


| Basic Information | |
|---|---|
| Family ID | F065501 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 43 residues |
| Representative Sequence | DGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 98.43 % |
| % of genes from short scaffolds (< 2000 bps) | 89.76 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.504 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (11.024 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.646 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.071 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 5.51 |
| PF03401 | TctC | 3.94 |
| PF01521 | Fe-S_biosyn | 3.15 |
| PF04545 | Sigma70_r4 | 3.15 |
| PF03795 | YCII | 1.57 |
| PF12680 | SnoaL_2 | 1.57 |
| PF00440 | TetR_N | 1.57 |
| PF08327 | AHSA1 | 1.57 |
| PF10282 | Lactonase | 1.57 |
| PF13505 | OMP_b-brl | 1.57 |
| PF07690 | MFS_1 | 1.57 |
| PF00072 | Response_reg | 0.79 |
| PF07152 | YaeQ | 0.79 |
| PF05995 | CDO_I | 0.79 |
| PF04536 | TPM_phosphatase | 0.79 |
| PF00795 | CN_hydrolase | 0.79 |
| PF01614 | IclR | 0.79 |
| PF11752 | DUF3309 | 0.79 |
| PF04199 | Cyclase | 0.79 |
| PF09423 | PhoD | 0.79 |
| PF11871 | DUF3391 | 0.79 |
| PF01042 | Ribonuc_L-PSP | 0.79 |
| PF12792 | CSS-motif | 0.79 |
| PF01738 | DLH | 0.79 |
| PF09084 | NMT1 | 0.79 |
| PF00665 | rve | 0.79 |
| PF04972 | BON | 0.79 |
| PF00392 | GntR | 0.79 |
| PF13360 | PQQ_2 | 0.79 |
| PF02826 | 2-Hacid_dh_C | 0.79 |
| PF00111 | Fer2 | 0.79 |
| PF00211 | Guanylate_cyc | 0.79 |
| PF00378 | ECH_1 | 0.79 |
| PF00403 | HMA | 0.79 |
| PF01554 | MatE | 0.79 |
| PF00528 | BPD_transp_1 | 0.79 |
| PF01926 | MMR_HSR1 | 0.79 |
| PF12849 | PBP_like_2 | 0.79 |
| PF00691 | OmpA | 0.79 |
| PF07479 | NAD_Gly3P_dh_C | 0.79 |
| PF13683 | rve_3 | 0.79 |
| PF02518 | HATPase_c | 0.79 |
| PF02738 | MoCoBD_1 | 0.79 |
| PF13167 | GTP-bdg_N | 0.79 |
| PF05231 | MASE1 | 0.79 |
| PF12697 | Abhydrolase_6 | 0.79 |
| PF00857 | Isochorismatase | 0.79 |
| PF11294 | DUF3095 | 0.79 |
| PF13442 | Cytochrome_CBB3 | 0.79 |
| PF01527 | HTH_Tnp_1 | 0.79 |
| PF00326 | Peptidase_S9 | 0.79 |
| PF03466 | LysR_substrate | 0.79 |
| PF13419 | HAD_2 | 0.79 |
| PF12244 | DUF3606 | 0.79 |
| PF00710 | Asparaginase | 0.79 |
| PF00300 | His_Phos_1 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.94 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 3.15 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 3.15 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.57 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.57 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.79 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.79 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.79 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.79 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.79 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.79 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.79 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.79 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.79 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.79 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.79 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.79 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.79 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.79 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.79 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.79 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.79 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
| COG4681 | Uncharacterized conserved protein YaeQ, suppresses RfaH defect | Function unknown [S] | 0.79 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.29 % |
| Unclassified | root | N/A | 30.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004052|Ga0055490_10158239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300004463|Ga0063356_100270386 | Not Available | 2079 | Open in IMG/M |
| 3300005176|Ga0066679_10089417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. OB1 | 1854 | Open in IMG/M |
| 3300005336|Ga0070680_101738669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300005540|Ga0066697_10271291 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005557|Ga0066704_10240552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1228 | Open in IMG/M |
| 3300005558|Ga0066698_10444661 | Not Available | 885 | Open in IMG/M |
| 3300005568|Ga0066703_10048093 | All Organisms → cellular organisms → Bacteria | 2378 | Open in IMG/M |
| 3300005713|Ga0066905_100800157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 818 | Open in IMG/M |
| 3300005840|Ga0068870_10716753 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300006032|Ga0066696_10455191 | Not Available | 838 | Open in IMG/M |
| 3300006032|Ga0066696_11030150 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006847|Ga0075431_100013489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 8253 | Open in IMG/M |
| 3300006852|Ga0075433_11615678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 559 | Open in IMG/M |
| 3300006854|Ga0075425_102494252 | Not Available | 572 | Open in IMG/M |
| 3300006871|Ga0075434_100078517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3296 | Open in IMG/M |
| 3300006876|Ga0079217_10822816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300006894|Ga0079215_10037617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1787 | Open in IMG/M |
| 3300006894|Ga0079215_10306253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300006894|Ga0079215_10319146 | Not Available | 869 | Open in IMG/M |
| 3300006904|Ga0075424_100147924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. WS9 | 2488 | Open in IMG/M |
| 3300006954|Ga0079219_10356008 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300007004|Ga0079218_10023904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3404 | Open in IMG/M |
| 3300007004|Ga0079218_10316418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1278 | Open in IMG/M |
| 3300007004|Ga0079218_13952309 | Not Available | 504 | Open in IMG/M |
| 3300007255|Ga0099791_10201468 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300009012|Ga0066710_101984040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 864 | Open in IMG/M |
| 3300009012|Ga0066710_102906432 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300009053|Ga0105095_10170116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocucumis → Methylocucumis oryzae | 1192 | Open in IMG/M |
| 3300009087|Ga0105107_10178247 | Not Available | 1492 | Open in IMG/M |
| 3300009087|Ga0105107_11079992 | Not Available | 559 | Open in IMG/M |
| 3300009088|Ga0099830_11229526 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009089|Ga0099828_11428768 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009137|Ga0066709_101586573 | Not Available | 938 | Open in IMG/M |
| 3300009137|Ga0066709_101867865 | Not Available | 838 | Open in IMG/M |
| 3300009137|Ga0066709_102528878 | Not Available | 691 | Open in IMG/M |
| 3300009153|Ga0105094_10136656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1393 | Open in IMG/M |
| 3300009157|Ga0105092_10845962 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009171|Ga0105101_10345750 | Not Available | 721 | Open in IMG/M |
| 3300010045|Ga0126311_11250934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300010045|Ga0126311_11609223 | Not Available | 547 | Open in IMG/M |
| 3300010128|Ga0127486_1032735 | Not Available | 711 | Open in IMG/M |
| 3300010399|Ga0134127_10430239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1314 | Open in IMG/M |
| 3300010400|Ga0134122_11848081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 637 | Open in IMG/M |
| 3300010401|Ga0134121_10977955 | Not Available | 829 | Open in IMG/M |
| 3300011399|Ga0137466_1056630 | Not Available | 613 | Open in IMG/M |
| 3300011413|Ga0137333_1121948 | Not Available | 602 | Open in IMG/M |
| 3300011417|Ga0137326_1018219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1515 | Open in IMG/M |
| 3300011428|Ga0137456_1203261 | Not Available | 536 | Open in IMG/M |
| 3300011441|Ga0137452_1224944 | Not Available | 636 | Open in IMG/M |
| 3300011441|Ga0137452_1314396 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012034|Ga0137453_1051025 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012140|Ga0137351_1051689 | Not Available | 583 | Open in IMG/M |
| 3300012159|Ga0137344_1094026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300012160|Ga0137349_1014408 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300012199|Ga0137383_11263405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 528 | Open in IMG/M |
| 3300012203|Ga0137399_11592111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella pertussis | 541 | Open in IMG/M |
| 3300012206|Ga0137380_10126553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2334 | Open in IMG/M |
| 3300012361|Ga0137360_11133725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300012362|Ga0137361_10340687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1375 | Open in IMG/M |
| 3300012913|Ga0157298_10330996 | Not Available | 553 | Open in IMG/M |
| 3300012918|Ga0137396_10163805 | Not Available | 1624 | Open in IMG/M |
| 3300012922|Ga0137394_11152532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300012922|Ga0137394_11258153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300012930|Ga0137407_10928834 | Not Available | 823 | Open in IMG/M |
| 3300014265|Ga0075314_1096928 | Not Available | 634 | Open in IMG/M |
| 3300014271|Ga0075326_1286963 | Not Available | 513 | Open in IMG/M |
| 3300014873|Ga0180066_1075406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 686 | Open in IMG/M |
| 3300014877|Ga0180074_1120030 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300014883|Ga0180086_1088618 | Not Available | 778 | Open in IMG/M |
| 3300014885|Ga0180063_1178513 | Not Available | 679 | Open in IMG/M |
| 3300017792|Ga0163161_11500242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300017930|Ga0187825_10353001 | Not Available | 557 | Open in IMG/M |
| 3300017939|Ga0187775_10114068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 923 | Open in IMG/M |
| 3300018422|Ga0190265_10173349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2138 | Open in IMG/M |
| 3300018422|Ga0190265_11100010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300018422|Ga0190265_11125713 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300018422|Ga0190265_11215556 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300018432|Ga0190275_10395128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12 | 1391 | Open in IMG/M |
| 3300018468|Ga0066662_11823814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 636 | Open in IMG/M |
| 3300019238|Ga0180112_1332268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300019361|Ga0173482_10268306 | Not Available | 735 | Open in IMG/M |
| 3300020215|Ga0196963_10454167 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 578 | Open in IMG/M |
| 3300021067|Ga0196978_1048361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300021080|Ga0210382_10373833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300021081|Ga0210379_10144949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300025160|Ga0209109_10240802 | Not Available | 880 | Open in IMG/M |
| 3300025165|Ga0209108_10066488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1979 | Open in IMG/M |
| 3300025917|Ga0207660_11401595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300025930|Ga0207701_10618582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300025960|Ga0207651_10457571 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300025986|Ga0207658_11692854 | Not Available | 578 | Open in IMG/M |
| 3300026041|Ga0207639_12267762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300026089|Ga0207648_12267152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300026121|Ga0207683_11591975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300026295|Ga0209234_1102276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1080 | Open in IMG/M |
| 3300026310|Ga0209239_1039545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2182 | Open in IMG/M |
| 3300026343|Ga0209159_1121936 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300026542|Ga0209805_1060108 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300027395|Ga0209996_1015676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300027471|Ga0209995_1100159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300027543|Ga0209999_1022372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae | 1163 | Open in IMG/M |
| 3300027543|Ga0209999_1025742 | Not Available | 1086 | Open in IMG/M |
| 3300027639|Ga0209387_1111288 | Not Available | 681 | Open in IMG/M |
| 3300027663|Ga0208990_1007435 | Not Available | 3634 | Open in IMG/M |
| 3300027713|Ga0209286_1131575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 923 | Open in IMG/M |
| 3300027713|Ga0209286_1328131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300027731|Ga0209592_1344518 | Not Available | 505 | Open in IMG/M |
| 3300027886|Ga0209486_10240684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300027909|Ga0209382_11755621 | Not Available | 606 | Open in IMG/M |
| 3300028536|Ga0137415_10455434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1085 | Open in IMG/M |
| 3300028592|Ga0247822_10429597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-12 | 1034 | Open in IMG/M |
| 3300031226|Ga0307497_10516735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300031548|Ga0307408_102093413 | Not Available | 545 | Open in IMG/M |
| 3300031820|Ga0307473_10918260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 633 | Open in IMG/M |
| 3300031912|Ga0306921_10195018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2374 | Open in IMG/M |
| 3300031965|Ga0326597_11412870 | Not Available | 673 | Open in IMG/M |
| 3300031995|Ga0307409_102178698 | Not Available | 584 | Open in IMG/M |
| 3300032002|Ga0307416_102248199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex | 646 | Open in IMG/M |
| 3300032061|Ga0315540_10073376 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300032061|Ga0315540_10088999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Zetaproteobacteria → unclassified Zetaproteobacteria → Zetaproteobacteria bacterium CG_4_10_14_0_8_um_filter_49_80 | 1428 | Open in IMG/M |
| 3300032075|Ga0310890_10215313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1328 | Open in IMG/M |
| 3300032157|Ga0315912_10073125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2693 | Open in IMG/M |
| 3300032157|Ga0315912_10537837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300032180|Ga0307471_100005619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7861 | Open in IMG/M |
| 3300033550|Ga0247829_10260118 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300034676|Ga0314801_069597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 735 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 11.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.15% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.36% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.36% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.57% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011399 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012140 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021067 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055490_101582393 | 3300004052 | Natural And Restored Wetlands | ALLAVFVADYGKDEEYKGIAGQIAAFLAKPRKVKPCPPA* |
| Ga0063356_1002703863 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DGRALLANFVANYGKVEEFRGIAGQITTFLDKARKVKPCPPA* |
| Ga0066679_100894171 | 3300005176 | Soil | LDGRALLANFVANYGKVEENKGIAGQITAFLDKARRLKPCPPA* |
| Ga0070680_1017386692 | 3300005336 | Corn Rhizosphere | RAALANFVATYGKVDEFKGIAGQITVFLDKARKPKPCPPA* |
| Ga0066697_102712911 | 3300005540 | Soil | ECRRLAQERLDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKACPPA* |
| Ga0066704_102405523 | 3300005557 | Soil | LDGRALLVSFVDNYGKVEENKGIAGQITAFLNKARKVKPCSPA* |
| Ga0066698_104446612 | 3300005558 | Soil | LVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA* |
| Ga0066703_100480931 | 3300005568 | Soil | LDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKACPPA* |
| Ga0066905_1008001571 | 3300005713 | Tropical Forest Soil | NDGRAHLEYFVATWGNLEEFKGIAGQISAFLGKARKPRPCP* |
| Ga0068870_107167532 | 3300005840 | Miscanthus Rhizosphere | LLVNFVDNYGKVEENKGIAGQITAFLGKARKVKPCPPA* |
| Ga0066696_104551911 | 3300006032 | Soil | ERLDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKLCPPA* |
| Ga0066696_110301501 | 3300006032 | Soil | ERLDGRALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKACPPA* |
| Ga0075431_10001348910 | 3300006847 | Populus Rhizosphere | VLENFVATYGKVDEFREIAGQITAFLARARKVKPCPPAS* |
| Ga0075433_116156783 | 3300006852 | Populus Rhizosphere | ALLVNFVDNYGKVEENKGIAGRITAFLGKTRKVKPCPPA* |
| Ga0075425_1024942521 | 3300006854 | Populus Rhizosphere | ECRRLEQERLDGRAVLENFVANYGKDEEFKGIGGRINAFLNEPRKARPCPPA* |
| Ga0075434_1000785171 | 3300006871 | Populus Rhizosphere | ECRRLEQERLDGRAVRENFANYGKDEEFKGIGGRINAFLKEPRKAKPCR* |
| Ga0079217_108228161 | 3300006876 | Agricultural Soil | QEQLEGRALLANFVANHGKVEEFQGIAGQISAFLDKAGNVKQCPPA* |
| Ga0079215_100376174 | 3300006894 | Agricultural Soil | QERLDGRAVLAGFVASYGKVEEYKGIAGQITAFLNKARKAKPCPPA* |
| Ga0079215_103062534 | 3300006894 | Agricultural Soil | QERLEGRAVLSNFVSNYGKDEEYTGIAGEISAFLGKARTEKPCPPA* |
| Ga0079215_103191461 | 3300006894 | Agricultural Soil | GREVLENFVATYGTVDEFKGIAGQISAFLKKARKPKPCPPA* |
| Ga0075424_1001479244 | 3300006904 | Populus Rhizosphere | VLENFVANYGKDEEFKGIGGRINAFLNEPRKARPCPPA* |
| Ga0079219_103560082 | 3300006954 | Agricultural Soil | EQERLDGRAVLANFVATYGEVDEFKEIAGQITAFLDKARKVKPCPPA* |
| Ga0079218_100239041 | 3300007004 | Agricultural Soil | CRRLEQERSEGRAMLENFVANYGKVDEFKGIGGQITAFLGKARKVKPCPPA* |
| Ga0079218_103164181 | 3300007004 | Agricultural Soil | CRRLEQERSEGRAMLENFVANYGKVDEFKGIGGQITAFLGRARKVKPCPPA* |
| Ga0079218_139523092 | 3300007004 | Agricultural Soil | GRALLENFVATYGKVDEFKGIAGQITAFLGKARKVKPCPPA* |
| Ga0099791_102014683 | 3300007255 | Vadose Zone Soil | DGRALLVSFVDNYGKVEENKGIAGQITAFLAKARKAMPCPPA* |
| Ga0066710_1019840401 | 3300009012 | Grasslands Soil | RALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA |
| Ga0066710_1029064322 | 3300009012 | Grasslands Soil | ECRRLEQERLDGRALLVNFVDNYGKLEENKGIARQITAFLNKARKVKPCPPA |
| Ga0105095_101701163 | 3300009053 | Freshwater Sediment | RLDGRALLENFVANYGKVEEFKGIAGQITAFLGKARKVKPCPPA* |
| Ga0105107_101782472 | 3300009087 | Freshwater Sediment | RALLENFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0105107_110799922 | 3300009087 | Freshwater Sediment | LDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0099830_112295262 | 3300009088 | Vadose Zone Soil | DGRALLANFVATYGKVEEFKEIAGQITTFLDKARKVKPCPPG* |
| Ga0099828_114287684 | 3300009089 | Vadose Zone Soil | RALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0066709_1015865731 | 3300009137 | Grasslands Soil | RALLVNFVDNYGKVEENKGIAGQITAFLAKARKMKLCPPA* |
| Ga0066709_1018678651 | 3300009137 | Grasslands Soil | RRLAQERLDGRALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA* |
| Ga0066709_1025288781 | 3300009137 | Grasslands Soil | LLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA* |
| Ga0105094_101366561 | 3300009153 | Freshwater Sediment | HLADFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0105092_108459622 | 3300009157 | Freshwater Sediment | ERLDGRALLANFVATYGKVDEFKGIAGQISAFLNKARKVKPCPPAS* |
| Ga0105101_103457502 | 3300009171 | Freshwater Sediment | CRRLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDEARKVKPCPPA* |
| Ga0126311_112509342 | 3300010045 | Serpentine Soil | RLEQERSDGRALLANFVANYGKVEEFKGIAGQISAFLDKARKVKPCPPA* |
| Ga0126311_116092231 | 3300010045 | Serpentine Soil | LLTSFVDKYGKVDEFKAIAGQISAFLAKARTVKPCPPA* |
| Ga0127486_10327352 | 3300010128 | Grasslands Soil | VNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA* |
| Ga0134127_104302391 | 3300010399 | Terrestrial Soil | ALLVNFVDNYGKVEENKGIAKQITKFLGKTGKAKACPPA* |
| Ga0134122_118480812 | 3300010400 | Terrestrial Soil | LENFIATYGKVAEFKEPAGHIAAFLGKPRKAKPCAPAS* |
| Ga0134121_109779551 | 3300010401 | Terrestrial Soil | SFVAKYGKVEEFTEIAGQISAFLEKPRKVKPCPPA* |
| Ga0137466_10566303 | 3300011399 | Soil | RECRRLEQERLDGRALLANFVATYGKVEEFKDIAGQITAFLDKARKVKPCPPA* |
| Ga0137333_11219481 | 3300011413 | Soil | ERLDGRALLENFVANYGKVEEFKGIAGQITAFLAKARKVKPCPPA* |
| Ga0137326_10182193 | 3300011417 | Soil | FVATYGNVEEFKEIAGQITAFLDKARKVKPCPPA* |
| Ga0137456_12032612 | 3300011428 | Soil | ERECRRLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0137452_12249441 | 3300011441 | Soil | LLANFVATYGKVDEFKEIAGQIAAFLDKARKVKPCPPA* |
| Ga0137452_13143961 | 3300011441 | Soil | NFVATYGKVDEFNVIAGQITAFLDKARKVKPCPPA* |
| Ga0137453_10510252 | 3300012034 | Soil | CRRLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0137351_10516891 | 3300012140 | Soil | QERNDGRALLANFVANYGKVEEFEEIAGQITAFLDKARKVKPCPPAG* |
| Ga0137344_10940262 | 3300012159 | Soil | ERSDGRALLANFVAKYGKVEELKGIAGQISAFLDKAPKPKPCPPA* |
| Ga0137349_10144081 | 3300012160 | Soil | CRRLEQERLDGRALLANFVATYGKVEEFKVIAGQITGFLDKARKVKPCPPTP* |
| Ga0137383_112634052 | 3300012199 | Vadose Zone Soil | RLAQERLDGRALLVSFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA* |
| Ga0137399_115921112 | 3300012203 | Vadose Zone Soil | LAQERLDGRALLVSFVDNYGKVEENKGIAGQITAFLDKARKVKPCPPA* |
| Ga0137380_101265531 | 3300012206 | Vadose Zone Soil | ERECRRLEQERLDGRALLANFVANYGKVEEFKGIEGQITAFLDKVRKVKPCPPA* |
| Ga0137360_111337251 | 3300012361 | Vadose Zone Soil | RLDGRALLANFVANYGKVEEFKGIAGQTTAFLDKVRKVKPCPPA* |
| Ga0137361_103406873 | 3300012362 | Vadose Zone Soil | ALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0157298_103309961 | 3300012913 | Soil | RLDGRMVLENFVANYGKVEEFKGIAGQISAFLAKARKAKPCPPA* |
| Ga0137396_101638052 | 3300012918 | Vadose Zone Soil | LLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0137394_111525321 | 3300012922 | Vadose Zone Soil | LEQERLDGRAVLANFVANYGKVEEFKGIAGQTTAFLDKVRKVKPCPPA* |
| Ga0137394_112581532 | 3300012922 | Vadose Zone Soil | ALLENFVATYGKVDEFKVIAGQITAFLDKARKVKPCPPA* |
| Ga0137407_109288342 | 3300012930 | Vadose Zone Soil | DGRALLVNFVDNYGKVEEFKGIAGQITAFLNKARKVKPCPPE* |
| Ga0075314_10969282 | 3300014265 | Natural And Restored Wetlands | LDGRAVLESFVATYGKVDEFKGIAGQITAFLAKARKVKPCPPA* |
| Ga0075326_12869631 | 3300014271 | Natural And Restored Wetlands | RALLAVFVADYGKDEEFKGIAGQIAAFLAKPRKVKPCPPA* |
| Ga0180066_10754061 | 3300014873 | Soil | RLDGRTLLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA* |
| Ga0180074_11200302 | 3300014877 | Soil | ERLDGRALLANFVANYGKVEEFKGIAGQITALLDKTRKVKPCPPA* |
| Ga0180086_10886182 | 3300014883 | Soil | LEQERLDGRALLENFVANYGKVEENKGIAGQITAFLAKARKVKPCPPA* |
| Ga0180063_11785132 | 3300014885 | Soil | DGRALLANFVATYGKVEEFKEIAGQITAFLDKARKVKPCPPA* |
| Ga0163161_115002422 | 3300017792 | Switchgrass Rhizosphere | RECRRLEQERLDGRALLENFVANYGKVEENKGIAGQISAFLGKPRKVKPCAPA |
| Ga0187825_103530012 | 3300017930 | Freshwater Sediment | ADFVDKYGKVDEFKGIAGQITAFLGKPRKAKPCPPA |
| Ga0187775_101140683 | 3300017939 | Tropical Peatland | NFVTSYGTVDEFKGIAGQIRAFLAKPRKEKACPPA |
| Ga0190265_101733493 | 3300018422 | Soil | CRRLEQERSEGRALLENFVASYGKVDEFKGIGGQISAFLAKARKVKPCPPA |
| Ga0190265_111000102 | 3300018422 | Soil | DGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Ga0190265_111257133 | 3300018422 | Soil | DGRALLANFVATYGKVEEFKEIAGQITAFLNKARKVKPCPPAS |
| Ga0190265_112155563 | 3300018422 | Soil | DGRALLANFVATYGKVEEFKEIAGQITAFLNKARKVKPCPPVP |
| Ga0190275_103951284 | 3300018432 | Soil | LENFVATYGKVDEFKGIAAQISAFLGKARKVKPCPPA |
| Ga0066662_118238143 | 3300018468 | Grasslands Soil | RALLVNFVDNYGKVEENKGIAGQITTFLAKARNVKPCPPA |
| Ga0180112_13322682 | 3300019238 | Groundwater Sediment | RRLEQERSDGRALLANFVATYGKVEEFKEIAGQITAFLNKARKVKPCPPA |
| Ga0173482_102683062 | 3300019361 | Soil | AEQERLDGRMVLENFVANYGKVEEFKGIAGQISAFLAKARKAKPCPPA |
| Ga0196963_104541672 | 3300020215 | Soil | QERSEGRALLGNFVATYGAVDEFKAIGGQISAFLAKARKAKPCPPAPS |
| Ga0196978_10483613 | 3300021067 | Soil | LENFVATYGKVDEFTGIAGQISAFLAKPRKVKPCPPA |
| Ga0210382_103738331 | 3300021080 | Groundwater Sediment | LLANFVATYGKVEEFKEIAGQISAFLDKARKVKPCPPA |
| Ga0210379_101449491 | 3300021081 | Groundwater Sediment | ECRRLEQERLDGRALLANFVATYGKVDEFKEIAGQITAFLDKARKVKPCPPA |
| Ga0209109_102408021 | 3300025160 | Soil | ECRRLEQERLDGRVLLANFVANYGKVEEFKGIAGQITTFLDKARKVKPCPPA |
| Ga0209108_100664885 | 3300025165 | Soil | LEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Ga0207660_114015951 | 3300025917 | Corn Rhizosphere | LEQESSDGRAALANFVATYGKVDEFKGIAGQITVFLDKARKPKPCPPA |
| Ga0207701_106185821 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QERSDGRALLENFVATYGKAEEFKGIAGQISAFLGKARKAKPCPPA |
| Ga0207651_104575711 | 3300025960 | Switchgrass Rhizosphere | LLENFVANYGKVEENKGIAGQISAFLGKPRKVKPCAPA |
| Ga0207658_116928541 | 3300025986 | Switchgrass Rhizosphere | VNFVDNYGKVEENKGIAGQIAAFLGRARKVKPCPPA |
| Ga0207639_122677621 | 3300026041 | Corn Rhizosphere | MVLENFVANYGKVEEFKGIAGQISAFLAKARKAKPCPPA |
| Ga0207648_122671522 | 3300026089 | Miscanthus Rhizosphere | LLENFVATYGKAEEFKGIAGQIRAFLDKARKVKPCPPA |
| Ga0207683_115919752 | 3300026121 | Miscanthus Rhizosphere | GRALLENFVATYGKAEEFKGIAGQISAFLGKARKAKPCPPA |
| Ga0209234_11022763 | 3300026295 | Grasslands Soil | ECRRLAQERLDGRALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA |
| Ga0209239_10395451 | 3300026310 | Grasslands Soil | ALLVSFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA |
| Ga0209159_11219362 | 3300026343 | Soil | DGRALLVNFVDNYGKVEENKGIAGQITAFLNKARKVKPCPPA |
| Ga0209805_10601081 | 3300026542 | Soil | ALLVNFVDNYGKVEENKGIAGQITTFLAKARKMKACPPA |
| Ga0209996_10156763 | 3300027395 | Arabidopsis Thaliana Rhizosphere | LLENFVANYGKVEENKGIAGQITAFLAKARKVKPCPPA |
| Ga0209995_11001591 | 3300027471 | Arabidopsis Thaliana Rhizosphere | LENFVANYGKVEENKGIAGQITAFLAKARKVKPCPPA |
| Ga0209999_10223721 | 3300027543 | Arabidopsis Thaliana Rhizosphere | LENFVATYGKVDEFKGIAGQIAAFLGKARKVKPCPPA |
| Ga0209999_10257423 | 3300027543 | Arabidopsis Thaliana Rhizosphere | NFVANYGKVDEFKGIAGQITTFLGKARKVKPCPPA |
| Ga0209387_11112881 | 3300027639 | Agricultural Soil | VLENFVATYGTVDEFKGIAGQISAFLKKARKPKPCPPA |
| Ga0208990_10074351 | 3300027663 | Forest Soil | ANFVANYGKVEEFEGIAGQITAFLDKARKVKPCPPA |
| Ga0209286_11315751 | 3300027713 | Freshwater Sediment | DFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Ga0209286_13281312 | 3300027713 | Freshwater Sediment | LDGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Ga0209592_13445181 | 3300027731 | Freshwater Sediment | DGRALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPT |
| Ga0209486_102406843 | 3300027886 | Agricultural Soil | AQERSDGRELLANFVANYGKVDEFKGIAGQISAFLARARKVKPCPPA |
| Ga0209382_117556211 | 3300027909 | Populus Rhizosphere | LLENFVANYGKVDEFKGIAGQISAFLGKARKVKPCPPA |
| Ga0137415_104554343 | 3300028536 | Vadose Zone Soil | LLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Ga0247822_104295971 | 3300028592 | Soil | SAGREVLENFVATYGAVDEFKGIAGQISAFLKKARKPKPCPPA |
| Ga0307497_105167352 | 3300031226 | Soil | RLEQERSDGRALLASFVAKYGKVDEFKEISGQISAFLDKARKPKPCPPAPK |
| Ga0307408_1020934132 | 3300031548 | Rhizosphere | RLEQERSDGREVLENFVATYGTVDEFKGIAGQISAFLKKARKVKPCPPA |
| Ga0307473_109182601 | 3300031820 | Hardwood Forest Soil | GRALLAKFVATYGEVDEFKEIAGQITAFLGKARKLKPCPPA |
| Ga0306921_101950184 | 3300031912 | Soil | GRALLTNFVDNYGKIDENKGIAGQITAFLAKPRKAKPCAPA |
| Ga0326597_114128702 | 3300031965 | Soil | ALLANFVANYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| Ga0307409_1021786982 | 3300031995 | Rhizosphere | CRRQEQERSDGRALLENFVATYGKVDEFKGIAGQISAFLGKARKVKPCPPA |
| Ga0307416_1022481992 | 3300032002 | Rhizosphere | RLEQERLDGRALLANFVANYGKVEEFKGIAGQITAFLKKARKAKPCPPA |
| Ga0315540_100733761 | 3300032061 | Salt Marsh Sediment | REGRALLASFVAKYGTVEEFKGIAGQISAFLDKPRKVKPCPPA |
| Ga0315540_100889991 | 3300032061 | Salt Marsh Sediment | GRALLASFVAKYGTVEEFKGIAGQISAFLDKPRKVKPCPPA |
| Ga0310890_102153131 | 3300032075 | Soil | ANFVATYGKVDEFKGIAGQISAFLGKARKAKPCPPA |
| Ga0315912_100731252 | 3300032157 | Soil | GREVLANFVATYGKVAEFKGIAGQISAFLDKAVKPKPCPPAG |
| Ga0315912_105378373 | 3300032157 | Soil | EKFVADYGKDEEFKGIAGQITAFLAKARKVKPCPPA |
| Ga0307471_1000056197 | 3300032180 | Hardwood Forest Soil | LADFVANYGKVDEFKEIAGQITAFLNKARKVKPCPSTPPELPRP |
| Ga0247829_102601183 | 3300033550 | Soil | NFVANYGKVEENKGIAGQISAFLGKPRKVKPCAPA |
| Ga0314801_069597_3_143 | 3300034676 | Soil | QEQNEGRALLANFVATYGKVEEFKGIAGQITAFLDKARKVKPCPPA |
| ⦗Top⦘ |