


| Basic Information | |
|---|---|
| Family ID | F065576 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKRLIASVVLAIALLTSGAVVTQSSLVGTAYADSGGGE |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.61 % |
| % of genes near scaffold ends (potentially truncated) | 18.11 % |
| % of genes from short scaffolds (< 2000 bps) | 73.23 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.047 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.646 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 33.91 |
| PF02954 | HTH_8 | 18.26 |
| PF02776 | TPP_enzyme_N | 3.48 |
| PF00072 | Response_reg | 0.87 |
| PF00989 | PAS | 0.87 |
| PF01609 | DDE_Tnp_1 | 0.87 |
| PF00158 | Sigma54_activat | 0.87 |
| PF17203 | sCache_3_2 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.87 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.87 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.87 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.12 % |
| Unclassified | root | N/A | 44.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101806268 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1383 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101806268 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1383 | Open in IMG/M |
| 3300000550|F24TB_12370845 | Not Available | 506 | Open in IMG/M |
| 3300000956|JGI10216J12902_101816064 | All Organisms → cellular organisms → Bacteria | 5788 | Open in IMG/M |
| 3300003319|soilL2_10310448 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300003996|Ga0055467_10042314 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005332|Ga0066388_103828323 | Not Available | 768 | Open in IMG/M |
| 3300005719|Ga0068861_102330602 | Not Available | 537 | Open in IMG/M |
| 3300005719|Ga0068861_102330602 | Not Available | 537 | Open in IMG/M |
| 3300005764|Ga0066903_100729387 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300005764|Ga0066903_101801589 | Not Available | 1169 | Open in IMG/M |
| 3300005764|Ga0066903_107583924 | Not Available | 559 | Open in IMG/M |
| 3300005840|Ga0068870_10156756 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1346 | Open in IMG/M |
| 3300005981|Ga0081538_10211152 | Not Available | 782 | Open in IMG/M |
| 3300005985|Ga0081539_10247087 | Not Available | 795 | Open in IMG/M |
| 3300006797|Ga0066659_11159272 | Not Available | 646 | Open in IMG/M |
| 3300006845|Ga0075421_100107255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3512 | Open in IMG/M |
| 3300006845|Ga0075421_100780012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1102 | Open in IMG/M |
| 3300006845|Ga0075421_101733370 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006846|Ga0075430_100652087 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 868 | Open in IMG/M |
| 3300006852|Ga0075433_11652843 | Not Available | 552 | Open in IMG/M |
| 3300006853|Ga0075420_100621357 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 932 | Open in IMG/M |
| 3300007255|Ga0099791_10345755 | Not Available | 712 | Open in IMG/M |
| 3300009012|Ga0066710_100194824 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2878 | Open in IMG/M |
| 3300009012|Ga0066710_100194824 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2878 | Open in IMG/M |
| 3300009012|Ga0066710_100285163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2410 | Open in IMG/M |
| 3300009038|Ga0099829_10080889 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300009038|Ga0099829_10468513 | Not Available | 1045 | Open in IMG/M |
| 3300009089|Ga0099828_10992057 | Not Available | 748 | Open in IMG/M |
| 3300009090|Ga0099827_10036101 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
| 3300009090|Ga0099827_10040018 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 3460 | Open in IMG/M |
| 3300009090|Ga0099827_10040018 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 3460 | Open in IMG/M |
| 3300009090|Ga0099827_10098139 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300009090|Ga0099827_10525575 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1017 | Open in IMG/M |
| 3300009094|Ga0111539_10008220 | All Organisms → cellular organisms → Bacteria | 13280 | Open in IMG/M |
| 3300009094|Ga0111539_10008220 | All Organisms → cellular organisms → Bacteria | 13280 | Open in IMG/M |
| 3300009094|Ga0111539_10217304 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300009137|Ga0066709_100133798 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
| 3300009143|Ga0099792_10552599 | Not Available | 728 | Open in IMG/M |
| 3300009143|Ga0099792_10810723 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 614 | Open in IMG/M |
| 3300009147|Ga0114129_12773117 | Not Available | 583 | Open in IMG/M |
| 3300009444|Ga0114945_10029190 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300009444|Ga0114945_10852745 | Not Available | 560 | Open in IMG/M |
| 3300009691|Ga0114944_1008823 | All Organisms → cellular organisms → Bacteria | 3287 | Open in IMG/M |
| 3300009691|Ga0114944_1011574 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2936 | Open in IMG/M |
| 3300009691|Ga0114944_1060331 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1402 | Open in IMG/M |
| 3300009691|Ga0114944_1071625 | Not Available | 1296 | Open in IMG/M |
| 3300009821|Ga0105064_1102781 | Not Available | 587 | Open in IMG/M |
| 3300009822|Ga0105066_1070903 | Not Available | 747 | Open in IMG/M |
| 3300010046|Ga0126384_11269117 | Not Available | 682 | Open in IMG/M |
| 3300010047|Ga0126382_10142107 | Not Available | 1629 | Open in IMG/M |
| 3300010047|Ga0126382_10400201 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1071 | Open in IMG/M |
| 3300010047|Ga0126382_10564179 | Not Available | 929 | Open in IMG/M |
| 3300010047|Ga0126382_11145355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 693 | Open in IMG/M |
| 3300010047|Ga0126382_11591642 | Not Available | 605 | Open in IMG/M |
| 3300010047|Ga0126382_12006360 | Not Available | 551 | Open in IMG/M |
| 3300010360|Ga0126372_10317735 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300010362|Ga0126377_10076307 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2997 | Open in IMG/M |
| 3300010366|Ga0126379_10438690 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300010366|Ga0126379_11059345 | Not Available | 916 | Open in IMG/M |
| 3300010366|Ga0126379_11059345 | Not Available | 916 | Open in IMG/M |
| 3300010392|Ga0118731_114614765 | Not Available | 544 | Open in IMG/M |
| 3300010398|Ga0126383_10138431 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2251 | Open in IMG/M |
| 3300010398|Ga0126383_10138431 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2251 | Open in IMG/M |
| 3300010398|Ga0126383_13361031 | Not Available | 523 | Open in IMG/M |
| 3300011269|Ga0137392_11486912 | Not Available | 536 | Open in IMG/M |
| 3300011440|Ga0137433_1016638 | Not Available | 2141 | Open in IMG/M |
| 3300012189|Ga0137388_10598734 | Not Available | 1025 | Open in IMG/M |
| 3300012204|Ga0137374_10014581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9093 | Open in IMG/M |
| 3300012205|Ga0137362_10247130 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300012206|Ga0137380_10145242 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300012207|Ga0137381_10071412 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 2903 | Open in IMG/M |
| 3300012209|Ga0137379_10060067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3661 | Open in IMG/M |
| 3300012209|Ga0137379_10178678 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300012356|Ga0137371_10279713 | Not Available | 1301 | Open in IMG/M |
| 3300012356|Ga0137371_10871218 | Not Available | 685 | Open in IMG/M |
| 3300012361|Ga0137360_11201431 | Not Available | 656 | Open in IMG/M |
| 3300012930|Ga0137407_12215225 | Not Available | 525 | Open in IMG/M |
| 3300012944|Ga0137410_10225660 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300012948|Ga0126375_10726616 | Not Available | 776 | Open in IMG/M |
| 3300012948|Ga0126375_11120150 | Not Available | 650 | Open in IMG/M |
| 3300012948|Ga0126375_11417090 | Not Available | 590 | Open in IMG/M |
| 3300012948|Ga0126375_11827956 | Not Available | 531 | Open in IMG/M |
| 3300013306|Ga0163162_10357228 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300013308|Ga0157375_12248055 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300015241|Ga0137418_10032104 | Not Available | 4862 | Open in IMG/M |
| 3300018056|Ga0184623_10034658 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300018063|Ga0184637_10079821 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300018079|Ga0184627_10652262 | Not Available | 521 | Open in IMG/M |
| 3300018082|Ga0184639_10262602 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300019232|Ga0180114_1284915 | Not Available | 604 | Open in IMG/M |
| 3300019232|Ga0180114_1284915 | Not Available | 604 | Open in IMG/M |
| 3300019249|Ga0184648_1234667 | Not Available | 616 | Open in IMG/M |
| 3300019249|Ga0184648_1234667 | Not Available | 616 | Open in IMG/M |
| 3300019249|Ga0184648_1365637 | Not Available | 552 | Open in IMG/M |
| 3300019259|Ga0184646_1047203 | Not Available | 619 | Open in IMG/M |
| 3300019259|Ga0184646_1213050 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1256 | Open in IMG/M |
| 3300020063|Ga0180118_1212083 | Not Available | 730 | Open in IMG/M |
| 3300020065|Ga0180113_1122301 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 727 | Open in IMG/M |
| 3300022563|Ga0212128_10030856 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 3452 | Open in IMG/M |
| 3300022563|Ga0212128_10030856 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 3452 | Open in IMG/M |
| 3300022563|Ga0212128_10099938 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300022563|Ga0212128_10101394 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1859 | Open in IMG/M |
| 3300022563|Ga0212128_10128589 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1635 | Open in IMG/M |
| 3300022563|Ga0212128_10243260 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300022563|Ga0212128_10273717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1064 | Open in IMG/M |
| 3300022563|Ga0212128_10298026 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300022563|Ga0212128_10454780 | Not Available | 787 | Open in IMG/M |
| 3300022563|Ga0212128_10702436 | Not Available | 606 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10164954 | Not Available | 912 | Open in IMG/M |
| 3300025910|Ga0207684_10919005 | Not Available | 735 | Open in IMG/M |
| 3300025961|Ga0207712_10873361 | Not Available | 794 | Open in IMG/M |
| 3300025961|Ga0207712_10873361 | Not Available | 794 | Open in IMG/M |
| 3300026035|Ga0207703_12189637 | Not Available | 529 | Open in IMG/M |
| 3300027882|Ga0209590_10041884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2500 | Open in IMG/M |
| 3300027882|Ga0209590_10328073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 985 | Open in IMG/M |
| 3300027909|Ga0209382_10348819 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300027961|Ga0209853_1008730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3137 | Open in IMG/M |
| 3300028536|Ga0137415_10378788 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1219 | Open in IMG/M |
| 3300030592|Ga0247612_1027108 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300030619|Ga0268386_10104134 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 2194 | Open in IMG/M |
| 3300031094|Ga0308199_1004755 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300031421|Ga0308194_10024633 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1357 | Open in IMG/M |
| 3300031562|Ga0310886_10708282 | Not Available | 627 | Open in IMG/M |
| 3300034643|Ga0370545_011787 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1336 | Open in IMG/M |
| 3300034643|Ga0370545_011787 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1336 | Open in IMG/M |
| 3300034659|Ga0314780_124506 | Not Available | 612 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.96% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 12.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.66% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 7.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.79% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1018062681 | 3300000364 | Soil | RLIASVVVVVALLTSGVVVTQSRLVGTAYADSGGD* |
| INPhiseqgaiiFebDRAFT_1018062682 | 3300000364 | Soil | MRRLIASVVIAIALLTSGAVVPQARLLGTAYADSGSE* |
| F24TB_123708451 | 3300000550 | Soil | RLVATIMLSIALLTSGAVVTQSSLVGTAYAEAAGGSE* |
| JGI10216J12902_1018160647 | 3300000956 | Soil | MKRLIISVVLAIVLLTSGAVVPQSNLVSAAYADEGGGE* |
| soilL2_103104482 | 3300003319 | Sugarcane Root And Bulk Soil | MKRLVASVILAVALLASGVVVTQSGLVGIAYADDGGGSD* |
| Ga0055467_100423142 | 3300003996 | Natural And Restored Wetlands | MKRIFASILLAVALLTAGVTTTQYSLVGAAYADGDCGDF* |
| Ga0066388_1038283232 | 3300005332 | Tropical Forest Soil | MKLLIVNILLAIALLTSGVVVPQSNLVGTAYAESDGGSD* |
| Ga0068861_1023306021 | 3300005719 | Switchgrass Rhizosphere | MKRLIASVVLAIALLTSGAVVPQASLVGTAYADGDGGGD* |
| Ga0068861_1023306022 | 3300005719 | Switchgrass Rhizosphere | MKRLIASVVVVVALLTSGAVVPQASLVGTAYADGDGGGD* |
| Ga0066903_1007293871 | 3300005764 | Tropical Forest Soil | MKRLIASVVLAIALLTSGVVATQYTMVGTAYADSGGGD* |
| Ga0066903_1018015893 | 3300005764 | Tropical Forest Soil | MKRLIASVVLAIALLTSGVVVTQYNMVGTAYADGSGE* |
| Ga0066903_1075839241 | 3300005764 | Tropical Forest Soil | MIMKRLIASVVLAIALLTSGVVVTQYSMVGIAHADGGDGG* |
| Ga0068870_101567561 | 3300005840 | Miscanthus Rhizosphere | KPQGELAMKRLITSVLLAVALLTSGLVVTHSGIVGMAYADDGGGE* |
| Ga0081538_102111522 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKRFVASMLLAIALLTSGLVVTQYDMVGTAYADDGAGSD* |
| Ga0081539_102470872 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKRLIVSVILAIVLFTSGAVVPQSSLVGTAYAEEGGSE* |
| Ga0066659_111592722 | 3300006797 | Soil | MKRLIVSVLLAIILVTSGAATTQHSMVGTAYADDGRGGD* |
| Ga0075421_1001072553 | 3300006845 | Populus Rhizosphere | VATIVLAIALLTSGMAVTQSSLVGTAYADEGGSD* |
| Ga0075421_1007800124 | 3300006845 | Populus Rhizosphere | MKRLVATIVLAIALLTSGMAVTQSSLVGTAYADEGG |
| Ga0075421_1017333701 | 3300006845 | Populus Rhizosphere | GTMKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE* |
| Ga0075430_1006520872 | 3300006846 | Populus Rhizosphere | MKRIIASILLALALLTSGAMGTQYNMTGIAYADAGGGDF* |
| Ga0075433_116528431 | 3300006852 | Populus Rhizosphere | MKRLICGVVLAIVLLTSGAVVPQASLVGSAYADDCGGE |
| Ga0075420_1006213572 | 3300006853 | Populus Rhizosphere | MKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE* |
| Ga0099791_103457551 | 3300007255 | Vadose Zone Soil | MKRFMASVVLAIALLTSGVVVTQYSMVGTAYADGDSGD* |
| Ga0066710_1001948242 | 3300009012 | Grasslands Soil | MKRLIASVLLAFTLLTSGMGVTQYNMVGTAYANGGE |
| Ga0066710_1001948243 | 3300009012 | Grasslands Soil | MKRFIASVVLAIALLTSGVAVTQYSMVGTVYANGGE |
| Ga0066710_1002851632 | 3300009012 | Grasslands Soil | MKRLILSVVLSIALLTSSMVATQSSLVGTAYADDGGGE |
| Ga0099829_100808892 | 3300009038 | Vadose Zone Soil | MKRLIASVVLAIALLTSGAVLTQHSMVGTAYADGCGD* |
| Ga0099829_104685132 | 3300009038 | Vadose Zone Soil | MKRLIASVVLAIALLTSGAVVTQSSLVGTAYADSGGGE* |
| Ga0099828_109920572 | 3300009089 | Vadose Zone Soil | MKRFITSVVLAIALLTSGVVVTQYSMVGTAYADGDDGA* |
| Ga0099827_100361012 | 3300009090 | Vadose Zone Soil | MKRLISIIVLAIALLTSGVVVTQSSLVGTAYAGNAAGGGD* |
| Ga0099827_100400182 | 3300009090 | Vadose Zone Soil | MKRFIASVVLAIALLTSGVVVTQYSMVGTAYADDGAD* |
| Ga0099827_100400183 | 3300009090 | Vadose Zone Soil | MKRFIASVVLAIALLTSGVVVTQYSLVGTAYADDGAD* |
| Ga0099827_100981392 | 3300009090 | Vadose Zone Soil | MKRLMASVVLAIALLTSGVVVTQYSIVGTAYADSDGGAE* |
| Ga0099827_105255751 | 3300009090 | Vadose Zone Soil | MKRLIASVVLAIALLTSGVVVTQHSMVGTAYADGSGE* |
| Ga0111539_1000822011 | 3300009094 | Populus Rhizosphere | MKRLIASVVVVVALLTSGVVVTQSSLVGTAYADGGGD* |
| Ga0111539_1000822012 | 3300009094 | Populus Rhizosphere | MKRLIASVVVVVALLTSGAVVTQSNLVGTAYADGGGD* |
| Ga0111539_102173043 | 3300009094 | Populus Rhizosphere | AGTMKRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE* |
| Ga0066709_1001337983 | 3300009137 | Grasslands Soil | MKKLIVSVLLAITLLMSGMVVTQYNMVGTAYADGGGDC* |
| Ga0099792_105525992 | 3300009143 | Vadose Zone Soil | MKRLIASVVLAIALLTSGAVVSQSSLVGTAYADGGGGE* |
| Ga0099792_108107231 | 3300009143 | Vadose Zone Soil | RLIASVVLAIALLTSGVVVTQHSMVGTAYADGSGE* |
| Ga0114129_127731171 | 3300009147 | Populus Rhizosphere | MKRLLASVVLAIVLLTSGAVVPQSGLVGSAYADDCGGE* |
| Ga0114945_100291902 | 3300009444 | Thermal Springs | MKRLIVSVVLAIALLTSGVVVTQHSMVGAAYADDSDGGG* |
| Ga0114945_108527452 | 3300009444 | Thermal Springs | MNGDMIMKRLIASVVLAIALLTSGVVVTQSSLVGTAYADDSGD* |
| Ga0114944_10088232 | 3300009691 | Thermal Springs | MKRFIASVVLAIALLTSGVVVTQYNMVGTAYADDDPGE* |
| Ga0114944_10115743 | 3300009691 | Thermal Springs | MKRLIASVVLAIALLTSGVVVSQYSMIGTAYADDAAGD* |
| Ga0114944_10603312 | 3300009691 | Thermal Springs | MKRFIASVVLAIALLTSSAVVTQYSMVGTAYADGDSGE* |
| Ga0114944_10716251 | 3300009691 | Thermal Springs | MKRLIASVVLAIALLTSGMVVTQYSMVGTVYADDGGGM* |
| Ga0105064_11027811 | 3300009821 | Groundwater Sand | MKRFMASVVLAIALLTSSVVVTQYSMVGTAYADDSCGSD* |
| Ga0105066_10709032 | 3300009822 | Groundwater Sand | MKRFMASVVLAIVLLTSSVVVTQYSIVGTAYADGDAGAE* |
| Ga0126384_112691171 | 3300010046 | Tropical Forest Soil | MKGLVISVVLVIALFTTGAMVTQSSLVGTAYAESDGGS* |
| Ga0126382_101421072 | 3300010047 | Tropical Forest Soil | MKRLIASVVLAIALLTSGVVVTQYSMVGIAHADGGDGG* |
| Ga0126382_104002012 | 3300010047 | Tropical Forest Soil | LIASVVLAIALLTSSAVVTQFSLVGIAYADDGGGE* |
| Ga0126382_105641792 | 3300010047 | Tropical Forest Soil | MKILVVRIMLVIALLTSGGVVTQSRLVGTAYAGEGGGE* |
| Ga0126382_111453552 | 3300010047 | Tropical Forest Soil | MKRLIASVVVVVVLLTSGAVVTQSRLVGTAYAESGGGGD* |
| Ga0126382_115916422 | 3300010047 | Tropical Forest Soil | MKQFIVSVVLAIALLTSGVVVTQDPMVGVAYADGDGGE* |
| Ga0126382_120063601 | 3300010047 | Tropical Forest Soil | MKRFIASVLLAIALLTSGVVVTQYSMIGTAHADSGDGG* |
| Ga0126372_103177352 | 3300010360 | Tropical Forest Soil | RTSMKRLIASMLLAIALLTSGAVVTQSSLVGTAYAEGGGD* |
| Ga0126377_100763074 | 3300010362 | Tropical Forest Soil | MKRLIASVVIAIALLTSGAVVTQSKLVGTAYASDSGGD* |
| Ga0126379_104386901 | 3300010366 | Tropical Forest Soil | MKKLVVSLALAIILITSGVVVTQHSLVGTAYADGCGD* |
| Ga0126379_110593451 | 3300010366 | Tropical Forest Soil | MKRLIVSVILAITLLTSGVVVTQYSMVSTAQADSGGE |
| Ga0126379_110593452 | 3300010366 | Tropical Forest Soil | MRRFVASVILAIALLTSGTVVTQYNMVGTAQADSGGE* |
| Ga0118731_1146147652 | 3300010392 | Marine | MKRLIATIMLAVALLTSGALVGQFDMLGTAYADGDGGE* |
| Ga0126383_101384312 | 3300010398 | Tropical Forest Soil | MKKLVVSIALAIILITSGVVVTQHSLVGTAYADGCGD* |
| Ga0126383_101384313 | 3300010398 | Tropical Forest Soil | MKKLVVSIVLAIILITSGVVVTQHSLVGTAYADGCGD* |
| Ga0126383_133610312 | 3300010398 | Tropical Forest Soil | MKRLIVSVVLAIVLLTSGAMVPQSSLVGTAYADGDGGDC* |
| Ga0137392_114869121 | 3300011269 | Vadose Zone Soil | MKRLIASVVLAIALLTSGAVVSQSSLVGTAYAEAGGD* |
| Ga0137433_10166388 | 3300011440 | Soil | MKRLIVSVVLAISLLTAGVVATQYGLVGTASADGDAGGC* |
| Ga0137388_105987341 | 3300012189 | Vadose Zone Soil | MKRLIASVVLAIALLTSGAVVSQSSLVGTAYADDGGGF* |
| Ga0137374_100145813 | 3300012204 | Vadose Zone Soil | MKRFMASVILAIALLTSSVVVTQYSMVGTAHADGDAGSD* |
| Ga0137362_102471302 | 3300012205 | Vadose Zone Soil | MKRLIASVVLAIALLTSGVVVTQHSMVGTAHADGSGE* |
| Ga0137380_101452423 | 3300012206 | Vadose Zone Soil | MKRFIASVVLAIALLTSGAVVSQFSMVGVAYADDSG |
| Ga0137381_100714123 | 3300012207 | Vadose Zone Soil | MKRFIASVVLAIALLTSGVAVTQYSMVGTVYANGGE* |
| Ga0137379_100600673 | 3300012209 | Vadose Zone Soil | MKRLIASVVLAIALLTSGMVVTQSSLVGTAYADCSGGE* |
| Ga0137379_101786781 | 3300012209 | Vadose Zone Soil | MKRFIASVVLAIALLTSGAVVSQFSMVGAAYADDGGE* |
| Ga0137371_102797132 | 3300012356 | Vadose Zone Soil | MKRLILSVVLSIALLTSSMVVTQSSLVGTAYADDGGGE* |
| Ga0137371_108712181 | 3300012356 | Vadose Zone Soil | MVLENPNRRTVMKRFIASVVLAIALLTSGVVVTQYSLVGTAYADDGA |
| Ga0137360_112014311 | 3300012361 | Vadose Zone Soil | MKRLIASVVLAIALLTSGAVVSQSSLVGTAYADGGGGE |
| Ga0137407_122152251 | 3300012930 | Vadose Zone Soil | MKRFMASVVLAIALLTSSVVVTQYSMVGTTYAEESGSDN* |
| Ga0137410_102256602 | 3300012944 | Vadose Zone Soil | MKRLIASVVLAIALLTSGVVVTQHSMVGTAYADGCGE* |
| Ga0126375_107266161 | 3300012948 | Tropical Forest Soil | MKRLVVVIVTVIALLTSGVAVTQHSTVGTAYADAGGD* |
| Ga0126375_111201501 | 3300012948 | Tropical Forest Soil | MKRLVASIVLAIALLTSGAVVTQSRLVGTAYAEAGGD* |
| Ga0126375_114170901 | 3300012948 | Tropical Forest Soil | MKKLIASVLLAIALLTSGTVVTQSSLVGTAYADDGCGGD* |
| Ga0126375_118279562 | 3300012948 | Tropical Forest Soil | MKRLIASVVLAIVLLTSGVVVPQSNLVGTAYAESDGGTD* |
| Ga0163162_103572282 | 3300013306 | Switchgrass Rhizosphere | MKRLIASVVLAIALLTSGAMVTQSSLVGTAYADDSGGE* |
| Ga0157375_122480552 | 3300013308 | Miscanthus Rhizosphere | CTMKRLIASVVVVVALLTSGAVVTQSNLIGTAYAEDSGD* |
| Ga0137418_100321042 | 3300015241 | Vadose Zone Soil | MKRLIASVVLAIALLTSGVVVTQHSMVGTAYADAGGE* |
| Ga0184623_100346584 | 3300018056 | Groundwater Sediment | MKRLIATVLIAIALLTSGVVVTQYSMVGTAYADDSGGE |
| Ga0184637_100798212 | 3300018063 | Groundwater Sediment | MKQLIVSALLAIALLTSGMMVTPYSMVGTAYADGGEGSE |
| Ga0184627_106522621 | 3300018079 | Groundwater Sediment | MKRMIVSVLIAIALLTSGVVVTQYGMVGTAHAEGGDGG |
| Ga0184639_102626022 | 3300018082 | Groundwater Sediment | MKRMIVSVLIAIALLTSGVVVTQYGMVGTAYADEGGGD |
| Ga0180114_12849151 | 3300019232 | Groundwater Sediment | MKRLIVSVVLAIALLTSGVVVTQDSMVGTAYADDGGGN |
| Ga0180114_12849152 | 3300019232 | Groundwater Sediment | MKRLIVGVVLAIALLTSGVVVTQDSMVSTAYADDGGGN |
| Ga0184648_12346671 | 3300019249 | Groundwater Sediment | MIVSVLLAIALLTSGVVVTQYRMVGTAYADGGDGGT |
| Ga0184648_12346672 | 3300019249 | Groundwater Sediment | MKRFVASVLIAIALLTSGVVVTQYSMVGTAYADGDDGG |
| Ga0184648_13656371 | 3300019249 | Groundwater Sediment | MKRLIASVVLAIALLTSGTVVTQYRLAGTAYADDGGGSE |
| Ga0184646_10472031 | 3300019259 | Groundwater Sediment | MKRLIASVLLAIALLTSGAAVTQSSMVGTAYADDGP |
| Ga0184646_12130501 | 3300019259 | Groundwater Sediment | MVMKRFVASVLIAIALLTSGVVVTQYSMVGTAYADGGGGE |
| Ga0180118_12120831 | 3300020063 | Groundwater Sediment | MKRLIASVLLAIALLTSGMVVTQYSMVGTVYADDGGGE |
| Ga0180113_11223012 | 3300020065 | Groundwater Sediment | MKRFIASVLLAIALLTSGVVVTQYSMVGTAYADDGDGA |
| Ga0212128_100308562 | 3300022563 | Thermal Springs | MQRLVVSMLVALALLASGVVVTQYSTVGTAYADDGDGGG |
| Ga0212128_100308563 | 3300022563 | Thermal Springs | MKRLIASVVLAIALLTSGVVVSQYSMIGTAYADDAAGD |
| Ga0212128_100999382 | 3300022563 | Thermal Springs | MKRFIASVVLAIALLTSGVVVTQYNMVGTAYADDDPGE |
| Ga0212128_101013943 | 3300022563 | Thermal Springs | MKRLIVSVVLAIALLTSGVVVTQHSMVGAAYADDSDGGG |
| Ga0212128_101285892 | 3300022563 | Thermal Springs | MKRFIASVVLAIALLTSSAVVTQYSMVGTAYADGDSGE |
| Ga0212128_102432602 | 3300022563 | Thermal Springs | LIVSVVLAIALLTSGAVVTQHSMVGTAYADDGDGGT |
| Ga0212128_102737172 | 3300022563 | Thermal Springs | MKRLIASVVLAIALLTSGMVVTQYSMVGTVYADDGGGM |
| Ga0212128_102980261 | 3300022563 | Thermal Springs | MKRFVASVLLAIALLTSGVVVTQYSMVGTAHADGSDGG |
| Ga0212128_104547802 | 3300022563 | Thermal Springs | MNGDMIMKRLIASVVLAIALLTSSVMVTQYNMVGTAYADDSGE |
| Ga0212128_107024361 | 3300022563 | Thermal Springs | MKRFIASVLVVLALLMSGVVVTQYSMVGIAHADGDDGGG |
| (restricted) Ga0233424_101649542 | 3300023208 | Freshwater | MKRLIVSIMVAMALLTAGIAGTQHSFVGTAYADGGDGGGD |
| Ga0207684_109190052 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRFIASVVLAIALLTSGVVVTQYSMVGTAYADDGAD |
| Ga0207712_108733611 | 3300025961 | Switchgrass Rhizosphere | MKRLIASVVLAIALLTSGAVVPQASLVGTAYADGDGGGD |
| Ga0207712_108733612 | 3300025961 | Switchgrass Rhizosphere | MKRLIASVVVVVALLTSGAVVPQASLVGTAYADGDGGGD |
| Ga0207703_121896371 | 3300026035 | Switchgrass Rhizosphere | MKRLIASVVLAIALLTSGVMVTQSSLVGTAYADDSGGEXYMLA |
| Ga0209590_100418842 | 3300027882 | Vadose Zone Soil | MKRLISIIVLAIALLTSGVVVTQSSLVGTAYAGNAAGGGD |
| Ga0209590_103280731 | 3300027882 | Vadose Zone Soil | MKRFIASVVLAIALLTSGVVVTQYSLVGTAYADDGAD |
| Ga0209382_103488192 | 3300027909 | Populus Rhizosphere | KRLIASVVVVVALLTSGAVVTQSRLVGMAYADGGGE |
| Ga0209853_10087303 | 3300027961 | Groundwater Sand | MKRFMASVVIAIVLLTSSVVVTQYSIVGTAYADGDAG |
| Ga0137415_103787882 | 3300028536 | Vadose Zone Soil | MKRLIASVVLAIALLTSGVVVTQHSMVGTAYADAGGE |
| Ga0247612_10271082 | 3300030592 | Soil | MKRLIASVVLAIALLTSGMVATQYGLVGTAYADDGGGTD |
| Ga0268386_101041342 | 3300030619 | Soil | MKKFVATVLLAVALLTSGVVVTQYGMVGTAHADDGGGEG |
| Ga0308199_10047552 | 3300031094 | Soil | MKRLIASVFLALALLTSGVVVTQYSMVGIAYADDGGGN |
| Ga0308194_100246332 | 3300031421 | Soil | MKRLIVSVVLAIALLTSGLAVTQYSMVGTAYADGGAE |
| Ga0310886_107082821 | 3300031562 | Soil | MKRLIASVVVVVALLTSGAVVTQSNLVGTAYADGGGD |
| Ga0370545_011787_1101_1217 | 3300034643 | Soil | MKRVIVSVLLAIALLTSGVVVTQYGMVGTAYADEGGGS |
| Ga0370545_011787_922_1038 | 3300034643 | Soil | MKQFVASVLLAIALLTSGVVVTQYGMVGTAYAEDDGGG |
| Ga0314780_124506_491_610 | 3300034659 | Soil | CTMKRLIASVVVVVALLTSGAVVPQSRLLGMAYADSGSD |
| ⦗Top⦘ |