


| Basic Information | |
|---|---|
| Family ID | F065407 |
| Family Type | Metagenome |
| Number of Sequences | 127 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFTFDEQYKKFEEVIDRTKQAYEFWYNCILSTWEDFYKPKKK |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.05 % |
| % of genes near scaffold ends (potentially truncated) | 13.39 % |
| % of genes from short scaffolds (< 2000 bps) | 66.14 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.756 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.347 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.740 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (88.976 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 9.45 |
| PF16786 | RecA_dep_nuc | 7.09 |
| PF10263 | SprT-like | 6.30 |
| PF05866 | RusA | 3.94 |
| PF03237 | Terminase_6N | 3.94 |
| PF10124 | Mu-like_gpT | 3.94 |
| PF04851 | ResIII | 1.57 |
| PF00145 | DNA_methylase | 1.57 |
| PF00182 | Glyco_hydro_19 | 1.57 |
| PF13362 | Toprim_3 | 0.79 |
| PF01555 | N6_N4_Mtase | 0.79 |
| PF07728 | AAA_5 | 0.79 |
| PF13392 | HNH_3 | 0.79 |
| PF14549 | P22_Cro | 0.79 |
| PF12705 | PDDEXK_1 | 0.79 |
| PF00271 | Helicase_C | 0.79 |
| PF03567 | Sulfotransfer_2 | 0.79 |
| PF01075 | Glyco_transf_9 | 0.79 |
| PF13884 | Peptidase_S74 | 0.79 |
| PF09889 | DUF2116 | 0.79 |
| PF11753 | DUF3310 | 0.79 |
| PF04545 | Sigma70_r4 | 0.79 |
| PF04466 | Terminase_3 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 3.94 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.57 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 1.57 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 1.57 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.79 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.79 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.76 % |
| All Organisms | root | All Organisms | 47.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c009940 | Not Available | 1723 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1001417 | Not Available | 17757 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1061028 | Not Available | 1258 | Open in IMG/M |
| 3300002091|JGI24028J26656_1002640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3241 | Open in IMG/M |
| 3300002091|JGI24028J26656_1007803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1438 | Open in IMG/M |
| 3300002091|JGI24028J26656_1010163 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300002091|JGI24028J26656_1010333 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1146 | Open in IMG/M |
| 3300002091|JGI24028J26656_1020598 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 655 | Open in IMG/M |
| 3300002092|JGI24218J26658_1021733 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 861 | Open in IMG/M |
| 3300002092|JGI24218J26658_1021894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia ambifaria | 856 | Open in IMG/M |
| 3300002092|JGI24218J26658_1026345 | Not Available | 742 | Open in IMG/M |
| 3300002098|JGI24219J26650_1017762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300002307|JGI24890J29729_1080651 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 512 | Open in IMG/M |
| 3300002930|Water_103329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2646 | Open in IMG/M |
| 3300002933|G310J44882_10000631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16992 | Open in IMG/M |
| 3300003375|JGI26470J50227_1000715 | All Organisms → cellular organisms → Bacteria | 12970 | Open in IMG/M |
| 3300003375|JGI26470J50227_1001206 | Not Available | 9342 | Open in IMG/M |
| 3300003375|JGI26470J50227_1011160 | Not Available | 2224 | Open in IMG/M |
| 3300003375|JGI26470J50227_1020634 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300003375|JGI26470J50227_1039616 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 881 | Open in IMG/M |
| 3300003375|JGI26470J50227_1042498 | Not Available | 834 | Open in IMG/M |
| 3300003820|Ga0007863_1009461 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 937 | Open in IMG/M |
| 3300003852|Ga0031655_10013300 | Not Available | 4130 | Open in IMG/M |
| 3300003852|Ga0031655_10060305 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300004448|Ga0065861_1000874 | All Organisms → cellular organisms → Bacteria | 21399 | Open in IMG/M |
| 3300004448|Ga0065861_1072228 | Not Available | 1327 | Open in IMG/M |
| 3300004460|Ga0066222_1045671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2103 | Open in IMG/M |
| 3300004694|Ga0065170_1000799 | All Organisms → cellular organisms → Bacteria | 4358 | Open in IMG/M |
| 3300004694|Ga0065170_1039285 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 634 | Open in IMG/M |
| 3300004770|Ga0007804_1069074 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 914 | Open in IMG/M |
| 3300004772|Ga0007791_10031162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1829 | Open in IMG/M |
| 3300004774|Ga0007794_10160505 | Not Available | 671 | Open in IMG/M |
| 3300004774|Ga0007794_10186968 | Not Available | 618 | Open in IMG/M |
| 3300004805|Ga0007792_10194868 | Not Available | 623 | Open in IMG/M |
| 3300004807|Ga0007809_10065756 | Not Available | 1152 | Open in IMG/M |
| 3300006071|Ga0007876_1032896 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1431 | Open in IMG/M |
| 3300006116|Ga0007807_1007015 | Not Available | 2879 | Open in IMG/M |
| 3300008113|Ga0114346_1156018 | Not Available | 968 | Open in IMG/M |
| 3300009068|Ga0114973_10040726 | Not Available | 2773 | Open in IMG/M |
| 3300009151|Ga0114962_10008134 | Not Available | 7910 | Open in IMG/M |
| 3300009151|Ga0114962_10139539 | Not Available | 1467 | Open in IMG/M |
| 3300009151|Ga0114962_10236765 | Not Available | 1047 | Open in IMG/M |
| 3300009151|Ga0114962_10358345 | Not Available | 798 | Open in IMG/M |
| 3300009152|Ga0114980_10004509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9380 | Open in IMG/M |
| 3300009152|Ga0114980_10032951 | Not Available | 3198 | Open in IMG/M |
| 3300009152|Ga0114980_10091854 | All Organisms → Viruses → Predicted Viral | 1817 | Open in IMG/M |
| 3300009154|Ga0114963_10000413 | Not Available | 28599 | Open in IMG/M |
| 3300009154|Ga0114963_10173233 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1265 | Open in IMG/M |
| 3300009154|Ga0114963_10324864 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 851 | Open in IMG/M |
| 3300009155|Ga0114968_10072979 | Not Available | 2148 | Open in IMG/M |
| 3300009155|Ga0114968_10080275 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300009155|Ga0114968_10196406 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1171 | Open in IMG/M |
| 3300009155|Ga0114968_10377310 | Not Available | 778 | Open in IMG/M |
| 3300009155|Ga0114968_10624831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300009175|Ga0073936_10131179 | All Organisms → Viruses → Predicted Viral | 1940 | Open in IMG/M |
| 3300009175|Ga0073936_10238332 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300009182|Ga0114959_10034630 | Not Available | 3047 | Open in IMG/M |
| 3300009182|Ga0114959_10268732 | Not Available | 859 | Open in IMG/M |
| 3300009184|Ga0114976_10001786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13484 | Open in IMG/M |
| 3300009502|Ga0114951_10073582 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
| 3300009502|Ga0114951_10217504 | Not Available | 1015 | Open in IMG/M |
| 3300010157|Ga0114964_10446552 | Not Available | 609 | Open in IMG/M |
| 3300010158|Ga0114960_10296984 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 811 | Open in IMG/M |
| 3300010230|Ga0136236_1000325 | Not Available | 7162 | Open in IMG/M |
| 3300013286|Ga0136641_1025289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1812 | Open in IMG/M |
| 3300013286|Ga0136641_1091694 | Not Available | 850 | Open in IMG/M |
| 3300017754|Ga0181344_1036148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1500 | Open in IMG/M |
| 3300017754|Ga0181344_1211989 | Not Available | 541 | Open in IMG/M |
| 3300017766|Ga0181343_1096525 | Not Available | 840 | Open in IMG/M |
| 3300020158|Ga0194038_1131444 | Not Available | 728 | Open in IMG/M |
| 3300020692|Ga0214224_1014983 | Not Available | 668 | Open in IMG/M |
| 3300020710|Ga0214198_1000192 | Not Available | 15594 | Open in IMG/M |
| 3300020716|Ga0214207_1014064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
| 3300020718|Ga0214178_1021735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300020727|Ga0214246_1005208 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
| 3300021131|Ga0214206_1007005 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1777 | Open in IMG/M |
| 3300021131|Ga0214206_1022421 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 767 | Open in IMG/M |
| 3300021139|Ga0214166_1018685 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
| 3300021354|Ga0194047_10126569 | Not Available | 1061 | Open in IMG/M |
| 3300021354|Ga0194047_10356172 | Not Available | 552 | Open in IMG/M |
| 3300021519|Ga0194048_10000104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35430 | Open in IMG/M |
| 3300021519|Ga0194048_10163143 | Not Available | 834 | Open in IMG/M |
| 3300022555|Ga0212088_10157090 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1906 | Open in IMG/M |
| 3300022591|Ga0236341_1002554 | All Organisms → Viruses | 9164 | Open in IMG/M |
| 3300022591|Ga0236341_1003478 | Not Available | 7402 | Open in IMG/M |
| 3300022592|Ga0236342_1392904 | Not Available | 524 | Open in IMG/M |
| 3300022594|Ga0236340_1087713 | Not Available | 606 | Open in IMG/M |
| 3300022602|Ga0248169_100653 | Not Available | 53731 | Open in IMG/M |
| 3300022602|Ga0248169_106458 | Not Available | 10981 | Open in IMG/M |
| 3300022602|Ga0248169_108045 | Not Available | 9073 | Open in IMG/M |
| 3300023311|Ga0256681_11104472 | Not Available | 1174 | Open in IMG/M |
| 3300023311|Ga0256681_12235983 | All Organisms → Viruses → Predicted Viral | 1657 | Open in IMG/M |
| 3300025316|Ga0209697_10433002 | Not Available | 626 | Open in IMG/M |
| 3300025372|Ga0207957_1001651 | All Organisms → Viruses → Predicted Viral | 4551 | Open in IMG/M |
| 3300025375|Ga0208259_1055479 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 534 | Open in IMG/M |
| 3300025383|Ga0208250_1021400 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300025389|Ga0208257_1005959 | Not Available | 2232 | Open in IMG/M |
| 3300025411|Ga0208865_1060658 | Not Available | 574 | Open in IMG/M |
| 3300025606|Ga0207954_1000116 | Not Available | 24123 | Open in IMG/M |
| 3300025606|Ga0207954_1130261 | Not Available | 602 | Open in IMG/M |
| 3300025616|Ga0208613_1131496 | Not Available | 562 | Open in IMG/M |
| 3300025723|Ga0208741_10177443 | Not Available | 509 | Open in IMG/M |
| 3300025838|Ga0208872_1045681 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300027708|Ga0209188_1001492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18652 | Open in IMG/M |
| 3300027708|Ga0209188_1009304 | Not Available | 5691 | Open in IMG/M |
| 3300027708|Ga0209188_1032999 | Not Available | 2454 | Open in IMG/M |
| 3300027708|Ga0209188_1228342 | Not Available | 654 | Open in IMG/M |
| 3300027712|Ga0209499_1114930 | Not Available | 1009 | Open in IMG/M |
| 3300027734|Ga0209087_1001509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13659 | Open in IMG/M |
| 3300027741|Ga0209085_1017144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3523 | Open in IMG/M |
| 3300027741|Ga0209085_1080971 | Not Available | 1456 | Open in IMG/M |
| 3300027741|Ga0209085_1154094 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 967 | Open in IMG/M |
| 3300027754|Ga0209596_1110720 | Not Available | 1279 | Open in IMG/M |
| 3300027763|Ga0209088_10002338 | Not Available | 11716 | Open in IMG/M |
| 3300027764|Ga0209134_10321718 | Not Available | 524 | Open in IMG/M |
| 3300027777|Ga0209829_10013849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4952 | Open in IMG/M |
| 3300027777|Ga0209829_10074773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
| 3300027896|Ga0209777_10033681 | Not Available | 4836 | Open in IMG/M |
| 3300027963|Ga0209400_1391909 | Not Available | 502 | Open in IMG/M |
| 3300027973|Ga0209298_10287138 | Not Available | 645 | Open in IMG/M |
| 3300031707|Ga0315291_10222445 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1907 | Open in IMG/M |
| 3300031707|Ga0315291_11594993 | Not Available | 509 | Open in IMG/M |
| 3300031746|Ga0315293_10193733 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1675 | Open in IMG/M |
| 3300031772|Ga0315288_10103123 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 3258 | Open in IMG/M |
| 3300031857|Ga0315909_10876282 | Not Available | 557 | Open in IMG/M |
| 3300032092|Ga0315905_10035692 | Not Available | 5051 | Open in IMG/M |
| 3300032516|Ga0315273_12190943 | Not Available | 649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 28.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 21.26% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 7.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.15% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 3.15% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.36% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.36% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.57% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.79% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010230 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Not filtered control. After WGA | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
| 3300020692 | Freshwater microbial communities from Trout Bog Lake, WI - 10SEP2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022592 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0099403 | 3300000176 | Freshwater | MFTFDEQFKKYEDVLDRTKQAYEFWYNCLVSTWKDFYKTYK* |
| TBL_comb48_EPIDRAFT_100141724 | 3300000439 | Freshwater | MFTFDEQYKKYEELINRTKQAYDFWYNCLVSTWKDFYK* |
| TBL_comb48_EPIDRAFT_10610282 | 3300000439 | Freshwater | MFSFEEQYKKFEEVVERTKQAYDFWYNCLVSTWQDFYNTKKK* |
| JGI24028J26656_100264010 | 3300002091 | Lentic | MFTFDEQIKKYEELADRTKQAYEFWYNCVLTTMKDFYKFGK* |
| JGI24028J26656_10078031 | 3300002091 | Lentic | MFTFEEQYKKFEELSDRTKQAYEFWVNCVFSSFKDFLKTGK* |
| JGI24028J26656_10101631 | 3300002091 | Lentic | MFTFEEQYKKFEELSXRTKQAYDFWYNCIMSTFKDFCKKK* |
| JGI24028J26656_10103331 | 3300002091 | Lentic | MFSFEDQYKKFEQLNERTKQAYEFWINCVTSTWEDFFKPRKK* |
| JGI24028J26656_10205981 | 3300002091 | Lentic | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLISTWKDFYKTGK* |
| JGI24218J26658_10217332 | 3300002092 | Lentic | MFTFDEQYKQFEEVAEKTKKAYEFWYNCVLSTWKDLYKFGK* |
| JGI24218J26658_10218943 | 3300002092 | Lentic | EQFKKYEEVLDRTKQAYEFWYNCLISTWKDFYKTGK* |
| JGI24218J26658_10263453 | 3300002092 | Lentic | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLISTWKDFYK* |
| JGI24219J26650_10177621 | 3300002098 | Lentic | MFSFDEQYKKFEQLNERTKQAYEFWVNAVVSTWEDFFKPKKK* |
| JGI24890J29729_10806511 | 3300002307 | Lentic | MFTFEEQYKKFEEVTERTKQAYEFWVNCLSSTWQDFFKAPKK* |
| Water_1033293 | 3300002930 | Estuary Water | MFTFDEQYKKYEELAERTKQAYEFWYKCVLSTMKDFYKFGK* |
| G310J44882_1000063132 | 3300002933 | Freshwater | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYKTYK* |
| JGI26470J50227_100071515 | 3300003375 | Freshwater | MEKIMFTFEEQYKKFEQLNERTKQAYEFWINAVVSTWEDFFKPKKK* |
| JGI26470J50227_10012061 | 3300003375 | Freshwater | MFSFEEQYKKFEELNERTKQAYEFWVNAISSTWEDFFKPKKK* |
| JGI26470J50227_10111602 | 3300003375 | Freshwater | MFTFEEQYKKYEQLNERTKQAYEFWINAVVSTWEDFFKPKKK* |
| JGI26470J50227_10206341 | 3300003375 | Freshwater | MFSFEEQYKKFEELSERTKQAYEFWYNCIMSTFKDFCKKK* |
| JGI26470J50227_10396161 | 3300003375 | Freshwater | MFTFEEQFKKFEELSERTKQAYEFWYSCIISTLKDFCKKK* |
| JGI26470J50227_10424982 | 3300003375 | Freshwater | MFTFEEQYKKYEEVLDRTKQAYEFWYSCLISTWKDFLKTGK* |
| Ga0007863_10094612 | 3300003820 | Freshwater | MFSFDEQYKKFEEVIDRTKQAYEFWYNCIVXTWEDFYKPKKK* |
| Ga0031655_100133005 | 3300003852 | Freshwater Lake Sediment | MFTFDDQYKKFEEVIDRTKQAYEFWYNCILSTWEDFYKPKKK* |
| Ga0031655_100603051 | 3300003852 | Freshwater Lake Sediment | MNHFSFEEQYKKFEELAERTKQAYEFWYNCVVSTWEDFCKPKKK* |
| Ga0065861_100087431 | 3300004448 | Marine | MFTFDEQIKKYEEVLDRTKQMYEFWYNCVLSTMKDFYKFGK* |
| Ga0065861_10722283 | 3300004448 | Marine | MFSFEEQYKKFEELNERTKQAYEFWVKAVTSTVEDFFKPRKK* |
| Ga0066222_10456711 | 3300004460 | Marine | MFTFDEQYKKFEQLNERTKQAYEFWLETITSTWEDLFKPRKK* |
| Ga0065170_10007994 | 3300004694 | Freshwater | MFSFDEQYKKFEEVIDRTKQAYEFWYNCIVSTWEDFYKPKKK* |
| Ga0065170_10392851 | 3300004694 | Freshwater | MMFTFEEQFKKFEELSERTKQAYEFWYSCIISTLKDFCKKK* |
| Ga0007804_10690743 | 3300004770 | Freshwater | MFTFEEQYKKFEEVMDRTKQAYEFWYNCLVSTWKDFYKSGK* |
| Ga0007791_100311621 | 3300004772 | Freshwater | MFTFEEQFKKYEVLVERTKEAYEFWVNCVFSSIKEYIKTGK* |
| Ga0007794_101605052 | 3300004774 | Freshwater | MFTFDEQIKKYEELAERTKQAYEFWYNCVLSTMKDFYKFGK* |
| Ga0007794_101869682 | 3300004774 | Freshwater | MFTFDEQYKKYEELLDRTKQAYEFWVNCLTSTWEDFYKAKKK* |
| Ga0007792_101948681 | 3300004805 | Freshwater | MFSFEEQYKKFEELTERTKQVYEFWVNAVFANVQDFYKPKKK* |
| Ga0007809_100657561 | 3300004807 | Freshwater | MFSFEEQYKKFEELSERTKQAYEFWYSCIISTLKDFCKKK* |
| Ga0007876_10328963 | 3300006071 | Freshwater | MFTFDEQYKKFEEVIDRTKQAYEFWYNCILSTWEDFYKPKKK* |
| Ga0007807_10070151 | 3300006116 | Freshwater | MFTFDEQYKKFEEVIDRTKQAYEFWYNCILSTWED |
| Ga0114346_11560182 | 3300008113 | Freshwater, Plankton | MFTFDEQYKKFEQLNERNKEAYEFWLKAVVSTWEDFFKPKKK* |
| Ga0114973_100407262 | 3300009068 | Freshwater Lake | MFSFEEQYKKFEQLNERTKQAYEFWLETITSTWEDLFKPKKK* |
| Ga0114962_1000813411 | 3300009151 | Freshwater Lake | MFTFDEQYKQFEEVANRTKQAYEFWYNCVIETLKDLYKTKK* |
| Ga0114962_101395393 | 3300009151 | Freshwater Lake | MFTLDEQIKKYEELAERTKQAYEFWYNCVLSTMKDFYKFGK* |
| Ga0114962_102367651 | 3300009151 | Freshwater Lake | MEKTMFSFEEQYKKFEELNERTKQAYEFWVKAVASTVEDFFKPRKK* |
| Ga0114962_103583451 | 3300009151 | Freshwater Lake | MYTFDEQIKNYEEVLDRTKQMYEFWYNCVLSSMKDFYKFGK* |
| Ga0114980_1000450911 | 3300009152 | Freshwater Lake | MFTFDEQYKKFEELNERTKEAYKFWFNVITSSWEDFFKPKKK* |
| Ga0114980_100329511 | 3300009152 | Freshwater Lake | IAMFTFDEQIKKYEELADRTKQAYEFWYNCVLSTMKDFYKFGK* |
| Ga0114980_100918545 | 3300009152 | Freshwater Lake | MFTYDEQYKQFEEVAEKTKKAYEFWYNCVLSTMKDFYKFGK* |
| Ga0114963_100004134 | 3300009154 | Freshwater Lake | MFGFDEQYKKFEEVLDRTKQMYEFWSNAVMDTWKDLYKFKK* |
| Ga0114963_101732333 | 3300009154 | Freshwater Lake | MERTMFTFDEQYKQFEEVANRTKQAYEFWYNCVIETLKDLYKTKK* |
| Ga0114963_103248643 | 3300009154 | Freshwater Lake | MFTFDEQIKKYEELADRTKQAYEFWYNCVLFTMKDFYKFGK* |
| Ga0114968_100729793 | 3300009155 | Freshwater Lake | MFTFDEQIKKYEELADRTKQMYEFWYNCVLSTMKDFYKFGK* |
| Ga0114968_100802751 | 3300009155 | Freshwater Lake | MEKTMFSFEEQYKKFEELNERTKQAYEFWVKAVTSTVEDFFKPRKK* |
| Ga0114968_101964063 | 3300009155 | Freshwater Lake | MFTFDEQIKNYEEVLDRTKQMYEFWYNCVLSTMKDFYKFGK* |
| Ga0114968_103773101 | 3300009155 | Freshwater Lake | MFTFDEQIKKYEELAERTKQAYEFWYNCVLTTMKDFYKFGK* |
| Ga0114968_106248311 | 3300009155 | Freshwater Lake | MFTFDEQYKQLEQVAEKTKQAYEFWYNCLLSTLKDFYKTGK* |
| Ga0073936_101311791 | 3300009175 | Freshwater Lake Hypolimnion | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYK* |
| Ga0073936_102383323 | 3300009175 | Freshwater Lake Hypolimnion | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYKTGK* |
| Ga0114959_100346304 | 3300009182 | Freshwater Lake | MFTFEEQFKKYEQLLERTKETYEFWTNCVMSSWKDFLKTGK* |
| Ga0114959_102687323 | 3300009182 | Freshwater Lake | MFTFDEQIKKYEEVLDRTQQMYEFWYNCVLSSMKDFYKFGK* |
| Ga0114976_100017862 | 3300009184 | Freshwater Lake | MFTFDEQIKKYEELADRTKQAYEFWYNCVLSTMKDFYKFGK* |
| Ga0114951_100735825 | 3300009502 | Freshwater | MFTFEEQYKKFEELSERTKQAYDFWYNCIMSTFKDFCKKK* |
| Ga0114951_102175041 | 3300009502 | Freshwater | MFSFEEQYKKFEELTERTKQVYEFWVNAVFANVQDFCKPKKK* |
| Ga0114964_104465521 | 3300010157 | Freshwater Lake | EEQYKKFEQLNERTKQAYEFWLETITSTWEDLFKLRKK* |
| Ga0114960_102969841 | 3300010158 | Freshwater Lake | QIKKYEEVLDRTQQMYEFWYNCVLSSMKDFYKFGK* |
| Ga0136236_100032512 | 3300010230 | Freshwater | MFTFDEQYKKYEELTDRTKQAYEFWYNCVLFTWKDLYKFGK* |
| Ga0136641_10252893 | 3300013286 | Freshwater | MEKTMFTFEEQFKKQEQLFDRTKEAYEFWVNCVFSSFKEFFVKK* |
| Ga0136641_10916942 | 3300013286 | Freshwater | MFTFEEQFKKFEELNERTKQAYEFWINAVTSTWEDLFKPKKK* |
| Ga0181344_10361481 | 3300017754 | Freshwater Lake | MFSFDDQYKKFEELNERTKQAYEFWINAVVSTWEDFFKPKKK |
| Ga0181344_12119892 | 3300017754 | Freshwater Lake | MFTFDEQYKKFEEVTDRTKQMYEFWYNAVISTLKDFYKTGK |
| Ga0181343_10965252 | 3300017766 | Freshwater Lake | MFTFEEQYKKFEQLAERTKQAYEFWVNAVVSTVEDFYKPKKK |
| Ga0194038_11314441 | 3300020158 | Anoxic Zone Freshwater | MFTPDEQYKKYEEVLDRTKQAYEFWYNCLVSTWKDFYK |
| Ga0214224_10149832 | 3300020692 | Freshwater | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYKTYK |
| Ga0214198_100019210 | 3300020710 | Freshwater | MFTFDEQYKKYEELINRTKQAYDFWYNCLVSTWKDFYK |
| Ga0214207_10140641 | 3300020716 | Freshwater | MFTFEEQYKKYEEVLDRTKQAYEFWYSCLISTWKDFLKTGK |
| Ga0214178_10217351 | 3300020718 | Freshwater | MFTFEEQYKKFEQLNERTKQAYEFWINAVVSTWEDFFKPKKK |
| Ga0214246_10052084 | 3300020727 | Freshwater | MEKIMFTFEEQYKKFEQLNERTKQAYEFWINAVVSTWEDFFKPKKK |
| Ga0214206_10070052 | 3300021131 | Freshwater | MFTFEEQFKKFEELSERTKQAYEFWYSCIISTLKDFCKKK |
| Ga0214206_10224211 | 3300021131 | Freshwater | MNYFSFDEQYKKFEELAERTKQSYEFWVSCMASIWEDLVKPKKK |
| Ga0214166_10186853 | 3300021139 | Freshwater | MFTFDEQFKKYEDVLDRTKQAYEFWYNCLVSTWKDFYKTYK |
| Ga0194047_101265691 | 3300021354 | Anoxic Zone Freshwater | MFTFDEQIKKYEELADRTKQAYEFWYNCVLTTMKDFYKFGK |
| Ga0194047_103561721 | 3300021354 | Anoxic Zone Freshwater | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYK |
| Ga0194048_1000010444 | 3300021519 | Anoxic Zone Freshwater | MFTFDEQYKQLEEVTERTKQMYEFWYNAVVSTLKDFYKTGK |
| Ga0194048_101631432 | 3300021519 | Anoxic Zone Freshwater | MFTFDEQYKKFEELNERTKEAYKFWFNVMTSSWEDFFKPKKK |
| Ga0212088_101570905 | 3300022555 | Freshwater Lake Hypolimnion | MFSFEEQYKKFEELTERTKQVYEFWVNAVFANVQDFCKPKKK |
| Ga0236341_10025541 | 3300022591 | Freshwater | MFSFEEQYKKFEELTERTKQVYEFWVNAVFANVQDFYKPKKK |
| Ga0236341_10034786 | 3300022591 | Freshwater | MFTFDEQYKKYEELLDRTKQAYEFWVNCLTSTWEDFYKAKKK |
| Ga0236342_13929041 | 3300022592 | Freshwater | MFSFDEQYKKFEELSDRTKQAYEFWVNCVFSSFKDFLKTGK |
| Ga0236340_10877131 | 3300022594 | Freshwater | MFTFEEQYKKFEELSDRTKQAYEFWVNCVFSSFKDFLKTGK |
| Ga0248169_10065353 | 3300022602 | Freshwater | MFTFEEQYKKYEQLNERTKQAYEFWINAVVSTWEDFFKPKKK |
| Ga0248169_10645826 | 3300022602 | Freshwater | MFSFEEQYKKFEELSERTKQAYEFWYSCIISTLKDFCKKK |
| Ga0248169_1080455 | 3300022602 | Freshwater | MFSFEEQYKKFEELNERTKQAYEFWVNAISSTWEDFFKPKKK |
| Ga0256681_111044723 | 3300023311 | Freshwater | MFSFDEQYKKFEQLNDRTKQAYEFWVNAVVSTWEDFFKPKKK |
| Ga0256681_122359831 | 3300023311 | Freshwater | MFSFDEQYKKFEQLNDRTKQAYEFWVNAVVSTWED |
| Ga0209697_104330021 | 3300025316 | Freshwater Lake Hypolimnion | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYKTGK |
| Ga0207957_100165110 | 3300025372 | Freshwater | MFSFEEQYKKFEELSERTKQAYEFWYNCIMSTFKDFCKKK |
| Ga0208259_10554791 | 3300025375 | Freshwater | EKAMFTFDEQYKKYEELINRTKQAYDFWYNCLVSTWKDFYK |
| Ga0208250_10214002 | 3300025383 | Freshwater | MFTFDEQYKKFEEVIDRTKQAYEFWYNCILSTWEDFYKPKKK |
| Ga0208257_10059592 | 3300025389 | Freshwater | MFTFDEQYKKFEEVIERTKQAYDFWYNCLVSTWQDFYKTKK |
| Ga0208865_10606581 | 3300025411 | Freshwater | TEPNNLKEIKMFSFEEQYKKFEELNERTKQAYEFWVNAISSTWEDFFKPKKK |
| Ga0207954_100011610 | 3300025606 | Freshwater | MFTFEEQFKKYEVLVERTKEAYEFWVNCVFSSIKEYIKTGK |
| Ga0207954_11302611 | 3300025606 | Freshwater | MEKTMFSFEEQYKKFEELNERTKQAYEFWVKAVTSTVEDFFKPRKK |
| Ga0208613_11314961 | 3300025616 | Freshwater | MFTFDEQVKKYEEVLDRTKQAYEFWYNCVLSTMKDFYKFGK |
| Ga0208741_101774431 | 3300025723 | Freshwater | FTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKDFYKTYK |
| Ga0208872_10456816 | 3300025838 | Freshwater | MFTFDEQFKKYEEVLDRTKQAYEFWYNCLVSTWKD |
| Ga0209188_100149238 | 3300027708 | Freshwater Lake | MFTFEEQFKKYEQLLERTKETYEFWTNCVMSSWKDFLKTGK |
| Ga0209188_10093043 | 3300027708 | Freshwater Lake | MFSFEEQYKKFEELNERTKQAYEFWVKAVASTVEDFFKPRKK |
| Ga0209188_10329993 | 3300027708 | Freshwater Lake | MFTFEEQYKKFEQLNERTKQAYEFWLETITSTWEDLFKLRKK |
| Ga0209188_12283423 | 3300027708 | Freshwater Lake | MFTFDEQIKKYEEVLDRTQQMYEFWYNCVLSSMKDFYKFGK |
| Ga0209499_11149301 | 3300027712 | Freshwater Lake | MFTFDEQIKKYEEVLDRTQQMYEFWYNCVLSTMKDF |
| Ga0209087_100150919 | 3300027734 | Freshwater Lake | MFTFDEQIKKYEELADRTKQAYEFWYNCVLSTMKDFYKFGK |
| Ga0209085_10171443 | 3300027741 | Freshwater Lake | MFGFDEQYKKFEEVLDRTKQMYEFWSNAVMDTWKDLYKFKK |
| Ga0209085_10809713 | 3300027741 | Freshwater Lake | MFTFDEQIKKYEEVLDRTKQMYEFWYNCVLSTMKDFYKFGK |
| Ga0209085_11540943 | 3300027741 | Freshwater Lake | MERTMFTFDEQYKQFEEVANRTKQAYEFWYNCVIETLKDLYKTKK |
| Ga0209596_11107203 | 3300027754 | Freshwater Lake | MFTFDEQYKQLEQVAEKTKQAYEFWYNCLLSTLKDFYKTGK |
| Ga0209088_1000233813 | 3300027763 | Freshwater Lake | MFTFDEQYKKFEELNERTKEAYKFWFNVITSSWEDFFKPKKK |
| Ga0209134_103217181 | 3300027764 | Freshwater Lake | MFDFDKQYKEFEKLSERTKQAYEFWLKAVTSTWEDLFKLNKK |
| Ga0209829_1001384914 | 3300027777 | Freshwater Lake | MFTFDEQYKQFEEVANRTKQAYEFWYNCVIETLKDLYKTKK |
| Ga0209829_100747731 | 3300027777 | Freshwater Lake | MEKTMFSFEEQYKKFEELNERTKQAYEFWVKAVASTVEDFFKPRKK |
| Ga0209777_100336815 | 3300027896 | Freshwater Lake Sediment | MFTFDDQYKKFEEVIDRTKQAYEFWYNCILSTWEDFYKPKKK |
| Ga0209400_13919091 | 3300027963 | Freshwater Lake | MFTFDEQIKNYEEVLDRTKQMYEFWYNCVLSTMKDFYKFGK |
| Ga0209298_102871383 | 3300027973 | Freshwater Lake | TFDEQIKKYEELADRTKQAYEFWYNCVLSTMKDFYKFGK |
| Ga0315291_102224452 | 3300031707 | Sediment | MFTFDEQYKKFEEVTDRTKQMYEFWYNAFVSTLKDFYKTGK |
| Ga0315291_115949931 | 3300031707 | Sediment | FTFEEQYKKFEELNERTKQAYEFWINAVTSTWEDLFKPKKK |
| Ga0315293_101937333 | 3300031746 | Sediment | MFTFDEQYKKFEEVTDRTKQMYEFWFNAVVSTLKDFYKTGK |
| Ga0315288_101031233 | 3300031772 | Sediment | MFTFDEQYKKFEEVTDRTKQMYEFWYNAVVSTLKDFYKTGK |
| Ga0315909_108762821 | 3300031857 | Freshwater | MFTFDEQYKKFEQLNERNKEAYEFWLKAIVSTWEDLFKPKKK |
| Ga0315905_100356929 | 3300032092 | Freshwater | MFTFDEQYKKFEQLNERNKEAYEFWLKAVVSTWEDFFKPKKK |
| Ga0315273_121909431 | 3300032516 | Sediment | MFTFDEQYKKFEEVTDRTKQMYEFWYNAVVTTLKDFYKTGK |
| ⦗Top⦘ |