


| Basic Information | |
|---|---|
| Family ID | F065231 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.56 % |
| % of genes near scaffold ends (potentially truncated) | 96.09 % |
| % of genes from short scaffolds (< 2000 bps) | 92.19 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.469 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (39.844 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.344 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (71.094 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 65.00% β-sheet: 0.00% Coil/Unstructured: 35.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 28.12 |
| PF03237 | Terminase_6N | 3.91 |
| PF01510 | Amidase_2 | 1.56 |
| PF11753 | DUF3310 | 0.78 |
| PF05133 | Phage_prot_Gp6 | 0.78 |
| PF04545 | Sigma70_r4 | 0.78 |
| PF00166 | Cpn10 | 0.78 |
| PF00476 | DNA_pol_A | 0.78 |
| PF01726 | LexA_DNA_bind | 0.78 |
| PF03567 | Sulfotransfer_2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.47 % |
| All Organisms | root | All Organisms | 43.75 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10108339 | Not Available | 999 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10180971 | Not Available | 665 | Open in IMG/M |
| 3300001419|JGI11705J14877_10174216 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300001419|JGI11705J14877_10177251 | Not Available | 560 | Open in IMG/M |
| 3300001419|JGI11705J14877_10189687 | Not Available | 533 | Open in IMG/M |
| 3300001963|GOS2229_1003909 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300005215|Ga0069001_10142983 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005512|Ga0074648_1007915 | All Organisms → cellular organisms → Bacteria | 7531 | Open in IMG/M |
| 3300005512|Ga0074648_1070973 | Not Available | 1365 | Open in IMG/M |
| 3300005512|Ga0074648_1119735 | Not Available | 873 | Open in IMG/M |
| 3300005611|Ga0074647_1008714 | Not Available | 2039 | Open in IMG/M |
| 3300005733|Ga0076921_137244 | All Organisms → Viruses → environmental samples → uncultured marine virus | 543 | Open in IMG/M |
| 3300005748|Ga0076925_1036786 | All Organisms → Viruses → environmental samples → uncultured marine virus | 577 | Open in IMG/M |
| 3300006025|Ga0075474_10131176 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006026|Ga0075478_10073516 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300006027|Ga0075462_10106065 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300006027|Ga0075462_10111802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 845 | Open in IMG/M |
| 3300006027|Ga0075462_10124059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 796 | Open in IMG/M |
| 3300006027|Ga0075462_10258818 | Not Available | 514 | Open in IMG/M |
| 3300006400|Ga0075503_1005273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 800 | Open in IMG/M |
| 3300006402|Ga0075511_1782153 | Not Available | 1025 | Open in IMG/M |
| 3300006637|Ga0075461_10057763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1251 | Open in IMG/M |
| 3300006637|Ga0075461_10095223 | Not Available | 938 | Open in IMG/M |
| 3300006802|Ga0070749_10764386 | Not Available | 514 | Open in IMG/M |
| 3300006802|Ga0070749_10785022 | Not Available | 506 | Open in IMG/M |
| 3300006810|Ga0070754_10154639 | Not Available | 1094 | Open in IMG/M |
| 3300006810|Ga0070754_10314903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 699 | Open in IMG/M |
| 3300006867|Ga0075476_10140551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 906 | Open in IMG/M |
| 3300006916|Ga0070750_10305197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 680 | Open in IMG/M |
| 3300006916|Ga0070750_10489251 | Not Available | 505 | Open in IMG/M |
| 3300006919|Ga0070746_10459357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 564 | Open in IMG/M |
| 3300007234|Ga0075460_10281577 | Not Available | 548 | Open in IMG/M |
| 3300007234|Ga0075460_10285823 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300007236|Ga0075463_10214575 | Not Available | 619 | Open in IMG/M |
| 3300007345|Ga0070752_1252114 | Not Available | 686 | Open in IMG/M |
| 3300007345|Ga0070752_1394945 | Not Available | 512 | Open in IMG/M |
| 3300007346|Ga0070753_1279956 | Not Available | 600 | Open in IMG/M |
| 3300007538|Ga0099851_1113397 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300007538|Ga0099851_1142250 | Not Available | 897 | Open in IMG/M |
| 3300007538|Ga0099851_1236679 | Not Available | 656 | Open in IMG/M |
| 3300007539|Ga0099849_1242274 | Not Available | 665 | Open in IMG/M |
| 3300007539|Ga0099849_1278371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 608 | Open in IMG/M |
| 3300007542|Ga0099846_1337294 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300007609|Ga0102945_1080306 | Not Available | 601 | Open in IMG/M |
| 3300007623|Ga0102948_1256971 | Not Available | 533 | Open in IMG/M |
| 3300007640|Ga0070751_1102995 | Not Available | 1178 | Open in IMG/M |
| 3300007778|Ga0102954_1065418 | Not Available | 1010 | Open in IMG/M |
| 3300008012|Ga0075480_10598814 | Not Available | 522 | Open in IMG/M |
| 3300009000|Ga0102960_1011950 | Not Available | 3281 | Open in IMG/M |
| 3300009000|Ga0102960_1264223 | Not Available | 609 | Open in IMG/M |
| 3300009001|Ga0102963_1063156 | Not Available | 1525 | Open in IMG/M |
| 3300009001|Ga0102963_1312008 | Not Available | 619 | Open in IMG/M |
| 3300009027|Ga0102957_1119780 | Not Available | 925 | Open in IMG/M |
| 3300009027|Ga0102957_1321107 | Not Available | 569 | Open in IMG/M |
| 3300009423|Ga0115548_1090001 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009515|Ga0129286_10191858 | Not Available | 684 | Open in IMG/M |
| 3300009529|Ga0114919_10911205 | Not Available | 593 | Open in IMG/M |
| 3300009529|Ga0114919_11181639 | Not Available | 512 | Open in IMG/M |
| 3300010296|Ga0129348_1045315 | Not Available | 1590 | Open in IMG/M |
| 3300010297|Ga0129345_1131710 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300010297|Ga0129345_1265620 | Not Available | 598 | Open in IMG/M |
| 3300010299|Ga0129342_1324353 | Not Available | 527 | Open in IMG/M |
| 3300010300|Ga0129351_1307717 | Not Available | 599 | Open in IMG/M |
| 3300010300|Ga0129351_1335701 | Not Available | 568 | Open in IMG/M |
| 3300010318|Ga0136656_1320949 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010368|Ga0129324_10293879 | All Organisms → Viruses → environmental samples → uncultured marine virus | 640 | Open in IMG/M |
| 3300010430|Ga0118733_109223459 | Not Available | 508 | Open in IMG/M |
| 3300016735|Ga0182074_1576156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300016771|Ga0182082_1354961 | Not Available | 603 | Open in IMG/M |
| 3300017950|Ga0181607_10012541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6721 | Open in IMG/M |
| 3300017964|Ga0181589_10094437 | Not Available | 2174 | Open in IMG/M |
| 3300017964|Ga0181589_10447625 | Not Available | 843 | Open in IMG/M |
| 3300017971|Ga0180438_10586322 | Not Available | 827 | Open in IMG/M |
| 3300017991|Ga0180434_10510235 | Not Available | 923 | Open in IMG/M |
| 3300018041|Ga0181601_10713135 | Not Available | 504 | Open in IMG/M |
| 3300018080|Ga0180433_10723740 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018080|Ga0180433_11001864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 610 | Open in IMG/M |
| 3300018420|Ga0181563_10123199 | All Organisms → Viruses → Predicted Viral | 1664 | Open in IMG/M |
| 3300018421|Ga0181592_10128035 | unclassified Hyphomonas → Hyphomonas sp. | 1951 | Open in IMG/M |
| 3300018421|Ga0181592_10767648 | Not Available | 638 | Open in IMG/M |
| 3300018421|Ga0181592_10816946 | All Organisms → Viruses → environmental samples → uncultured marine virus | 613 | Open in IMG/M |
| 3300019751|Ga0194029_1001571 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
| 3300019765|Ga0194024_1032249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1139 | Open in IMG/M |
| 3300021356|Ga0213858_10397685 | Not Available | 647 | Open in IMG/M |
| 3300021356|Ga0213858_10462289 | Not Available | 590 | Open in IMG/M |
| 3300021497|Ga0193945_1047310 | All Organisms → Viruses | 549 | Open in IMG/M |
| 3300021958|Ga0222718_10090900 | Not Available | 1818 | Open in IMG/M |
| 3300021958|Ga0222718_10163384 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1246 | Open in IMG/M |
| 3300021958|Ga0222718_10201223 | All Organisms → Viruses | 1087 | Open in IMG/M |
| 3300021958|Ga0222718_10302859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 829 | Open in IMG/M |
| 3300021958|Ga0222718_10628450 | Not Available | 500 | Open in IMG/M |
| 3300021959|Ga0222716_10089391 | All Organisms → Viruses → Predicted Viral | 2100 | Open in IMG/M |
| 3300021960|Ga0222715_10308003 | All Organisms → Viruses | 897 | Open in IMG/M |
| 3300021962|Ga0222713_10623137 | All Organisms → Viruses | 626 | Open in IMG/M |
| 3300021964|Ga0222719_10295391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1053 | Open in IMG/M |
| 3300022053|Ga0212030_1057109 | All Organisms → Viruses | 555 | Open in IMG/M |
| 3300022057|Ga0212025_1042677 | Not Available | 780 | Open in IMG/M |
| 3300022063|Ga0212029_1044530 | Not Available | 639 | Open in IMG/M |
| 3300022068|Ga0212021_1025763 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300022071|Ga0212028_1004212 | All Organisms → Viruses | 1956 | Open in IMG/M |
| 3300022167|Ga0212020_1070275 | Not Available | 590 | Open in IMG/M |
| 3300022169|Ga0196903_1007974 | All Organisms → Viruses | 1344 | Open in IMG/M |
| 3300022198|Ga0196905_1133977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 644 | Open in IMG/M |
| 3300022306|Ga0224509_10259313 | All Organisms → Viruses | 628 | Open in IMG/M |
| 3300022308|Ga0224504_10086687 | All Organisms → Viruses | 1264 | Open in IMG/M |
| 3300022925|Ga0255773_10327550 | All Organisms → Viruses → environmental samples → uncultured marine virus | 613 | Open in IMG/M |
| 3300022926|Ga0255753_1110456 | All Organisms → Viruses | 1323 | Open in IMG/M |
| 3300023170|Ga0255761_10129150 | Not Available | 1529 | Open in IMG/M |
| 3300024433|Ga0209986_10081633 | Not Available | 1803 | Open in IMG/M |
| 3300025655|Ga0208795_1113146 | Not Available | 714 | Open in IMG/M |
| 3300025769|Ga0208767_1196092 | Not Available | 683 | Open in IMG/M |
| 3300025771|Ga0208427_1089533 | Not Available | 1077 | Open in IMG/M |
| 3300025803|Ga0208425_1013564 | All Organisms → Viruses | 2228 | Open in IMG/M |
| 3300025803|Ga0208425_1050818 | All Organisms → Viruses | 1033 | Open in IMG/M |
| 3300025822|Ga0209714_1081535 | Not Available | 941 | Open in IMG/M |
| 3300025828|Ga0208547_1121971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 774 | Open in IMG/M |
| 3300025879|Ga0209555_10311135 | Not Available | 600 | Open in IMG/M |
| 3300025889|Ga0208644_1017584 | Not Available | 4608 | Open in IMG/M |
| 3300025889|Ga0208644_1101577 | Not Available | 1414 | Open in IMG/M |
| 3300026183|Ga0209932_1075073 | All Organisms → Viruses | 777 | Open in IMG/M |
| 3300026187|Ga0209929_1096780 | Not Available | 771 | Open in IMG/M |
| 3300026187|Ga0209929_1132389 | All Organisms → Viruses | 622 | Open in IMG/M |
| 3300031578|Ga0307376_10322132 | All Organisms → Viruses | 1028 | Open in IMG/M |
| 3300032257|Ga0316205_10069715 | Not Available | 1578 | Open in IMG/M |
| 3300032274|Ga0316203_1210298 | Not Available | 535 | Open in IMG/M |
| 3300034375|Ga0348336_012142 | Not Available | 5053 | Open in IMG/M |
| 3300034375|Ga0348336_046828 | Not Available | 1824 | Open in IMG/M |
| 3300034375|Ga0348336_174934 | Not Available | 605 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 39.84% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.16% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 7.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.03% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.25% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 3.12% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.34% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 2.34% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 2.34% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.56% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.56% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.56% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.56% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.56% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.56% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.56% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.78% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.78% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.78% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300005215 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005733 | Seawater microbial communities from Vineyard Sound, MA, USA - crude oil ammended T14 | Environmental | Open in IMG/M |
| 3300005748 | Seawater microbial communities from Vineyard Sound, MA, USA - control T7 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021497 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_0-1_MG | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101083391 | 3300000117 | Marine | RVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH* |
| DelMOWin2010_101809713 | 3300000117 | Marine | NIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| JGI11705J14877_101742163 | 3300001419 | Saline Water And Sediment | RVDGMMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGNH* |
| JGI11705J14877_101772511 | 3300001419 | Saline Water And Sediment | NNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGNH* |
| JGI11705J14877_101896873 | 3300001419 | Saline Water And Sediment | IRVDGMMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGDH* |
| GOS2229_10039094 | 3300001963 | Marine | MNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0069001_101429833 | 3300005215 | Natural And Restored Wetlands | MNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0074648_100791514 | 3300005512 | Saline Water And Sediment | RVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNSH* |
| Ga0074648_10709731 | 3300005512 | Saline Water And Sediment | GMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0074648_11197352 | 3300005512 | Saline Water And Sediment | MNNKVNINRLQMDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0074647_10087141 | 3300005611 | Saline Water And Sediment | GMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0076921_1372441 | 3300005733 | Marine | GLEKLTLRVDGMMNNKVNINRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0076925_10367863 | 3300005748 | Marine | EGLEKLTLRVDGMMNNKVNINRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0075474_101311764 | 3300006025 | Aqueous | VDGMMNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0075478_100735161 | 3300006026 | Aqueous | KVNIERLQKDFERLYIDVEKLKDSVRSNIGKLNGDH* |
| Ga0075462_101060655 | 3300006027 | Aqueous | DGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0075462_101118021 | 3300006027 | Aqueous | EQNMTNKVNIERLQSDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0075462_101240594 | 3300006027 | Aqueous | GMMNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0075462_102588182 | 3300006027 | Aqueous | MNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0075503_10052731 | 3300006400 | Aqueous | NKVNIERLQSDVERLRIDVEKLKDSVRANLGKLNGNH* |
| Ga0075511_17821531 | 3300006402 | Aqueous | RVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0075461_100577631 | 3300006637 | Aqueous | EGLEKLTIRVDDMMNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0075461_100952231 | 3300006637 | Aqueous | MMNNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGNH* |
| Ga0070749_107643861 | 3300006802 | Aqueous | DGMMNYRVIIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0070749_107850221 | 3300006802 | Aqueous | NIERLQTDVERLRIDVEKLKDSVRANLGKLNGNSH* |
| Ga0070754_101546391 | 3300006810 | Aqueous | VDGMMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGNH* |
| Ga0070754_103149031 | 3300006810 | Aqueous | VNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0075476_101405515 | 3300006867 | Aqueous | MMNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0070750_103051971 | 3300006916 | Aqueous | MTNKVNIERLQQDVERLRIDVEKLKDSVRANIGKLNGTH* |
| Ga0070750_104892511 | 3300006916 | Aqueous | LTIRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0070746_104593573 | 3300006919 | Aqueous | DMMNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0075460_102815771 | 3300007234 | Aqueous | RVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRTNIGKLNGNH* |
| Ga0075460_102858231 | 3300007234 | Aqueous | MMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0075463_102145753 | 3300007236 | Aqueous | GLEKLTIRVDDMMNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGTH* |
| Ga0070752_12521143 | 3300007345 | Aqueous | LEKLTVRVDDMMNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0070752_13949453 | 3300007345 | Aqueous | NKVNIERLQQDVERLRIDVEKLKDSVRANIGKLNGTH* |
| Ga0070753_12799561 | 3300007346 | Aqueous | RVNIERLQTDVERLRIDVEKLKDSVRANLGKLNGNSH* |
| Ga0099851_11133971 | 3300007538 | Aqueous | TVRVDGMMNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0099851_11422501 | 3300007538 | Aqueous | VNIERLQTDVERLRIDVEKLKDSVRANLGKLNGNSH* |
| Ga0099851_12366791 | 3300007538 | Aqueous | MMNNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGDH* |
| Ga0099849_12422743 | 3300007539 | Aqueous | MNNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGNH* |
| Ga0099849_12783711 | 3300007539 | Aqueous | IRVDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGAH* |
| Ga0099846_13372943 | 3300007542 | Aqueous | VRVDGMMNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0102945_10803063 | 3300007609 | Pond Water | KIERLKTDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0102948_12569713 | 3300007623 | Water | DGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0070751_11029954 | 3300007640 | Aqueous | DGMMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGNH* |
| Ga0102954_10654183 | 3300007778 | Water | NRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGDH* |
| Ga0075480_105988143 | 3300008012 | Aqueous | LEKLTVRVDGMMNNRVKIERLQTDVERLRVDVEKLKDSVRANIGKLNGNH* |
| Ga0102960_10119501 | 3300009000 | Pond Water | RVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0102960_12642231 | 3300009000 | Pond Water | NIERIQKDIEKILSDVEKLKDSVRANLGKLNGDH* |
| Ga0102963_10631561 | 3300009001 | Pond Water | VDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0102963_13120083 | 3300009001 | Pond Water | MMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGNH* |
| Ga0102957_11197801 | 3300009027 | Pond Water | NIDRLQQDVERLRIDVEKLKDSVRANIGKLNGDH* |
| Ga0102957_13211073 | 3300009027 | Pond Water | TRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGSH* |
| Ga0115548_10900011 | 3300009423 | Pelagic Marine | RVDDMMKNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0129286_101918581 | 3300009515 | Sediment | RVDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH* |
| Ga0114919_109112052 | 3300009529 | Deep Subsurface | MKNNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGDH* |
| Ga0114919_111816391 | 3300009529 | Deep Subsurface | RVDGMMNNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGNH* |
| Ga0129348_10453154 | 3300010296 | Freshwater To Marine Saline Gradient | IRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0129345_11317101 | 3300010297 | Freshwater To Marine Saline Gradient | RVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0129345_12656203 | 3300010297 | Freshwater To Marine Saline Gradient | KAGATVTIRVDDMMNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH* |
| Ga0129342_13243531 | 3300010299 | Freshwater To Marine Saline Gradient | MIKNRINNERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0129351_13077173 | 3300010300 | Freshwater To Marine Saline Gradient | VNIERLQSDVERLRIDVEKLKDSVRANIGKLNGDH* |
| Ga0129351_13357013 | 3300010300 | Freshwater To Marine Saline Gradient | VDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH* |
| Ga0136656_13209493 | 3300010318 | Freshwater To Marine Saline Gradient | MNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH* |
| Ga0129324_102938791 | 3300010368 | Freshwater To Marine Saline Gradient | KVNIDRLQTDVERLRIDVEKLKDSVRANLGKLNGNH* |
| Ga0118733_1092234591 | 3300010430 | Marine Sediment | NKVNIERLQQDVERLRIDTEKLKDSVRTNIGKLNGDK* |
| Ga0182074_15761561 | 3300016735 | Salt Marsh | NMTNKVNIERLQKDVDKILVDVEKLKDSVRANLGKLNGDH |
| Ga0182082_13549611 | 3300016771 | Salt Marsh | VNINRLQQDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0181607_100125411 | 3300017950 | Salt Marsh | KVNIERLQLDVERLRIDVEKLKDSVRANLGKLNGNH |
| Ga0181589_100944375 | 3300017964 | Salt Marsh | MKNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0181589_104476252 | 3300017964 | Salt Marsh | MMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0180438_105863221 | 3300017971 | Hypersaline Lake Sediment | TIRVDDMMNNKVNINRLQMDVERLRVDTEKLKDSVRANIGKLNGNH |
| Ga0180434_105102351 | 3300017991 | Hypersaline Lake Sediment | IRVDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNSH |
| Ga0181601_107131351 | 3300018041 | Salt Marsh | RVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0180433_107237401 | 3300018080 | Hypersaline Lake Sediment | TVRVDGMMNNRVNIERLQMDVNKLQIDVEKLKDSVRANIGKLNGNH |
| Ga0180433_110018643 | 3300018080 | Hypersaline Lake Sediment | GMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0181563_101231991 | 3300018420 | Salt Marsh | QEQNKTNKVNIERLQSDVERLRIDREKLKDSVRANIGKLNGSH |
| Ga0181592_101280351 | 3300018421 | Salt Marsh | MMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0181592_107676481 | 3300018421 | Salt Marsh | NKVNIERLQSDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0181592_108169463 | 3300018421 | Salt Marsh | ERVDAMMNNKVNIDRLQTDVERLRIDVEKLKDSVRANLGKLNGNH |
| Ga0194029_10015711 | 3300019751 | Freshwater | NNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0194024_10322494 | 3300019765 | Freshwater | VNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0213858_103976851 | 3300021356 | Seawater | VNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0213858_104622891 | 3300021356 | Seawater | DMMNNKVNINRLQMDVERLRIDTEKLKDSVRTNIGKLNGNH |
| Ga0193945_10473101 | 3300021497 | Sediment | MMNNRVNIERLQTDVERLRVDVEKLKDSVRANIGKLNGNH |
| Ga0222718_100909004 | 3300021958 | Estuarine Water | MTNKVNIERLQQDVERLRVDVEKLKDSVRANIGKLNGDH |
| Ga0222718_101633841 | 3300021958 | Estuarine Water | IRVDGMMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGNH |
| Ga0222718_102012231 | 3300021958 | Estuarine Water | KVNIERLQSDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0222718_103028591 | 3300021958 | Estuarine Water | NNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0222718_106284501 | 3300021958 | Estuarine Water | VDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGGH |
| Ga0222716_100893915 | 3300021959 | Estuarine Water | QNMTNKVNIERLQLDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0222715_103080034 | 3300021960 | Estuarine Water | VDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0222713_106231371 | 3300021962 | Estuarine Water | TKRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0222719_102953911 | 3300021964 | Estuarine Water | TIRVDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGTH |
| Ga0212030_10571091 | 3300022053 | Aqueous | ESDGMMNNRVNIERLQKDVDRISIDVEKLKDSVRANIGKLNGAH |
| Ga0212025_10426774 | 3300022057 | Aqueous | TERVDAMMNNKVNIDRLQNDVERLRIDVEKLKDSVRANLGKLNGNH |
| Ga0212029_10445302 | 3300022063 | Aqueous | IRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0212021_10257634 | 3300022068 | Aqueous | GQNMTNKVNILRLQSDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0212028_10042121 | 3300022071 | Aqueous | RVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0212020_10702751 | 3300022167 | Aqueous | DMMNNKVNIDRLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0196903_10079746 | 3300022169 | Aqueous | MMNNRVNIERLQTDVERLRIDVEKLKDSVRANLGKLNGNSH |
| Ga0196905_11339773 | 3300022198 | Aqueous | VNIERLQKDVDKILVDVEKLKDSVRANLGKLNGDH |
| Ga0224509_102593133 | 3300022306 | Sediment | MMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0224504_100866877 | 3300022308 | Sediment | LTIRVDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0255773_103275501 | 3300022925 | Salt Marsh | VNIDRLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0255753_11104566 | 3300022926 | Salt Marsh | KVNINRLQQDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0255761_101291501 | 3300023170 | Salt Marsh | MMNNKVNINRLQTDVERLRIDVEKLKDSVRANIGKLNGNY |
| Ga0209986_100816335 | 3300024433 | Deep Subsurface | NNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0208795_11131461 | 3300025655 | Aqueous | NRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0208767_11960921 | 3300025769 | Aqueous | DGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0208427_10895334 | 3300025771 | Aqueous | VDGMMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0208425_10135641 | 3300025803 | Aqueous | EQNMTNKVNIERLQSDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0208425_10508185 | 3300025803 | Aqueous | TTRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0209714_10815353 | 3300025822 | Pelagic Marine | MMNNRVNIERLQQDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0208547_11219713 | 3300025828 | Aqueous | MNNKVNINRLQIDVERLRVDVEKLKDSVRANIGKLNGTH |
| Ga0209555_103111351 | 3300025879 | Marine | MTNKVNIERLQQDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0208644_101758412 | 3300025889 | Aqueous | KLTFRVDGMMNNRVNIERLQMDVGKLQVDVEKLKDSVRANIGKLNGNH |
| Ga0208644_11015771 | 3300025889 | Aqueous | GMMNNRVNIERLQMDVERLRVDTEKLKDSVRANIGKLNGNH |
| Ga0209932_10750731 | 3300026183 | Pond Water | RVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0209929_10967804 | 3300026187 | Pond Water | LEKLTIRVDDMMNNKVNIDRLQQDVERLRIDTEKLKDSVRANIGKLNGDH |
| Ga0209929_11323891 | 3300026187 | Pond Water | NRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGNH |
| Ga0307376_103221321 | 3300031578 | Soil | KVNIERLQKDVDRISIDVEKLKDSVRANIGKLNGNSH |
| Ga0316205_100697155 | 3300032257 | Microbial Mat | TRVDGMMNNRVNIERLQMDVERLRIDTEKLKDSVRTNIGKLNGDK |
| Ga0316203_12102981 | 3300032274 | Microbial Mat | VNIERLQQDVERLRIDVEKLKDSVRANLGKLNGNH |
| Ga0348336_012142_4940_5053 | 3300034375 | Aqueous | NKVNINRLQMDVERLRIDTEKLKDSVRANIGKLNGNH |
| Ga0348336_046828_1685_1807 | 3300034375 | Aqueous | MMNNRVNIERLQTDVERLRIDVEKLKDSVRANIGKLNGDH |
| Ga0348336_174934_11_130 | 3300034375 | Aqueous | MTNKVNIERLQSDVERLRIDVEKLKDSVRANIGKLNGDH |
| ⦗Top⦘ |