhizosphere | RDAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAVFLNWVAHF* |
| Ga0075434_1006582522 | 3300006871 | Populus Rhizosphere | MLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF* |
| Ga0075436_1006570461 | 3300006914 | Populus Rhizosphere | KMLKRIFPYLNRPDVEFVLECASFILFSAVFLNWVAHF* |
| Ga0079219_101345751 | 3300006954 | Agricultural Soil | MENQKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0075435_1000603354 | 3300007076 | Populus Rhizosphere | MFRHMFPFLMRPDLEFALDCASFIFFCAALLHWIAQL* |
| Ga0075435_1003462043 | 3300007076 | Populus Rhizosphere | DAWMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF* |
| Ga0075435_1009586481 | 3300007076 | Populus Rhizosphere | MENQKMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF* |
| Ga0075435_1015682171 | 3300007076 | Populus Rhizosphere | KMLRRVFPYFKRPDVEFVLECVSFILFSVVFVHWVAHF* |
| Ga0075435_1019498892 | 3300007076 | Populus Rhizosphere | RVKQMFRRVFPFLNRPDVEFTLECASFILFCAAFLYWLAQF* |
| Ga0105251_100530721 | 3300009011 | Switchgrass Rhizosphere | NKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF* |
| Ga0111539_113102212 | 3300009094 | Populus Rhizosphere | MLAQARSQGEKQMLRRVFPLLKRPDVEFMLDCASFILFGAALLHWVAQF* |
| Ga0105243_101793611 | 3300009148 | Miscanthus Rhizosphere | MENQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWV |
| Ga0105243_113419842 | 3300009148 | Miscanthus Rhizosphere | MLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF* |
| Ga0111538_110187361 | 3300009156 | Populus Rhizosphere | NQKMLKRIFPYLNRPDVEFVLECVSFILLSAVFLNWVAHF* |
| Ga0111538_115223601 | 3300009156 | Populus Rhizosphere | MFRHMFPFLMRPDVEFALHCASFIFFCAALLHWIAQL |
| Ga0075423_111348562 | 3300009162 | Populus Rhizosphere | MLRRVFPYLKRPDVEFTLECASFILFCAAFLRWIAQF* |
| Ga0113563_125539332 | 3300009167 | Freshwater Wetlands | MLRRVFPLLKRPDVEFTLECASFVLFCAALLHWIAQF* |
| Ga0105249_103626644 | 3300009553 | Switchgrass Rhizosphere | DAWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAIFLNWVAHF* |
| Ga0105249_107825103 | 3300009553 | Switchgrass Rhizosphere | RIFPYLNRPDVEFVLECASFILFSAVFLNWVAHF* |
| Ga0105239_121904832 | 3300010375 | Corn Rhizosphere | GLPKSTENQKMLRRMFPYLNRPDVEIVLDCTSFIFFSVIFLRWVAHF* |
| Ga0134126_103638342 | 3300010396 | Terrestrial Soil | MLRRIFPYFKRPDVEFVLEYVSFILFSVVFVHWVAHF* |
| Ga0105246_100031831 | 3300011119 | Miscanthus Rhizosphere | MLKRIFPYLNRPNVEFVLEYVSFILFCGVFLHWVAHF* |
| Ga0105246_100183717 | 3300011119 | Miscanthus Rhizosphere | MLKRIFPYLNRPDVEFALECASSILFSAVFLNWVAQF* |
| Ga0105246_110995231 | 3300011119 | Miscanthus Rhizosphere | MENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVF |
| Ga0157349_10303481 | 3300012489 | Unplanted Soil | MLRRVFPLLKRPDVEFMLEYASFILLGAALLHWLAQF* |
| Ga0157299_100126381 | 3300012899 | Soil | ASLIELRDAGMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0157290_101861811 | 3300012909 | Soil | QKMLKRIFPSLNRPDVEFALECASFILFSAVFLNWVAQF* |
| Ga0157301_101132623 | 3300012911 | Soil | AWMENQKMLKRIFPYLNRPDVEFVLECVSFILFSAVVLNWVAHF* |
| Ga0164300_100132274 | 3300012951 | Soil | MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL* |
| Ga0164300_105064512 | 3300012951 | Soil | MLRRVFPFLKRPDIEFKLECASFILFSAAFLHWVAQF* |
| Ga0164303_100050156 | 3300012957 | Soil | MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAHL* |
| Ga0164303_100148953 | 3300012957 | Soil | MLSRVFPFLKKPDVEFTLECASFILFCAAFLHWVAQL* |
| Ga0164303_100160172 | 3300012957 | Soil | MLRRTFPYLKRPDVEFVLERTSFIFFSVIFLHWVAHF* |
| Ga0164303_112328451 | 3300012957 | Soil | KQMLRRMFPLLKRPDVEFMLDCASFILFGAALLHWVAQF* |
| Ga0164299_100919603 | 3300012958 | Soil | MLRRMFPYLNRPDVEIVLDCTSFIFFSVVFLRWVAHF* |
| Ga0164299_101869183 | 3300012958 | Soil | MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL* |
| Ga0164299_113026452 | 3300012958 | Soil | MVRPVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF* |
| Ga0164301_107735501 | 3300012960 | Soil | MLRRTFPYLKRPDVEFVLDCTSFIFFSVIFLHWVAHF* |
| Ga0164301_111452162 | 3300012960 | Soil | RRVFPFLKRPDIEFKLECASFILFSAAFLHWVAQF* |
| Ga0164309_100487461 | 3300012984 | Soil | LSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL* |
| Ga0164308_108735361 | 3300012985 | Soil | KRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0164308_117335671 | 3300012985 | Soil | RVLTQGVKQMLRRVFPFLKRPDIEFTLECASFILFSAAFLHWVAQL* |
| Ga0164306_112066982 | 3300012988 | Soil | MVRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF* |
| Ga0157378_117417861 | 3300013297 | Miscanthus Rhizosphere | KMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF* |
| Ga0163162_100302241 | 3300013306 | Switchgrass Rhizosphere | GVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL* |
| Ga0163162_100692067 | 3300013306 | Switchgrass Rhizosphere | MLKRIFPSLNRPDVEFALECASFILFSAVFLNWVAQF* |
| Ga0163162_122989452 | 3300013306 | Switchgrass Rhizosphere | RVFPLLKRPGVEFMLECASFVLFCAALLHWVAQF* |
| Ga0157372_129344811 | 3300013307 | Corn Rhizosphere | MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWGAQL* |
| Ga0132258_100731314 | 3300015371 | Arabidopsis Rhizosphere | MFKSIFPFLKRPDIEFALECASFIFFYAAFLHWVAQF* |
| Ga0132258_122180302 | 3300015371 | Arabidopsis Rhizosphere | MLRRVFPLLKRPDVEFMLECASFILFCTALLHWVARF* |
| Ga0132257_1001190892 | 3300015373 | Arabidopsis Rhizosphere | MLRRVFPYLKRPDVEFMLECASFILFCAAFLRWIAQF* |
| Ga0132257_1001466182 | 3300015373 | Arabidopsis Rhizosphere | MLRRVFPFLKRPDIEFTLECASFILFCAAFLHWVAQF* |
| Ga0132257_1022317852 | 3300015373 | Arabidopsis Rhizosphere | MSAQASSQGEKQMLRRVFPLLKRPDVEFMLECASFVLFCAALLHWIAQF* |
| Ga0132255_1018643772 | 3300015374 | Arabidopsis Rhizosphere | MLAQARSQGEKQMLRRVFPLLKRPDVEFMLEYASFILLGAALLHWLAQF* |
| Ga0132255_1048990592 | 3300015374 | Arabidopsis Rhizosphere | MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAHF* |
| Ga0187819_100173112 | 3300017943 | Freshwater Sediment | MLRRAFPLLKRSDVEFTLECASFVLFCAAFLHWVAQI |
| Ga0187817_100771732 | 3300017955 | Freshwater Sediment | MLKRAFPPLKRPDVEFTLECASFILFCAAFLHWVAQI |
| Ga0184608_101927342 | 3300018028 | Groundwater Sediment | MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQ |
| Ga0184625_104284742 | 3300018081 | Groundwater Sediment | MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL |
| Ga0222623_100672491 | 3300022694 | Groundwater Sediment | MLSRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF |
| Ga0247794_101051893 | 3300024055 | Soil | MLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAH |
| Ga0207680_102007833 | 3300025903 | Switchgrass Rhizosphere | QRKRAMENQKMLKRIFPYLNRPDVEFALECASFILFSAVFLNWVAQF |
| Ga0207643_100500193 | 3300025908 | Miscanthus Rhizosphere | MLKRIFPYLNRPDVEFVLECVSFILFCGVFVHWVAHF |
| Ga0207643_105845002 | 3300025908 | Miscanthus Rhizosphere | MLKRIFPYLNRPDVEFALERASFILFSAVFLNWVAQF |
| Ga0207654_100180012 | 3300025911 | Corn Rhizosphere | MFKSIFPFLKRPDIEFALECASFIFFCAAFLHWVAQF |
| Ga0207663_100231434 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIFPYFKRPDVEFVLECVSFILFSAVFVHWVAHF |
| Ga0207657_1000047050 | 3300025919 | Corn Rhizosphere | WMENKKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF |
| Ga0207706_108827202 | 3300025933 | Corn Rhizosphere | MLKRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQF |
| Ga0207670_104572952 | 3300025936 | Switchgrass Rhizosphere | MFRHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL |
| Ga0207704_106782682 | 3300025938 | Miscanthus Rhizosphere | ENKKMLKRVFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF |
| Ga0207667_100951014 | 3300025949 | Corn Rhizosphere | MFKSIFPFLKRPDIEFALECASFIFFYAAFLHWVAQF |
| Ga0207668_112370502 | 3300025972 | Switchgrass Rhizosphere | MLRRLFPYLKRPDIEIFLDCAAFIFFIVAFLHWVARF |
| Ga0207703_106696402 | 3300026035 | Switchgrass Rhizosphere | KKMLKRIFPYLNRPDVEFVLECVSFILFCGVFLHWVAHF |
| Ga0207678_102857333 | 3300026067 | Corn Rhizosphere | MLKRIFPYLDRPDVEFVLECVSFILFSAVFLNWVAHF |
| Ga0207862_10183272 | 3300027703 | Tropical Forest Soil | MVKRMFPFLKWPNVEFTLECASFVFFCVAFLHWVAHF |
| Ga0268266_101489571 | 3300028379 | Switchgrass Rhizosphere | MLKRIFPYLNRPDVEFVLEYVSFILFCGVFLHWVAHF |
| Ga0310884_105793052 | 3300031944 | Soil | KQGVKKMFKHMFPFLMRPDVEFALDCASFIFFCAAFLHWIAQL |
| Ga0307471_1009425222 | 3300032180 | Hardwood Forest Soil | MLRRVFPFLKRPDVEFTLECASFILFCAAFLHWVAQL |
| Ga0307471_1032187932 | 3300032180 | Hardwood Forest Soil | MLRRVFPLLKRPDVEFMLECTSFILFCAAFLRWIAQF |
| Ga0307472_1009754422 | 3300032205 | Hardwood Forest Soil | MLRRLFPYLKRPDVEIFLDCVSFIFFSVAFLHWVAHF |
| Ga0307472_1011548723 | 3300032205 | Hardwood Forest Soil | QGVKQMLRRVFPLLKRPDVEFMLECASFILFCAALLHWVAQF |
| Ga0335070_102520352 | 3300032829 | Soil | MLRHVFPILKRRDVELTLECTSFLLLCAAFLHWVAVG |
| Ga0247830_117117431 | 3300033551 | Soil | MLRRTFPYLKRPDVEFALDCTSLIIFSVIFLHWVVHF |
| ⦗Top⦘ |