


| Basic Information | |
|---|---|
| Family ID | F065485 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSPRRSPRRAQA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.16 % |
| % of genes near scaffold ends (potentially truncated) | 21.26 % |
| % of genes from short scaffolds (< 2000 bps) | 82.68 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.189 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (15.748 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.984 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (26.772 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00582 | Usp | 37.01 |
| PF00571 | CBS | 33.86 |
| PF00034 | Cytochrom_C | 4.72 |
| PF13380 | CoA_binding_2 | 3.15 |
| PF11794 | HpaB_N | 2.36 |
| PF13607 | Succ_CoA_lig | 1.57 |
| PF09335 | SNARE_assoc | 1.57 |
| PF00115 | COX1 | 1.57 |
| PF00072 | Response_reg | 0.79 |
| PF13549 | ATP-grasp_5 | 0.79 |
| PF01258 | zf-dskA_traR | 0.79 |
| PF00006 | ATP-synt_ab | 0.79 |
| PF04909 | Amidohydro_2 | 0.79 |
| PF00583 | Acetyltransf_1 | 0.79 |
| PF12973 | Cupin_7 | 0.79 |
| PF00702 | Hydrolase | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.57 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.57 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.57 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.19 % |
| Unclassified | root | N/A | 11.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0813821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 638 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100674634 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300000956|JGI10216J12902_110930752 | Not Available | 619 | Open in IMG/M |
| 3300002121|C687J26615_10154014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 581 | Open in IMG/M |
| 3300003994|Ga0055435_10192499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 584 | Open in IMG/M |
| 3300004020|Ga0055440_10005514 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300004022|Ga0055432_10064454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 902 | Open in IMG/M |
| 3300004062|Ga0055500_10088658 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004633|Ga0066395_10055973 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1765 | Open in IMG/M |
| 3300004633|Ga0066395_10692123 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 604 | Open in IMG/M |
| 3300005172|Ga0066683_10806069 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 546 | Open in IMG/M |
| 3300005183|Ga0068993_10286942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 592 | Open in IMG/M |
| 3300005186|Ga0066676_10659328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 711 | Open in IMG/M |
| 3300005332|Ga0066388_100788613 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300005332|Ga0066388_108688878 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005445|Ga0070708_100085868 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
| 3300005713|Ga0066905_100398020 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300005764|Ga0066903_102120952 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005829|Ga0074479_10003841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
| 3300005833|Ga0074472_10989179 | All Organisms → cellular organisms → Bacteria | 4196 | Open in IMG/M |
| 3300006871|Ga0075434_101386558 | Not Available | 713 | Open in IMG/M |
| 3300007255|Ga0099791_10339832 | Not Available | 718 | Open in IMG/M |
| 3300007258|Ga0099793_10112306 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300009038|Ga0099829_10417215 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1110 | Open in IMG/M |
| 3300009090|Ga0099827_11612767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
| 3300009162|Ga0075423_11953782 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300009792|Ga0126374_11016019 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 652 | Open in IMG/M |
| 3300009792|Ga0126374_11871717 | Not Available | 504 | Open in IMG/M |
| 3300010043|Ga0126380_10344019 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300010047|Ga0126382_10529463 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300010047|Ga0126382_11460982 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010048|Ga0126373_11202198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 824 | Open in IMG/M |
| 3300010358|Ga0126370_11574073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 628 | Open in IMG/M |
| 3300010359|Ga0126376_11164291 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300010359|Ga0126376_11837429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 644 | Open in IMG/M |
| 3300010376|Ga0126381_101310662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1047 | Open in IMG/M |
| 3300010391|Ga0136847_10041361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 554 | Open in IMG/M |
| 3300010391|Ga0136847_11806586 | Not Available | 788 | Open in IMG/M |
| 3300010391|Ga0136847_12072716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 727 | Open in IMG/M |
| 3300010391|Ga0136847_12390682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 532 | Open in IMG/M |
| 3300010391|Ga0136847_13197235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1546 | Open in IMG/M |
| 3300010398|Ga0126383_10310850 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300010398|Ga0126383_10917066 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 963 | Open in IMG/M |
| 3300010398|Ga0126383_11886234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
| 3300011270|Ga0137391_10092571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2614 | Open in IMG/M |
| 3300011414|Ga0137442_1063070 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300011419|Ga0137446_1066025 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012096|Ga0137389_10053039 | All Organisms → cellular organisms → Bacteria | 3072 | Open in IMG/M |
| 3300012096|Ga0137389_11509161 | Not Available | 568 | Open in IMG/M |
| 3300012164|Ga0137352_1078293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 659 | Open in IMG/M |
| 3300012204|Ga0137374_10015007 | All Organisms → cellular organisms → Bacteria | 8951 | Open in IMG/M |
| 3300012204|Ga0137374_10022737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7060 | Open in IMG/M |
| 3300012206|Ga0137380_11013097 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia | 710 | Open in IMG/M |
| 3300012209|Ga0137379_10157891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2179 | Open in IMG/M |
| 3300012351|Ga0137386_10872573 | Not Available | 646 | Open in IMG/M |
| 3300012917|Ga0137395_10022333 | All Organisms → cellular organisms → Bacteria | 3705 | Open in IMG/M |
| 3300012931|Ga0153915_10655555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1210 | Open in IMG/M |
| 3300012931|Ga0153915_10904158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1026 | Open in IMG/M |
| 3300012931|Ga0153915_11375067 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012931|Ga0153915_11835768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 709 | Open in IMG/M |
| 3300012964|Ga0153916_10017007 | All Organisms → cellular organisms → Bacteria | 6042 | Open in IMG/M |
| 3300012971|Ga0126369_10254213 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300012971|Ga0126369_10916818 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300014873|Ga0180066_1002659 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300014883|Ga0180086_1012763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1801 | Open in IMG/M |
| 3300014884|Ga0180104_1000882 | All Organisms → cellular organisms → Bacteria | 5972 | Open in IMG/M |
| 3300014884|Ga0180104_1019883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1654 | Open in IMG/M |
| 3300014885|Ga0180063_1201492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 640 | Open in IMG/M |
| 3300015254|Ga0180089_1059232 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300016357|Ga0182032_11553879 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 575 | Open in IMG/M |
| 3300018052|Ga0184638_1244011 | Not Available | 620 | Open in IMG/M |
| 3300018058|Ga0187766_10115566 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300018059|Ga0184615_10222700 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300018059|Ga0184615_10244018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1007 | Open in IMG/M |
| 3300018063|Ga0184637_10402027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 815 | Open in IMG/M |
| 3300018077|Ga0184633_10013171 | All Organisms → cellular organisms → Bacteria | 3983 | Open in IMG/M |
| 3300018084|Ga0184629_10152179 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1173 | Open in IMG/M |
| 3300018084|Ga0184629_10609913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 556 | Open in IMG/M |
| 3300020068|Ga0184649_1310470 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021081|Ga0210379_10023027 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300021081|Ga0210379_10254217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 763 | Open in IMG/M |
| 3300021090|Ga0210377_10115622 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300021560|Ga0126371_10232983 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300021560|Ga0126371_10290954 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300021560|Ga0126371_11096624 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300021560|Ga0126371_11567226 | Not Available | 786 | Open in IMG/M |
| 3300021560|Ga0126371_12084045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 683 | Open in IMG/M |
| 3300025001|Ga0209618_1015329 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300025159|Ga0209619_10055675 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300025164|Ga0209521_10156958 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300025311|Ga0209343_10166296 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300025319|Ga0209520_10166379 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300025535|Ga0207423_1032916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 886 | Open in IMG/M |
| 3300025560|Ga0210108_1020376 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300025560|Ga0210108_1068000 | Not Available | 693 | Open in IMG/M |
| 3300025910|Ga0207684_10165874 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
| 3300025922|Ga0207646_10471451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1132 | Open in IMG/M |
| 3300025965|Ga0210090_1048647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 579 | Open in IMG/M |
| 3300027815|Ga0209726_10005280 | All Organisms → cellular organisms → Bacteria | 15777 | Open in IMG/M |
| 3300027874|Ga0209465_10454949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 640 | Open in IMG/M |
| 3300027882|Ga0209590_10653897 | Not Available | 674 | Open in IMG/M |
| 3300027882|Ga0209590_10801903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 598 | Open in IMG/M |
| 3300028536|Ga0137415_10173961 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300031231|Ga0170824_102435951 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
| 3300031546|Ga0318538_10010547 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300031763|Ga0318537_10226844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 694 | Open in IMG/M |
| 3300031780|Ga0318508_1169045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 623 | Open in IMG/M |
| 3300031794|Ga0318503_10315482 | Not Available | 508 | Open in IMG/M |
| 3300031795|Ga0318557_10103046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
| 3300031796|Ga0318576_10579463 | Not Available | 528 | Open in IMG/M |
| 3300031873|Ga0315297_10716331 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031965|Ga0326597_10000462 | All Organisms → cellular organisms → Bacteria | 72026 | Open in IMG/M |
| 3300031965|Ga0326597_11097839 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031997|Ga0315278_10179806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2171 | Open in IMG/M |
| 3300032066|Ga0318514_10056472 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300032094|Ga0318540_10101263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1355 | Open in IMG/M |
| 3300032143|Ga0315292_11053516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 674 | Open in IMG/M |
| 3300032164|Ga0315283_12228048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 538 | Open in IMG/M |
| 3300032205|Ga0307472_102229467 | Not Available | 553 | Open in IMG/M |
| 3300032256|Ga0315271_11660069 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 549 | Open in IMG/M |
| 3300032770|Ga0335085_10334295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1781 | Open in IMG/M |
| 3300033233|Ga0334722_10608511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 780 | Open in IMG/M |
| 3300033289|Ga0310914_10063600 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
| 3300033806|Ga0314865_186401 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 556 | Open in IMG/M |
| 3300033814|Ga0364930_0004871 | All Organisms → cellular organisms → Bacteria | 4520 | Open in IMG/M |
| 3300034164|Ga0364940_0191866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 597 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.60% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.09% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 3.94% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.36% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.57% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.79% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_08138212 | 2228664022 | Soil | VGIRKSYGKNKKNKRPIGAITVKRDETLRRAGKSKKAPPRGRS |
| INPhiseqgaiiFebDRAFT_1006746342 | 3300000364 | Soil | VGIRKSYGKNKKXKRPIGAITVKRDETLRRAGKSKKAPPRGRS* |
| JGI10216J12902_1109307521 | 3300000956 | Soil | VGIRKSYGKNKKNKRPIGAITVKRDETLRRAGKSKKAPPRGRS* |
| C687J26615_101540141 | 3300002121 | Soil | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSTRRSPRRAKA* |
| Ga0055435_101924991 | 3300003994 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPISAIAVKRDETVRRARKSPRRTVRRAGA* |
| Ga0055440_100055145 | 3300004020 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIGAIAVKRDETVRRAAKSPRRAPRRARA* |
| Ga0055432_100644542 | 3300004022 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIAAIAVKRDETVRRAAKSSRRSPRRGHA* |
| Ga0055500_100886582 | 3300004062 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIAAIAVKRDETVRRAAKSPRRTKRRAKA* |
| Ga0066395_100559733 | 3300004633 | Tropical Forest Soil | MKEASVGIRKSRGKNKKNKRVAGAIAVKREETLRRADKGAQRGRRSPHA* |
| Ga0066395_106921232 | 3300004633 | Tropical Forest Soil | LVAGLKAAHDSPMKEASVGIRKSRGKNKKNKRVIGAIAVKREEALRRADKGERRGRRTPHA* |
| Ga0066683_108060691 | 3300005172 | Soil | MGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPRRRPSS* |
| Ga0068993_102869422 | 3300005183 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIGAIRVKRDETVRRAAKSPRRSPRRAQS* |
| Ga0066676_106593282 | 3300005186 | Soil | MGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPSRRPSS* |
| Ga0066388_1007886133 | 3300005332 | Tropical Forest Soil | VKEDSVGIRRSRVKNKKNKRVVGAIAVKREETLRRAGKGNRRGRRSPHA* |
| Ga0066388_1086888781 | 3300005332 | Tropical Forest Soil | MSGRAQAAHDSPVKEATVGIRKSRGKNKKNKRVVDAIAVKREETLRRAGKGSLRGRRSPRA* |
| Ga0070708_1000858683 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPRRKPSS* |
| Ga0066905_1003980202 | 3300005713 | Tropical Forest Soil | MGIRKSYGKNKKSKRPASAAAVEREETLRRAAKPRRRRRA* |
| Ga0066903_1021209522 | 3300005764 | Tropical Forest Soil | MGIRKSYGKNKKNKRPKEAIAVKRDETVRRARRSRATGPRARKG* |
| Ga0074479_100038412 | 3300005829 | Sediment (Intertidal) | MGIRKSYGKNKKNDRPIGAIGVKREETVRRATKSRRRTPRRAGA* |
| Ga0074472_109891795 | 3300005833 | Sediment (Intertidal) | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRRAQA* |
| Ga0075434_1013865582 | 3300006871 | Populus Rhizosphere | MGIRKSSGKNKKSKRPVTAIAVKRDETLRKAAANARRGAAKKSR* |
| Ga0099791_103398322 | 3300007255 | Vadose Zone Soil | MGIRKSIGKFKKDKRPIVAIAVKREETLRRVRRASRKPSS* |
| Ga0099793_101123062 | 3300007258 | Vadose Zone Soil | MGIRKSIGKFKKDKRPIVAIAVKREETLRRVRRDSRKPSS* |
| Ga0099829_104172151 | 3300009038 | Vadose Zone Soil | MGIRKSYGKNKKNKRPISAVAVKREEILRRARRRPRKP* |
| Ga0099827_116127671 | 3300009090 | Vadose Zone Soil | MGIRKSYGKNKKNKRPLEAIAVKRDETLPRAKRSRQAPPRRRRG* |
| Ga0075423_119537821 | 3300009162 | Populus Rhizosphere | KSTGKNKKSKRPVTAIAVKRDETLRKAAANARRGAAKKSR* |
| Ga0126374_110160191 | 3300009792 | Tropical Forest Soil | SYGKNKKNKRPKEAIAVKRDETLRRAKRSGATSPRARKG* |
| Ga0126374_118717172 | 3300009792 | Tropical Forest Soil | KSRGKNKKNKRVVGAIAVKREETLRRADKGERRGRRSPHA* |
| Ga0126380_103440191 | 3300010043 | Tropical Forest Soil | VKEDSVGIRRSRVKNKKNKRVVGAIAVKREETLRRAGKGNRRGRRSP |
| Ga0126382_105294632 | 3300010047 | Tropical Forest Soil | MGIRKSYGKNKKNKRPLEAIAVKRDETLRRAKRSRQVSPRRRQG* |
| Ga0126382_114609822 | 3300010047 | Tropical Forest Soil | VKEDSVGIRRSRVKNKKSKRVVGAIAVKREETLRRAGKGNRRGRRSPHA* |
| Ga0126373_112021981 | 3300010048 | Tropical Forest Soil | MKEASVGIRKSRGKNKKNKRVAGAIAVKREETLRRADKGAQRGRRSPHA |
| Ga0126370_115740732 | 3300010358 | Tropical Forest Soil | LAAHDSPKKEASVGIRKSRGKNKKNKRVVGAIAVKREETLRRADKGERRGRRSPHG* |
| Ga0126376_111642912 | 3300010359 | Tropical Forest Soil | VKEDSVGIRRSRVKNKKNKRAVGAIAVKREETLRRAGKGNRRGRRSPHA* |
| Ga0126376_118374292 | 3300010359 | Tropical Forest Soil | RCVDRETAMGIRKSYGKNKKNKRPLEAIAVKRDEMLRRAKRSRQVSPRRRQG* |
| Ga0126381_1013106622 | 3300010376 | Tropical Forest Soil | VKEASVGIRKSRGKNKKNKRVVGAIAVKREETLRRADKGERRGRRSPHA* |
| Ga0136847_100413612 | 3300010391 | Freshwater Sediment | MGIRKSYGKNKKNKRPISAIAVKRDETVRRARRRARKP* |
| Ga0136847_118065861 | 3300010391 | Freshwater Sediment | DMGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSTRRSPRPAGA* |
| Ga0136847_120727162 | 3300010391 | Freshwater Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRAPRRAQA* |
| Ga0136847_123906822 | 3300010391 | Freshwater Sediment | MGIRKSYGKNKKNDRPIGAIAVKRDETVRRAARSPRRPARRAKA* |
| Ga0136847_131972351 | 3300010391 | Freshwater Sediment | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSPRRSPRRAQA* |
| Ga0126383_103108503 | 3300010398 | Tropical Forest Soil | MGIRKSYGKNKKNKRPQGAIAVKRDETLRRARRARPASPRARRA* |
| Ga0126383_109170661 | 3300010398 | Tropical Forest Soil | MKEASVGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA* |
| Ga0126383_118862342 | 3300010398 | Tropical Forest Soil | VGIRKSRGKNKKNKRVVGAIAVKREETLRRADKGERRGRRSPRA* |
| Ga0137391_100925712 | 3300011270 | Vadose Zone Soil | MGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPSRKPSS* |
| Ga0137442_10630701 | 3300011414 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSPRRSPRRAEA* |
| Ga0137446_10660251 | 3300011419 | Soil | MGIRKSYGKNKKNDRPIAAIRVKREETVRRAAKSPRRSPRRAQA* |
| Ga0137389_100530393 | 3300012096 | Vadose Zone Soil | MGIRKSTGKFKKDKRPIVAIAVKREETLRRARRASRKPSS* |
| Ga0137389_115091611 | 3300012096 | Vadose Zone Soil | VGIRKSYGKNKNNNRPIGAITVKRDETLRRAGKSKEAPPRRRRP* |
| Ga0137352_10782932 | 3300012164 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRREAKSERRSPRRAQA* |
| Ga0137374_1001500715 | 3300012204 | Vadose Zone Soil | MGIRKSRGKNKKNKRPIAAIAVKREETLRRAAKSPRRSTGRAGA* |
| Ga0137374_100227376 | 3300012204 | Vadose Zone Soil | MGVRKSSGKNKTDKRPAEAIAVKREETLRRAGKSKRQPARRRP* |
| Ga0137380_110130972 | 3300012206 | Vadose Zone Soil | MRDREAAMGIRKSYGKNKKNKRPLEAVAVKRDETLRRAKRFRQAPPRRRQG* |
| Ga0137379_101578912 | 3300012209 | Vadose Zone Soil | MGIRKSYGKNKKNKRPLEAVAVKRDETLRRAKRFRQAPPRRRQG* |
| Ga0137386_108725731 | 3300012351 | Vadose Zone Soil | MRDREAAMGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPRRKPSS* |
| Ga0137395_100223331 | 3300012917 | Vadose Zone Soil | MGIRKSTGKFKKDKRPIVAIAMKREETLRRVRRASRKPSS* |
| Ga0153915_106555552 | 3300012931 | Freshwater Wetlands | MGIRKSYGKNKKNDRPIAAIAVKRDETVRRAAKSRRRSPRRAQA* |
| Ga0153915_109041583 | 3300012931 | Freshwater Wetlands | MGIRKSYGKNKKNDRPIAAIGVKRDETVRRAAKSRRRSPRRAGA* |
| Ga0153915_113750671 | 3300012931 | Freshwater Wetlands | MGIRKSYGKNKKNDRPISAIRVKRDETVRRAAKSPRRSPRRAGA* |
| Ga0153915_118357681 | 3300012931 | Freshwater Wetlands | MGIRKSYGMNKKNDRPISAIAVKRDETVRRAAKSPRRSPKRGQA* |
| Ga0153916_100170076 | 3300012964 | Freshwater Wetlands | MGIRKSYGKNKKNDRPIAAIGVKRDETVRRAAKSSRRSPRRSPRRAQA* |
| Ga0126369_102542132 | 3300012971 | Tropical Forest Soil | MKEASVGIRKSRGKNKKNKRVIGAIAVKREEALRRADKGERRGRRTPHA* |
| Ga0126369_109168182 | 3300012971 | Tropical Forest Soil | VGIRKSRGKNKKNKRVVGAIAVKREETLRRADKGERRGRRSPHA* |
| Ga0180066_10026592 | 3300014873 | Soil | MGIRKSYGKNKKNKRPISAIAVKREETVRRATKSPRRSPRRAQA* |
| Ga0180086_10127631 | 3300014883 | Soil | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAGKSPRRSPRRAEA* |
| Ga0180104_100088210 | 3300014884 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSPRRAPRRAKA* |
| Ga0180104_10198834 | 3300014884 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSARRSPRRAQA* |
| Ga0180063_12014921 | 3300014885 | Soil | MGIRKSYGKNKKNKRPISAIGVKRDETVRRAAKSARRSPRRAQA* |
| Ga0180089_10592323 | 3300015254 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSARRSPRRA |
| Ga0182032_115538791 | 3300016357 | Soil | RGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0184638_12440112 | 3300018052 | Groundwater Sediment | MGIRKSYGKNKKDKRTVGAIAAKRDETVRRAGRSKRTPSPRRPS |
| Ga0187766_101155662 | 3300018058 | Tropical Peatland | MGIRRSTVKNKKDKRSIAAIAVKRGETVRRAARSTRRAPERGRA |
| Ga0184615_102227003 | 3300018059 | Groundwater Sediment | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSPRRSPRRAEA |
| Ga0184615_102440183 | 3300018059 | Groundwater Sediment | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSTRRSPRRAKA |
| Ga0184637_104020272 | 3300018063 | Groundwater Sediment | MGIRKSYGKNKKNKRPSSAIAVKREETVRRAMKSPRRVPRHAQA |
| Ga0184633_100131712 | 3300018077 | Groundwater Sediment | MGIRKSHGKNKKNKRPISAIAVKRDETVRRAAKSTRRSARRAEA |
| Ga0184629_101521791 | 3300018084 | Groundwater Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRRAQA |
| Ga0184629_106099132 | 3300018084 | Groundwater Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRAPRRARA |
| Ga0184649_13104701 | 3300020068 | Groundwater Sediment | MGIRKSYGKNKKNDRPISAIRVKRDETVRRAAKSPRRSPRRAQA |
| Ga0210379_100230276 | 3300021081 | Groundwater Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRAPRRAQA |
| Ga0210379_102542172 | 3300021081 | Groundwater Sediment | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSPRRAPRRAKA |
| Ga0210377_101156222 | 3300021090 | Groundwater Sediment | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAGKSPRRSPRRAEA |
| Ga0126371_102329835 | 3300021560 | Tropical Forest Soil | MSPTKEASVGIRKSRGKNKKNKRVIGAIAVKREEALRRADKGER |
| Ga0126371_102909541 | 3300021560 | Tropical Forest Soil | VGIRKSRGKNKKNKRVIGAIAVKREEALRRADKGER |
| Ga0126371_110966242 | 3300021560 | Tropical Forest Soil | VGIRKSRGKNKKNKRVVGAIAVKREETLRRADKGERRGRRSPHA |
| Ga0126371_115672262 | 3300021560 | Tropical Forest Soil | MKEASMGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0126371_120840452 | 3300021560 | Tropical Forest Soil | MGIRKSYGKNKKNKRPKEAIAVKRDETLRRAKRSR |
| Ga0209618_10153291 | 3300025001 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSTRRAPRRAQA |
| Ga0209619_100556751 | 3300025159 | Soil | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSTRRAPRRAQA |
| Ga0209521_101569584 | 3300025164 | Soil | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKSTRRSPRRAKA |
| Ga0209108_104112473 | 3300025165 | Soil | MGIRKSYGKNKKNKRPISAIAVKRDEAVRRAAKSP |
| Ga0209343_101662961 | 3300025311 | Groundwater | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSTRRSPRRPKA |
| Ga0209520_101663794 | 3300025319 | Soil | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSTRR |
| Ga0207423_10329162 | 3300025535 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIAAIAVKRDETVRRAAKSSRRSPRRGHA |
| Ga0210108_10203761 | 3300025560 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPISAIAVKRDETVRRARKSPRRTVRRAGA |
| Ga0210108_10680002 | 3300025560 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIGAIRVKRDETVRRAAKSPRRSPRRAQS |
| Ga0207684_101658743 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPRRKPSS |
| Ga0207646_104714511 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RKSYGKNKKNKRPIGAIAVKREETLRRARRPRRKPSS |
| Ga0210090_10486472 | 3300025965 | Natural And Restored Wetlands | MGIRKSYGKNKKNDRPIAAIAVKRDETVRRAAKSPRRTKRRAKA |
| Ga0209726_1000528018 | 3300027815 | Groundwater | MGIRKSYGKNKKNKRPIAAIAVKRDETVRRAAKSTRRSPRRAEA |
| Ga0209465_104549492 | 3300027874 | Tropical Forest Soil | MKEASVGIRKSRGKNKKNKRVIGAIAVKREEALRRADKGERRGRRTPHA |
| Ga0209590_106538972 | 3300027882 | Vadose Zone Soil | MGIRKSYGKNKKNKRPIGAIAVKREETLRRARRPSRKPSS |
| Ga0209590_108019032 | 3300027882 | Vadose Zone Soil | MGIRKSYGKNKKNKRPLEAIAVKRDETLPRAKRSRQAPPRRRRG |
| Ga0137415_101739612 | 3300028536 | Vadose Zone Soil | MGIRKSIGKFKKDKRPIVAIAVKREETLRRVRRASRKPSS |
| Ga0170824_1024359511 | 3300031231 | Forest Soil | MGIRKSYGKNKKSKKPIGAITVKREETLRRAGKSSASASRRGRP |
| Ga0318538_100105473 | 3300031546 | Soil | MGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0318537_102268442 | 3300031763 | Soil | ASMGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0318508_11690452 | 3300031780 | Soil | MGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGR |
| Ga0318503_103154822 | 3300031794 | Soil | SPVKETRMGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0318557_101030463 | 3300031795 | Soil | SMGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0318576_105794632 | 3300031796 | Soil | VYDSPMKEASMGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0315297_107163311 | 3300031873 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSTRRAPRRAKA |
| Ga0326597_1000046236 | 3300031965 | Soil | MGIRKSYGKNKKNKRPIAAIAVKRDETLRRAAKSPRRSPRRAEA |
| Ga0326597_110978391 | 3300031965 | Soil | MGIRKSYGKNKKNKRPISAIAVKRDETVRRAAKTPRRSPRRTGA |
| Ga0315278_101798063 | 3300031997 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRRAKA |
| Ga0318514_100564721 | 3300032066 | Soil | MGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRR |
| Ga0318540_101012631 | 3300032094 | Soil | PMKEASMGIRKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0315292_110535163 | 3300032143 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRRAK |
| Ga0315283_122280482 | 3300032164 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRR |
| Ga0307472_1022294672 | 3300032205 | Hardwood Forest Soil | MGIRKSYGKNKKNKRPLEAIAVKRDETLRRAKRSREAPPRRRQG |
| Ga0315271_116600692 | 3300032256 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRRAQV |
| Ga0335085_103342952 | 3300032770 | Soil | MGIRKSYGKNKKDDRSIAAIAVKRDETIRRAAKSPRRAPKRAKA |
| Ga0334722_106085112 | 3300033233 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRSPRRAQG |
| Ga0310914_100636003 | 3300033289 | Soil | RKSRGKNKKNKRVIGAIAVKRDETLRRADKGERRGRRSPHA |
| Ga0314865_186401_32_166 | 3300033806 | Peatland | MGIRRSTVKNKKDKRSIAAIAVKRGETVRRAARSTRRPPERGRA |
| Ga0364930_0004871_3605_3739 | 3300033814 | Sediment | MGIRKSYGKNKKNDRPISAIAVKRDETVRRAAKSPRRSPRRAQA |
| Ga0364940_0191866_141_275 | 3300034164 | Sediment | MGIRKSYGKNKKNDRPIAAIRVKRDETVRRAAKSPRRAPRGAQA |
| ⦗Top⦘ |