


| Basic Information | |
|---|---|
| Family ID | F065391 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQSNFRHQQFNTMPKLAGVIASGWSTINCGSLSYDRTPEIRRVREDVV |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 92.91 % |
| % of genes near scaffold ends (potentially truncated) | 49.61 % |
| % of genes from short scaffolds (< 2000 bps) | 51.18 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.819 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (31.496 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.465 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.953 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.74% β-sheet: 0.00% Coil/Unstructured: 80.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00301 | Rubredoxin | 14.96 |
| PF02627 | CMD | 7.09 |
| PF02915 | Rubrerythrin | 7.09 |
| PF05118 | Asp_Arg_Hydrox | 4.72 |
| PF00574 | CLP_protease | 3.94 |
| PF01041 | DegT_DnrJ_EryC1 | 3.15 |
| PF00578 | AhpC-TSA | 2.36 |
| PF03401 | TctC | 1.57 |
| PF04055 | Radical_SAM | 1.57 |
| PF13207 | AAA_17 | 1.57 |
| PF09825 | BPL_N | 1.57 |
| PF05637 | Glyco_transf_34 | 1.57 |
| PF01541 | GIY-YIG | 0.79 |
| PF04851 | ResIII | 0.79 |
| PF06508 | QueC | 0.79 |
| PF01242 | PTPS | 0.79 |
| PF13578 | Methyltransf_24 | 0.79 |
| PF16473 | Rv2179c-like | 0.79 |
| PF00375 | SDF | 0.79 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.79 |
| PF16363 | GDP_Man_Dehyd | 0.79 |
| PF07437 | YfaZ | 0.79 |
| PF11750 | DUF3307 | 0.79 |
| PF00313 | CSD | 0.79 |
| PF13394 | Fer4_14 | 0.79 |
| PF02518 | HATPase_c | 0.79 |
| PF07883 | Cupin_2 | 0.79 |
| PF13505 | OMP_b-brl | 0.79 |
| PF00487 | FA_desaturase | 0.79 |
| PF00881 | Nitroreductase | 0.79 |
| PF08433 | KTI12 | 0.79 |
| PF01583 | APS_kinase | 0.79 |
| PF04165 | DUF401 | 0.79 |
| PF04724 | Glyco_transf_17 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 7.87 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 7.87 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 7.09 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 7.09 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 4.72 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.94 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 3.15 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 3.15 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 3.15 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 3.15 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 3.15 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 3.15 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.57 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.79 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.79 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.79 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.79 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.79 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.79 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.79 |
| COG1906 | Predicted GntP-related membrane permease AF0261, DUF401 family | General function prediction only [R] | 0.79 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.79 |
| COG4088 | tRNA uridine 5-carbamoylmethylation protein Kti12 (Killer toxin insensitivity protein) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.18 % |
| Unclassified | root | N/A | 48.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c002052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4850 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1055352 | Not Available | 1366 | Open in IMG/M |
| 3300000756|JGI12421J11937_10003111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6668 | Open in IMG/M |
| 3300000756|JGI12421J11937_10129431 | Not Available | 648 | Open in IMG/M |
| 3300000867|EsTDRAFT_1014825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3110 | Open in IMG/M |
| 3300002131|M2t2BS1_1141208 | Not Available | 53515 | Open in IMG/M |
| 3300003277|JGI25908J49247_10002562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5811 | Open in IMG/M |
| 3300003375|JGI26470J50227_1007781 | Not Available | 2815 | Open in IMG/M |
| 3300003393|JGI25909J50240_1005728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3133 | Open in IMG/M |
| 3300003754|Ga0005853_1035961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1475 | Open in IMG/M |
| 3300003783|Ga0007850_1005141 | Not Available | 1155 | Open in IMG/M |
| 3300003783|Ga0007850_1016867 | Not Available | 548 | Open in IMG/M |
| 3300003787|Ga0007811_1002892 | Not Available | 2163 | Open in IMG/M |
| 3300003798|Ga0007842_1005836 | Not Available | 881 | Open in IMG/M |
| 3300003804|Ga0007817_1001671 | Not Available | 1841 | Open in IMG/M |
| 3300003804|Ga0007817_1004795 | Not Available | 996 | Open in IMG/M |
| 3300003813|Ga0007879_1014916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300003820|Ga0007863_1005243 | Not Available | 1416 | Open in IMG/M |
| 3300004124|Ga0066178_10000620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5299 | Open in IMG/M |
| 3300004124|Ga0066178_10028027 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300004687|Ga0065174_1074564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 636 | Open in IMG/M |
| 3300004763|Ga0007746_1424593 | Not Available | 3574 | Open in IMG/M |
| 3300004770|Ga0007804_1020702 | All Organisms → Viruses → Predicted Viral | 1829 | Open in IMG/M |
| 3300004770|Ga0007804_1081370 | Not Available | 832 | Open in IMG/M |
| 3300004777|Ga0007827_10136653 | Not Available | 547 | Open in IMG/M |
| 3300004810|Ga0007757_11389012 | Not Available | 589 | Open in IMG/M |
| 3300005517|Ga0070374_10478368 | Not Available | 622 | Open in IMG/M |
| 3300005527|Ga0068876_10411740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 753 | Open in IMG/M |
| 3300005528|Ga0068872_10087902 | Not Available | 1874 | Open in IMG/M |
| 3300005580|Ga0049083_10186818 | Not Available | 706 | Open in IMG/M |
| 3300005582|Ga0049080_10010650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3189 | Open in IMG/M |
| 3300005582|Ga0049080_10101091 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300005582|Ga0049080_10125676 | Not Available | 866 | Open in IMG/M |
| 3300005584|Ga0049082_10032414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1829 | Open in IMG/M |
| 3300005584|Ga0049082_10038065 | Not Available | 1685 | Open in IMG/M |
| 3300005662|Ga0078894_10147228 | Not Available | 2112 | Open in IMG/M |
| 3300005662|Ga0078894_11321031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300005912|Ga0075109_1020659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2716 | Open in IMG/M |
| 3300005941|Ga0070743_10041962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1565 | Open in IMG/M |
| 3300006071|Ga0007876_1009282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2853 | Open in IMG/M |
| 3300006072|Ga0007881_1115962 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006072|Ga0007881_1180719 | Not Available | 508 | Open in IMG/M |
| 3300006100|Ga0007806_1005889 | Not Available | 3122 | Open in IMG/M |
| 3300006101|Ga0007810_1003812 | Not Available | 4174 | Open in IMG/M |
| 3300006101|Ga0007810_1015243 | Not Available | 1837 | Open in IMG/M |
| 3300006105|Ga0007819_1005083 | Not Available | 3627 | Open in IMG/M |
| 3300006119|Ga0007866_1015777 | Not Available | 1601 | Open in IMG/M |
| 3300006123|Ga0007852_1029789 | Not Available | 1321 | Open in IMG/M |
| 3300006127|Ga0007805_1009487 | Not Available | 2505 | Open in IMG/M |
| 3300006128|Ga0007828_1010730 | Not Available | 1949 | Open in IMG/M |
| 3300006128|Ga0007828_1016677 | Not Available | 1548 | Open in IMG/M |
| 3300008950|Ga0102891_1253341 | Not Available | 501 | Open in IMG/M |
| 3300009182|Ga0114959_10010682 | Not Available | 6325 | Open in IMG/M |
| 3300009419|Ga0114982_1004112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5824 | Open in IMG/M |
| 3300010157|Ga0114964_10050866 | Not Available | 2172 | Open in IMG/M |
| 3300010157|Ga0114964_10303282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300010885|Ga0133913_10262865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4579 | Open in IMG/M |
| 3300010885|Ga0133913_10502219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3195 | Open in IMG/M |
| 3300010885|Ga0133913_11324732 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300012771|Ga0138270_1082363 | Not Available | 680 | Open in IMG/M |
| 3300012779|Ga0138284_1387199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300013004|Ga0164293_10105381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2158 | Open in IMG/M |
| 3300013093|Ga0164296_1024058 | All Organisms → cellular organisms → Bacteria | 3650 | Open in IMG/M |
| 3300013285|Ga0136642_1000788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15167 | Open in IMG/M |
| 3300013285|Ga0136642_1009454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3079 | Open in IMG/M |
| 3300013285|Ga0136642_1024538 | Not Available | 1746 | Open in IMG/M |
| 3300013286|Ga0136641_1214509 | Not Available | 507 | Open in IMG/M |
| 3300013372|Ga0177922_10926419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4060 | Open in IMG/M |
| 3300017761|Ga0181356_1249157 | Not Available | 507 | Open in IMG/M |
| 3300020151|Ga0211736_10382712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3523 | Open in IMG/M |
| 3300020161|Ga0211726_10939277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2460 | Open in IMG/M |
| 3300020172|Ga0211729_11088331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2833 | Open in IMG/M |
| 3300020205|Ga0211731_11194301 | Not Available | 6772 | Open in IMG/M |
| 3300020205|Ga0211731_11507859 | Not Available | 682 | Open in IMG/M |
| 3300020205|Ga0211731_11713598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2966 | Open in IMG/M |
| 3300020731|Ga0214170_1009903 | Not Available | 1907 | Open in IMG/M |
| 3300021137|Ga0214165_1027358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1389 | Open in IMG/M |
| 3300021139|Ga0214166_1000579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17932 | Open in IMG/M |
| 3300021142|Ga0214192_1054767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
| 3300021142|Ga0214192_1151491 | Not Available | 590 | Open in IMG/M |
| 3300021956|Ga0213922_1125512 | Not Available | 503 | Open in IMG/M |
| 3300022822|Ga0222646_101439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5692 | Open in IMG/M |
| 3300024346|Ga0244775_10029803 | All Organisms → cellular organisms → Bacteria | 4868 | Open in IMG/M |
| 3300024346|Ga0244775_10071864 | Not Available | 2965 | Open in IMG/M |
| 3300025358|Ga0208504_1000983 | Not Available | 6244 | Open in IMG/M |
| 3300025369|Ga0208382_1045127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300025379|Ga0208738_1004061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2841 | Open in IMG/M |
| 3300025383|Ga0208250_1000202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20496 | Open in IMG/M |
| 3300025383|Ga0208250_1002578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4136 | Open in IMG/M |
| 3300025389|Ga0208257_1024252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 919 | Open in IMG/M |
| 3300025421|Ga0207958_1020034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1110 | Open in IMG/M |
| 3300025429|Ga0208500_1007645 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300025430|Ga0208622_1042541 | Not Available | 840 | Open in IMG/M |
| 3300025430|Ga0208622_1067492 | Not Available | 612 | Open in IMG/M |
| 3300025438|Ga0208770_1078824 | Not Available | 574 | Open in IMG/M |
| 3300025466|Ga0208497_1040457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
| 3300025598|Ga0208379_1000248 | Not Available | 25271 | Open in IMG/M |
| 3300025723|Ga0208741_10120214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300025773|Ga0208104_1000076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18578 | Open in IMG/M |
| 3300025778|Ga0208388_1010134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1639 | Open in IMG/M |
| 3300027608|Ga0208974_1013100 | Not Available | 2659 | Open in IMG/M |
| 3300027631|Ga0208133_1008119 | Not Available | 2965 | Open in IMG/M |
| 3300027642|Ga0209135_1004166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5215 | Open in IMG/M |
| 3300027642|Ga0209135_1022168 | Not Available | 2282 | Open in IMG/M |
| 3300027741|Ga0209085_1360356 | Not Available | 535 | Open in IMG/M |
| 3300027763|Ga0209088_10269451 | Not Available | 700 | Open in IMG/M |
| 3300027782|Ga0209500_10020980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3805 | Open in IMG/M |
| 3300027785|Ga0209246_10223707 | Not Available | 732 | Open in IMG/M |
| 3300027797|Ga0209107_10001438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13350 | Open in IMG/M |
| 3300028394|Ga0304730_1003796 | Not Available | 10074 | Open in IMG/M |
| 3300031784|Ga0315899_10744593 | Not Available | 905 | Open in IMG/M |
| 3300032116|Ga0315903_10086789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3032 | Open in IMG/M |
| 3300032668|Ga0316230_1005533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8654 | Open in IMG/M |
| 3300032753|Ga0316224_1053986 | Not Available | 1680 | Open in IMG/M |
| 3300033992|Ga0334992_0003150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12346 | Open in IMG/M |
| 3300033992|Ga0334992_0006394 | All Organisms → cellular organisms → Bacteria | 8258 | Open in IMG/M |
| 3300033995|Ga0335003_0005773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6314 | Open in IMG/M |
| 3300034082|Ga0335020_0000046 | Not Available | 100131 | Open in IMG/M |
| 3300034082|Ga0335020_0034468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2747 | Open in IMG/M |
| 3300034093|Ga0335012_0459925 | Not Available | 611 | Open in IMG/M |
| 3300034095|Ga0335022_0006517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7247 | Open in IMG/M |
| 3300034105|Ga0335035_0026545 | Not Available | 3862 | Open in IMG/M |
| 3300034105|Ga0335035_0040657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3083 | Open in IMG/M |
| 3300034283|Ga0335007_0263494 | Not Available | 1153 | Open in IMG/M |
| 3300034356|Ga0335048_0015636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5457 | Open in IMG/M |
| 3300034356|Ga0335048_0017625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 5085 | Open in IMG/M |
| 3300034356|Ga0335048_0140860 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 31.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.66% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.72% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.36% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.57% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.57% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.79% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.79% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.79% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.79% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000867 | Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU | Environmental | Open in IMG/M |
| 3300002131 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012771 | Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0020529 | 3300000176 | Freshwater | MQSNFRHQHFNWMPKQVGVIASYWSAIDCGSLLSLDRTPE |
| TBL_comb48_EPIDRAFT_10553526 | 3300000439 | Freshwater | MQSNHRHQFNTMPKQVGFIASCWSAINSLSYDRLPEIRRVRRTVV* |
| JGI12421J11937_100031112 | 3300000756 | Freshwater And Sediment | MQSNVRHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEISRVRETVV* |
| JGI12421J11937_101294311 | 3300000756 | Freshwater And Sediment | MQSFNRHQQFNTMPKLAGVIACSWLSINGGSLSYD |
| EsTDRAFT_10148255 | 3300000867 | Freshwater And Marine | MQSNVRHQQFNTMPKQAGLIASNWSTINGGSLSYDRTPEISRVREGWDG* |
| M2t2BS1_114120894 | 3300002131 | Marine | MQSCNRQHTFNTMPKQAGLIASGWSAINCVSLSYDRTPEITGVQEGWDG* |
| JGI25908J49247_100025628 | 3300003277 | Freshwater Lake | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIRRVRETVM* |
| JGI26470J50227_10077813 | 3300003375 | Freshwater | MQSNFKHQQFNTMPKLAGVIACSWSAINSGSLSYDRTPEINSRVREDIL* |
| JGI25909J50240_10057287 | 3300003393 | Freshwater Lake | MQSCNRHHQFNTMPKQVGVIASYWLSINAGSLSSLDRTPEIRRVRETVV* |
| Ga0005853_10359614 | 3300003754 | Freshwater And Sediment | MQSNFKHQQFNTMPTLAGVIASSWSTINCGSLSYDRTPEIIRVREGWDG* |
| Ga0007850_10051416 | 3300003783 | Freshwater | MQSNVRHQQFNTMPKLAGVIASNWSAINGGSLSLDRTPEIYTRVREGWDD* |
| Ga0007850_10168672 | 3300003783 | Freshwater | NFRQHQFNTMPKQVGVIASYWSAINCGSLLSLDRTPEINSRVREDIM* |
| Ga0007811_10028924 | 3300003787 | Freshwater | MQSSFKHQQFNTMPKLAGVIACSWSAINGGSLSYDRTPEINSRVREDIL* |
| Ga0007842_10058362 | 3300003798 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAINCGSLSSLDRTPEITG |
| Ga0007817_10016716 | 3300003804 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAINCGSLLSLDRTPEITRVREDMM* |
| Ga0007817_10047953 | 3300003804 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSSLDRTPEINSRVREDIL* |
| Ga0007879_10149163 | 3300003813 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSSLDRTPEINS |
| Ga0007863_10052432 | 3300003820 | Freshwater | MQSNFKHQQFNTMPKLAGVIACSWSAINGGSLSYDRTPEINSRVREDIL* |
| Ga0066178_100006208 | 3300004124 | Freshwater Lake | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIRRVR |
| Ga0066178_100280271 | 3300004124 | Freshwater Lake | MQSCNRHHQFNTMPKQVGVIASYWLSINAGSLSSLDRTPEIRR |
| Ga0065174_10745641 | 3300004687 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINCGSLLSLDRTPEINSRVREDIM* |
| Ga0007746_14245933 | 3300004763 | Freshwater Lake | MQSNVKHQQFNTMPRLAGVIACSWLSINGGSLSYDRTPEIRRVR |
| Ga0007804_10207024 | 3300004770 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINCGSLSSLDRTPEITRVREDMM* |
| Ga0007804_10813704 | 3300004770 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAIDCGSLLSLDRTPEINSRVREDTL* |
| Ga0007827_101366531 | 3300004777 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINSGSLLSLDRTPEINSRVREDIL* |
| Ga0007757_113890121 | 3300004810 | Freshwater Lake | MQSSVRHQHFNTMPKQVGFIASNWLSIECGSLSYDRTPEIISGSTENKV* |
| Ga0070374_104783681 | 3300005517 | Freshwater Lake | MQSNVKHQQFNAMPKLAGLIASGWQAINCGSLSYDRTPEIRRVRGTVV* |
| Ga0068876_104117403 | 3300005527 | Freshwater Lake | MQSNFRHHQFNTMPKQVGVIASYWSAINCGSLSSLDRTPEIQRVRRT |
| Ga0068872_100879025 | 3300005528 | Freshwater Lake | MQSFNRHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEI |
| Ga0049083_101868183 | 3300005580 | Freshwater Lentic | MQSNVKHQQFNAMPKLAGLIASGWQAINCGSLSYDRTPEIRRVR |
| Ga0049080_100106506 | 3300005582 | Freshwater Lentic | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIRRVREGWDD* |
| Ga0049080_101010911 | 3300005582 | Freshwater Lentic | MQSNFRQSHFNTMPKQAGVIACSWLSINGGSLSYDRTP |
| Ga0049080_101256761 | 3300005582 | Freshwater Lentic | MQSSSRHSLFNTMPKQAGVIACSWLSINGGSLSYDRTPEISRVREGWDG* |
| Ga0049082_100324149 | 3300005584 | Freshwater Lentic | MQSNFRQSHFNTMPKLAGVIACSWLSINGGSLSYDRTPEIPRVRETVV* |
| Ga0049082_100380652 | 3300005584 | Freshwater Lentic | MQLSNRHQLFNTMPKQAGVIACAWLSINGGSLSYDRTPEISRVREDIV* |
| Ga0078894_101472283 | 3300005662 | Freshwater Lake | MQIVARHQQFNTMPKQAGFVASNWLSIECGSLSYDRTPEITRVREGWDG* |
| Ga0078894_113210312 | 3300005662 | Freshwater Lake | MQSTVRHQLFNKMPKQAGVIASNWLSIECGSLSYDRTPEI |
| Ga0075109_10206591 | 3300005912 | Saline Lake | MQSFNRQHTFNTMPKQLGVIASGWSAINCESLSYDRTPEITRVREGWDG* |
| Ga0070743_100419621 | 3300005941 | Estuarine | MQNIARHQQFNTMPKQVGVIASNWLSIDCGSLSYDRTPEILRVREDIV* |
| Ga0007876_10092821 | 3300006071 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSYDRTPEINSRVREDIM* |
| Ga0007881_11159623 | 3300006072 | Freshwater | MQSTFRHQLFNTMPKQAGVIACSWSAISGESLSYDRLPE |
| Ga0007881_11807191 | 3300006072 | Freshwater | MQSNHRHQFNTMPKLAGVIACSWSAINSGSLSYDRTPEINSRVRRTVV* |
| Ga0007806_10058896 | 3300006100 | Freshwater | MQSTFRHQLFNTMPKQAGVIASCWSAINSGSLSYD |
| Ga0007810_10038127 | 3300006101 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINCGSLSSLDRTPEISRVREDMM* |
| Ga0007810_10152435 | 3300006101 | Freshwater | MQSSFKHQQFNTMPKLAGVIACSWSAINGGSLSYDRTP |
| Ga0007819_10050837 | 3300006105 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINCGSLSSLDRTPEI |
| Ga0007866_10157771 | 3300006119 | Freshwater | KMQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSLDRTPEINTRVREDIL* |
| Ga0007852_10297894 | 3300006123 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAIDCGSLLSLDRTPEINSRVRED |
| Ga0007805_10094872 | 3300006127 | Freshwater | MQSTFRHQLFNTMPKQAGVIACSWSAISGESLSYDRLPEIRRVRRTVV* |
| Ga0007828_10107301 | 3300006128 | Freshwater | KMQSNFRQHQFNWMPKQVGVIASYWSAINCGSLLSLDRTPEITRVREDMM* |
| Ga0007828_10166772 | 3300006128 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAINCGSLSSLDRTPEITGVREDIL* |
| Ga0102891_12533411 | 3300008950 | Estuarine | MQSNFRHQQFNTMPKQVGVIASYWLSINAGSLSSLDRTPEIPRVRETVV |
| Ga0114959_1001068211 | 3300009182 | Freshwater Lake | MQSNFRQQQFNTIAKCGGVMPSYWLAINSGSLSSLDRTPEIRRVREDTV* |
| Ga0114982_100411211 | 3300009419 | Deep Subsurface | MQSFNRHQQFNTMPKQAGVIASNWLSIECGSLSYDRTPEIT |
| Ga0114964_100508663 | 3300010157 | Freshwater Lake | MQSNVKHQQFNTMPKLAGFIASGWSMINCGSLSYD |
| Ga0114964_103032821 | 3300010157 | Freshwater Lake | MQSNFRHQHFNTMPKQVGVIASYWLSINAGSLSSLDRTPEIRR |
| Ga0133913_102628656 | 3300010885 | Freshwater Lake | MQSNFRHQQFNTMPKQAGVTASNWLSIDCGSLSYDRTPEIIRVREDLM* |
| Ga0133913_105022191 | 3300010885 | Freshwater Lake | MQSNFRHQLFNTMPKQVGVIASYWSAINSGSLSSLDRTPEIIR |
| Ga0133913_113247324 | 3300010885 | Freshwater Lake | MQSNVKHQQFNTMPKLAGVIASGWSTINCGSLSYDRTPEIRRVREDVV* |
| Ga0138270_10823631 | 3300012771 | Freshwater Lake | MQSNFRHQLFNTMPKQAGIIACSWSSINGGSLSYDRTPEI |
| Ga0138284_13871991 | 3300012779 | Freshwater Lake | MQSNFRHQQFNTMPKLAGFIASGWSTINCGSLSYDRTP |
| Ga0164293_101053813 | 3300013004 | Freshwater | MQIVARHQQFNAMPKQAGFIASNWLSIECGSLSYDRTPEITRVREGWNG* |
| Ga0164296_10240584 | 3300013093 | Freshwater | MQSNFRHQQFNTMPKQAGVIACSWSAINSGSLSYDRTPEINSRVREDIL* |
| Ga0136642_10007883 | 3300013285 | Freshwater | MQSNFRQHQFNTMPKQVGVIASCWSAINLDSLSYDRTPEITRVREGWDG* |
| Ga0136642_10094541 | 3300013285 | Freshwater | MQSCNRHHQFNTMPKQVGVIASYWLSINAGSLSSLDRTPEIIGVQEGWDG* |
| Ga0136642_10245384 | 3300013285 | Freshwater | MQSCNRHHQFNTMPKQVGVIASYWSAINAGSLSSLDRTPEI |
| Ga0136641_12145091 | 3300013286 | Freshwater | MQSNFRHQLFNTMPKQAGVIASYWSAINGGSLSLD |
| Ga0177922_109264191 | 3300013372 | Freshwater | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEISRVRETVV* |
| Ga0181356_12491571 | 3300017761 | Freshwater Lake | MQSCNRHHQFNTMPKQVGVIASYWLSINAGSLSSLDR |
| Ga0211736_103827121 | 3300020151 | Freshwater | MQSNFRHQQFNTMPKLAGVIACSWLSINAGSLSYDRTPEIRRVREGWDG |
| Ga0211726_109392775 | 3300020161 | Freshwater | MQSNFRHQQFNTMPKQAGVIACGWLSINAGSLSYDRTPEITRVREAVM |
| Ga0211729_110883314 | 3300020172 | Freshwater | MQSFNRHQQFNTMPKQAGVIASNWSTIDCGSLSYDRTPEITRVREDIM |
| Ga0211731_111943013 | 3300020205 | Freshwater | MQSNFRHQQFNTMPKQAGLIASNWSTINGGSLSYDRTPESYTRVPETVM |
| Ga0211731_115078593 | 3300020205 | Freshwater | MQSNFRHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIR |
| Ga0211731_117135981 | 3300020205 | Freshwater | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIRRVREGWDG |
| Ga0214170_10099031 | 3300020731 | Freshwater | MQSNFRHQQFNTMPKQAGVIACSWSAINSGSLSYDRTPEIN |
| Ga0214165_10273581 | 3300021137 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAIDCGSLLSLDRTPEINSRVREDMM |
| Ga0214166_10005791 | 3300021139 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAINCGSLLSLD |
| Ga0214192_10547672 | 3300021142 | Freshwater | MQSNVRHQQFNTMPKLAGVIASNWSAINGGSLSLDRTPEIYTGVRE |
| Ga0214192_11514911 | 3300021142 | Freshwater | MQSNFRHQQFNTMPKQAGVIACSWSAINSGSLSYDRTPEINSR |
| Ga0213922_11255121 | 3300021956 | Freshwater | MQSFNRHQQFNTMPKQAGVIASNWLSIECGSLSYDRTPE |
| Ga0222646_10143912 | 3300022822 | Saline Water | MQSFNRQHTFNTMPKQLGVIASGWSAINCESLSYDRTPEITRVREGWDG |
| Ga0244775_1002980311 | 3300024346 | Estuarine | MLGKHMQSNFKHQLFNTMPKQAGVIACSWLSINSGSLSYDRTPEINRVQEDIV |
| Ga0244775_100718642 | 3300024346 | Estuarine | MQNIARHQQFNTMPKQAGVIASNWLSIDCGSLSYDRTPEITRVREGLM |
| Ga0208504_10009831 | 3300025358 | Freshwater | MQSNVRHQQFNTMPKLAGVIASNWSAINGGSLSLDRTPEIYTRVREGWDD |
| Ga0208382_10451272 | 3300025369 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSSLD |
| Ga0208738_10040615 | 3300025379 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSYDRTPEINSRVREDIM |
| Ga0208250_100020224 | 3300025383 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAINCGSLLSLDRTPEITRVREDMM |
| Ga0208250_10025785 | 3300025383 | Freshwater | MQSSFKHQQFNTMPKLAGVIACSWSAINGGSLSYDRTPEINSRVREDIL |
| Ga0208257_10242523 | 3300025389 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAINCGSLLSLDRTPEITRVRE |
| Ga0207958_10200341 | 3300025421 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINSGSLLSLDRTPEINS |
| Ga0208500_10076453 | 3300025429 | Freshwater | MQSNFKHQQFNTMPKLAVVIACSWSAINGGSLSYDRTPEINS |
| Ga0208622_10425412 | 3300025430 | Freshwater | MQSNHRHQFNTMPKLAGVIACSWSAINSGSLSYDRT |
| Ga0208622_10674921 | 3300025430 | Freshwater | MQSNVRHQQFNTMPKLAGVIASNWSAINGGSLSLDRTPEIYT |
| Ga0208770_10788242 | 3300025438 | Saline Lake | QSFNRQHTFNTMPKQLGVIASGWSAINCESLSYDRTPEITRVREGWDG |
| Ga0208497_10404571 | 3300025466 | Freshwater | MQSSFKHQQFNTMPKLAGVIACSWSAINGGSLSYDRTPEINSR |
| Ga0208379_10002483 | 3300025598 | Freshwater | MQSNFKHQQFNTMPKLAGVIACSWSAINGGSLSYDRTPEINSRVREDIL |
| Ga0208741_101202141 | 3300025723 | Freshwater | MQSNFKHQQFNTMPKLAGVIACSWSAINGGSLSYD |
| Ga0208104_100007619 | 3300025773 | Freshwater | MQSNFRQHQFNWMPKQVGVIASYWSAIDCGSLLSLDRTPEINSRVREDTL |
| Ga0208388_10101343 | 3300025778 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSLDRTPEIN |
| Ga0208974_101310013 | 3300027608 | Freshwater Lentic | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIRRVREGWDD |
| Ga0208133_10081195 | 3300027631 | Estuarine | MQNIARHQQFNTMPKQAGVIASNWLSIDCGSLSYDRTPEITRVREDLM |
| Ga0209135_10041663 | 3300027642 | Freshwater Lake | MQSNVKHQQFNTMPKLAGFIASGWLAINCGSLSYDRTPEIRRVRETVV |
| Ga0209135_10221684 | 3300027642 | Freshwater Lake | MQSTVKHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEIRRVRETVM |
| Ga0209085_13603562 | 3300027741 | Freshwater Lake | MQSTVKHQQFNTMPKLAGFIASGWSMINCGSLSYDR |
| Ga0209088_102694511 | 3300027763 | Freshwater Lake | MQSNFKHQQFNAMPKQAGLIASNWSTIDCGSLSYD |
| Ga0209500_100209803 | 3300027782 | Freshwater Lake | MQSNVKHQQFNTMPKLAGLIASGWLAINCGSLSYDRTPEIRRVRETVV |
| Ga0209246_102237072 | 3300027785 | Freshwater Lake | EKGLKRKKMQSNVKHQQFNTMPKLAGFIASGWLAINCGSLSYDRTPEIRRVRETVV |
| Ga0209107_1000143820 | 3300027797 | Freshwater And Sediment | MQSNVRHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEISRVRETV |
| Ga0304730_100379626 | 3300028394 | Freshwater Lake | MQSNFRHQQFNTMPKLAGVIASGWSTINCGSLSYDRTPEIRRVREDVV |
| Ga0315899_107445931 | 3300031784 | Freshwater | MQSFNRHQQFNTMPKLAGVIACSWLSINGGSLSYDRTPEISRVREDIV |
| Ga0315903_100867891 | 3300032116 | Freshwater | MQSFNRHQQFNTMPKQAGVIACAWLSINAGSLSYDRTPE |
| Ga0316230_10055331 | 3300032668 | Freshwater | MQSNFRQHQFNTMPKQVGVIASYWSAINGGSLSLDRAPEINSRVREDI |
| Ga0316224_10539864 | 3300032753 | Freshwater | MQSKVRHQHFNTMPKQVGVIASYWSAIDCGSLLSLDRTPEISRV |
| Ga0334992_0003150_3313_3462 | 3300033992 | Freshwater | MQSNFRHQQFNTMPKQAGFNASNWLSIECGSLSYDRTPEITRVREGWDG |
| Ga0334992_0006394_5046_5192 | 3300033992 | Freshwater | MQSFNRHQQFNTMPKQAGVIASNWSTIDCGSLSYDRTPEITRVREDLM |
| Ga0335003_0005773_6189_6314 | 3300033995 | Freshwater | QQFNTMPKQAGVIASNWSTIDCGSLSYDRTPEITRVREDLM |
| Ga0335020_0000046_30808_30954 | 3300034082 | Freshwater | MQSSNRHQQFNTMPKQVGVIACGWLSINAGSLSYDRTPEISRVRRTVV |
| Ga0335020_0034468_2607_2747 | 3300034082 | Freshwater | MQSNFRHQQFNTMPKQAGFNASNWLSIECGSLSYDRTPEITRVREGW |
| Ga0335012_0459925_3_116 | 3300034093 | Freshwater | MQIVARHQQFNAMPKQAGFIASNWLSIECGSLSYDRTP |
| Ga0335022_0006517_1391_1537 | 3300034095 | Freshwater | MQSFNRHQQFNTMPKQAGVIASNWSTIDCGSLSYDRTPEITRVREAVM |
| Ga0335035_0026545_3750_3860 | 3300034105 | Freshwater | MQSFNRHQFNTMPKQAGVIACGWLSINAGSLSYDRTP |
| Ga0335035_0040657_2952_3083 | 3300034105 | Freshwater | MQSNFRHQQFNTMPKQAGFNASNWLSIECGSLSYDRTPEITRVR |
| Ga0335007_0263494_1044_1151 | 3300034283 | Freshwater | MQNIARHQQFNTMPKQAGVIASNWSTIDCGSLSYDR |
| Ga0335048_0015636_5320_5457 | 3300034356 | Freshwater | FNRHQQFNTMPKQAGVIASNWSTIDCGSLSYDRTPEITRVREDLM |
| Ga0335048_0017625_2_136 | 3300034356 | Freshwater | MQSFNRHQQFNTMPKQAGVIASNWSTIDCGSLSYDRTPEITRVRE |
| Ga0335048_0140860_1_126 | 3300034356 | Freshwater | MQSSNRHQQFNTMPKQVGVIACGWLSINAGSLSYDRTPEISR |
| ⦗Top⦘ |